Citrus Sinensis ID: 007571

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------60
MKEGNPSKRRASILKFFRELPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMAALIWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTWVEQRVAVRALGHLATYPSTFPTVASHAEILELSIQLAMSSLEIVYSHFYQYFDRRLSYHCDLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLPAICKPEFLAKLPGMWGGLVNENSPAGIGLLRTICHHKLGRGPVASCPGLIEALCNIARSSDDWQYMAIDCLLWLLQDPSTCHKVIDKAVPTLIDLAEITNLGDHKKLGDSIVNVLQDCIQLQGTVRSSPSNRSKEQIEELLNSRQRLKWEKNMLKEDLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLDAILFINECSQSNDPDLSLRQNKVPDYAERLVKKQMRAAWLFREAAIKHGGVHGEGNSGNIYGHETDDSEWETASESDIGNDGRDEMGDEDDDSEWKNEDERKDKYDKPPMKA
ccccccHHHHHHHHHHHHHcccccccccEEEHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHcHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHcccHHHHccccccccccc
cccccHHHHHHHHHHHHHHcccccccccEEEEHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHccccEEEEHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccccccHHHHHHHHHHcccccHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEccHccccccccccccccccccccccccccccccccccccc
mkegnpskrRASILKFFrelpsqdddgqvlpisglwntamahpndpefiELGIFECMAALIWKGlknrrwlshdqniyipYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTWVEQRVAVRALGhlatypstfptvaSHAEILELSIQLAMSSLEIVYSHFYQYFDRRLSYHCDlltrgmggvemeSRKAEEWASQLQCWSLQLIncfafkpeflpaickpeflaklpgmwgglvnenspagIGLLRTICHhklgrgpvascpGLIEALCNIARSSDDWQYMAIDCLLWllqdpstchkvidKAVPTLIDLaeitnlgdhkklgDSIVNVLQDCIQlqgtvrsspsnrsKEQIEELLNSRQRLKWEKNMLKEDLHIKQAAALVVKLEGnslfsagnisGAASKYSEALalcpmrskkERVVLYSNRAQCHLLMQQPLAAISDATRALClhnplnrhAKSLWRRAQAYDMLALAKESLLDAILFINEcsqsndpdlslrqnkvpDYAERLVKKQMRAAWLFREAAIKhggvhgegnsgniyghetddsewetasesdigndgrdemgdedddsewknederkdkydkppmka
mkegnpskrrASILKFFrelpsqdddgQVLPISGLWNTAMAHPNDPEFIELGIFECMAALIWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTWVEQRVAVRALGHLATYPSTFPTVASHAEILELSIQLAMSSLEIVYSHFYQYFDRRLSYHCDLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLPAICKPEFLAKLPGMWGGLVNENSPAGIGLLRTICHHKLGRGPVASCPGLIEALCNIARSSDDWQYMAIDCLLWLLQDPSTCHKVIDKAVPTLIDLAEITNLGDHKKLGDSIVNVLQDCIQLqgtvrsspsnrskEQIEELLNSRQRLKWEKNMLKEDLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLDAILFINECsqsndpdlslrqnKVPDYAERLVKKQMRAAWLFREAAIKHggvhgegnsgniYGHETDDSEWETasesdigndgrdemgdedddsewknederkdkydkppmka
MKEGNPSKRRASILKFFRELPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMAALIWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTWVEQRVAVRALGHLATYPSTFPTVASHAEILELSIQLAMSSLEIVYSHFYQYFDRRLSYHCDLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLPAICKPEFLAKLPGMWGGLVNENSPAGIGLLRTICHHKLGRGPVASCPGLIEALCNIARSSDDWQYMAIDCLLWLLQDPSTCHKVIDKAVPTLIDLAEITNLGDHKKLGDSIVNVLQDCIQLQGTVRSSPSNRSKEQIEELLNSRQRLKWEKNMLKEDLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLDAILFINECSQSNDPDLSLRQNKVPDYAERLVKKQMRAAWLFREAAIKHGGVHGEGNSGNIYGHETDDSEWETASESDIgndgrdemgdedddseWKNEDERKDKYDKPPMKA
**************KFF**********QVLPISGLWNTAMAHPNDPEFIELGIFECMAALIWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTWVEQRVAVRALGHLATYPSTFPTVASHAEILELSIQLAMSSLEIVYSHFYQYFDRRLSYHCDLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLPAICKPEFLAKLPGMWGGLVNENSPAGIGLLRTICHHKLGRGPVASCPGLIEALCNIARSSDDWQYMAIDCLLWLLQDPSTCHKVIDKAVPTLIDLAEITNLGDHKKLGDSIVNVLQDCIQLQG************************KWEKNMLKEDLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLDAILFINECS***************DYAERLVKKQMRAAWLFREAAIKHGGVHG***********************************************************
***********SILKFFRELPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMAALIWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTWVEQRVAVRALGHLATYPSTFPTVASHAEILELSIQLAMSSLEIVYSHFYQYFDRRLSYHCDLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLPAICKPEFLAKLPGMWGGLVNENSPAGIGLLRTICHHKLGRGPVASCPGLIEALCNIARSSDDWQYMAIDCLLWLLQDPSTCHKVIDKAVPTLIDL**************************************************************************LEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLDAILFINE*********************************************************************************************************
*********RASILKFFRELPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMAALIWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTWVEQRVAVRALGHLATYPSTFPTVASHAEILELSIQLAMSSLEIVYSHFYQYFDRRLSYHCDLLTRGMGGVEM*********SQLQCWSLQLINCFAFKPEFLPAICKPEFLAKLPGMWGGLVNENSPAGIGLLRTICHHKLGRGPVASCPGLIEALCNIARSSDDWQYMAIDCLLWLLQDPSTCHKVIDKAVPTLIDLAEITNLGDHKKLGDSIVNVLQDCIQLQG**************EELLNSRQRLKWEKNMLKEDLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLDAILFINECSQSNDPDLSLRQNKVPDYAERLVKKQMRAAWLFREAAIKHGGVHGEGNSGNIYGHET************IGNDG******************************
*****PSKRRASILKFFRELPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMAALIWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTWVEQRVAVRALGHLATYPSTFPTVASHAEILELSIQLAMSSLEIVYSHFYQYFDRRLSYHCDLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLPAICKPEFLAKLPGMWGGLVNENSPAGIGLLRTICHHKLGRGPVASCPGLIEALCNIARSSDDWQYMAIDCLLWLLQDPSTCHKVIDKAVPTLIDLAEITNLGDHKKLGDSIVNVLQDCIQLQ*******SNRSKEQIEELLNSRQRLKWEKNMLKEDLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLDAILFINECSQSNDPDLSLRQNKVPDYAERLVKKQMRAAWLFREAAIKH****************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEGNPSKRRASILKFFRELPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMAALIWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTWVEQRVAVRALGHLATYPSTFPTVASHAEILELSIQLAMSSLEIVYSHFYQYFDRRLSYHCDLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLPAICKPEFLAKLPGMWGGLVNENSPAGIGLLRTICHHKLGRGPVASCPGLIEALCNIARSSDDWQYMAIDCLLWLLQDPSTCHKVIDKAVPTLIDLAEITNLGDHKKLGDSIVNVLQDCIQLQGTVRSSPxxxxxxxxxxxxxxxxxxxxxxxxxxxxLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLDAILFINECSQSNDPDLSLRQNKVPDYAERLVKKQMRAAWLFREAAIKHGGVHGEGNSGNIYGHETDDSEWETASESDIGNDGRDEMGDEDDDSEWKNEDERKDKYDKPPMKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query598 2.2.26 [Sep-21-2011]
Q99614292 Tetratricopeptide repeat yes no 0.190 0.390 0.350 5e-11
Q3ZBR5292 Tetratricopeptide repeat yes no 0.190 0.390 0.350 2e-10
Q3KRD5309 Mitochondrial import rece yes no 0.183 0.355 0.411 3e-10
Q91Z38292 Tetratricopeptide repeat yes no 0.190 0.390 0.350 9e-10
Q15785309 Mitochondrial import rece no no 0.183 0.355 0.386 4e-09
A4K2V0309 Mitochondrial import rece no no 0.183 0.355 0.386 4e-09
Q9CYG7309 Mitochondrial import rece no no 0.137 0.265 0.422 2e-08
Q07617 926 Sperm-associated antigen no no 0.155 0.100 0.414 3e-07
Q6DGE9 934 Protein unc-45 homolog B no no 0.142 0.091 0.375 4e-07
Q75Q39 610 Mitochondrial import rece no no 0.160 0.157 0.363 5e-07
>sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens GN=TTC1 PE=1 SV=1 Back     alignment and function desciption
 Score = 70.1 bits (170), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 66/117 (56%), Gaps = 3/117 (2%)

Query: 370 LKWEKNMLKEDLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVL 429
           ++ EKNM  E+   ++  +  +K EGN  F  G+   A S YS AL +CP   +KER +L
Sbjct: 98  IELEKNMSDEEKQKRREESTRLKEEGNEQFKKGDYIEAESSYSRALEMCPSCFQKERSIL 157

Query: 430 YSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLD 486
           +SNRA   +   +   AI+D ++A+ L NP   + +++ RRA+ Y+      E+L D
Sbjct: 158 FSNRAAARMKQDKKEMAINDCSKAIQL-NP--SYIRAILRRAELYEKTDKLDEALED 211

Homo sapiens (taxid: 9606)
>sp|Q3ZBR5|TTC1_BOVIN Tetratricopeptide repeat protein 1 OS=Bos taurus GN=TTC1 PE=2 SV=1 Back     alignment and function description
>sp|Q3KRD5|TOM34_RAT Mitochondrial import receptor subunit TOM34 OS=Rattus norvegicus GN=Tomm34 PE=2 SV=1 Back     alignment and function description
>sp|Q91Z38|TTC1_MOUSE Tetratricopeptide repeat protein 1 OS=Mus musculus GN=Ttc1 PE=2 SV=1 Back     alignment and function description
>sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens GN=TOMM34 PE=1 SV=2 Back     alignment and function description
>sp|A4K2V0|TOM34_PONAB Mitochondrial import receptor subunit TOM34 OS=Pongo abelii GN=TOMM34 PE=2 SV=1 Back     alignment and function description
>sp|Q9CYG7|TOM34_MOUSE Mitochondrial import receptor subunit TOM34 OS=Mus musculus GN=Tomm34 PE=2 SV=1 Back     alignment and function description
>sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens GN=SPAG1 PE=1 SV=3 Back     alignment and function description
>sp|Q6DGE9|UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio GN=unc45b PE=1 SV=2 Back     alignment and function description
>sp|Q75Q39|TOM70_RAT Mitochondrial import receptor subunit TOM70 OS=Rattus norvegicus GN=Tomm70a PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query598
255584994627 heat shock protein 70 (HSP70)-interactin 0.998 0.952 0.941 0.0
224083703618 predicted protein [Populus trichocarpa] 1.0 0.967 0.919 0.0
356511097627 PREDICTED: uncharacterized protein LOC10 0.994 0.948 0.896 0.0
356525485627 PREDICTED: uncharacterized protein LOC10 0.994 0.948 0.897 0.0
449451439615 PREDICTED: uncharacterized protein LOC10 0.951 0.925 0.905 0.0
7960739621 putative protein [Arabidopsis thaliana] 0.986 0.950 0.851 0.0
79510032631 ARM-repeat/tetratricopeptide repeat-like 0.986 0.935 0.851 0.0
297807053630 binding protein [Arabidopsis lyrata subs 0.986 0.936 0.851 0.0
217426797630 AT5G10200-like protein [Arabidopsis aren 0.986 0.936 0.849 0.0
72384486631 80A08_17 [Brassica rapa subsp. pekinensi 0.986 0.935 0.833 0.0
>gi|255584994|ref|XP_002533208.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223526984|gb|EEF29179.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1139 bits (2947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/598 (94%), Positives = 576/598 (96%), Gaps = 1/598 (0%)

Query: 1   MKEGNPSKRRASILKFFRELPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMAAL 60
           MKEGNPSKRRASILKFFRELPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMAAL
Sbjct: 18  MKEGNPSKRRASILKFFRELPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMAAL 77

Query: 61  IWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTW 120
           IWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTW
Sbjct: 78  IWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTW 137

Query: 121 VEQRVAVRALGHLATYPSTFPTVASHAEILELSIQLAMSSLEIVYSHFYQYFDRRLSYHC 180
           VEQRVAVRALGHLATY STFP VAS  EILELSIQLAMSSLEIVYSHFYQY DRRLSYHC
Sbjct: 138 VEQRVAVRALGHLATYASTFPAVASQGEILELSIQLAMSSLEIVYSHFYQYVDRRLSYHC 197

Query: 181 DLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLPAICKPEFLAKLPGMWGG 240
           DLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLP ICKPEFL KLPGMWGG
Sbjct: 198 DLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLPTICKPEFLVKLPGMWGG 257

Query: 241 LVNENSPAGIGLLRTICHHKLGRGPVASCPGLIEALCNIARSSDDWQYMAIDCLLWLLQD 300
           LVNENSPAGIGLLRTICHHKLGRGPVASCPG+IEALCNIARSSDDWQYMAIDCLLWLLQD
Sbjct: 258 LVNENSPAGIGLLRTICHHKLGRGPVASCPGIIEALCNIARSSDDWQYMAIDCLLWLLQD 317

Query: 301 PSTCHKVIDKAVPTLIDLAEITNLGDHKKLGDSIVNVLQDCIQLQGTVRSSPSNRSKEQI 360
           PSTCHKVIDKAVP LIDL+EI+ LGDHKKLGDSIVNVLQDCIQ QGT RSS SNR+KE I
Sbjct: 318 PSTCHKVIDKAVPALIDLSEISTLGDHKKLGDSIVNVLQDCIQSQGTGRSSISNRTKELI 377

Query: 361 EELLNSRQRLKWEKNMLKEDLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPM 420
           EELL S+QRLKWEKNM KEDLHIKQAAALVVKLEGNSLFS+GNISGAASKYSEAL+LCPM
Sbjct: 378 EELLTSKQRLKWEKNMPKEDLHIKQAAALVVKLEGNSLFSSGNISGAASKYSEALSLCPM 437

Query: 421 RSKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALA 480
           RSKKERVVLYSNRAQCHLL+QQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDML LA
Sbjct: 438 RSKKERVVLYSNRAQCHLLLQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLGLA 497

Query: 481 KESLLDAILFINECSQSNDPDLSLRQNKVPDYAERLVKKQMRAAWLFREAAIKHGGVHGE 540
           KESLLDAILFINECSQSNDPDL LRQNKVPDYAERLVKKQMRAAWLFREAAIKHGGVHGE
Sbjct: 498 KESLLDAILFINECSQSNDPDLCLRQNKVPDYAERLVKKQMRAAWLFREAAIKHGGVHGE 557

Query: 541 GNSGNIYGHETDDSEWETASESDIGNDGRDEMGDEDDDSEWKNEDERKDKYDKPPMKA 598
           G+ G IYG ++DDSEWETASESDIGNDGRDEMGD+DDDSEWKNEDERKDKYDKP +K 
Sbjct: 558 GD-GEIYGQDSDDSEWETASESDIGNDGRDEMGDDDDDSEWKNEDERKDKYDKPSLKG 614

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224083703|ref|XP_002307091.1| predicted protein [Populus trichocarpa] gi|222856540|gb|EEE94087.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356511097|ref|XP_003524266.1| PREDICTED: uncharacterized protein LOC100800996 [Glycine max] Back     alignment and taxonomy information
>gi|356525485|ref|XP_003531355.1| PREDICTED: uncharacterized protein LOC100816695 [Glycine max] Back     alignment and taxonomy information
>gi|449451439|ref|XP_004143469.1| PREDICTED: uncharacterized protein LOC101209622 [Cucumis sativus] gi|449532300|ref|XP_004173120.1| PREDICTED: uncharacterized LOC101209622 [Cucumis sativus] Back     alignment and taxonomy information
>gi|7960739|emb|CAB92061.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79510032|ref|NP_196582.2| ARM-repeat/tetratricopeptide repeat-like protein [Arabidopsis thaliana] gi|110739302|dbj|BAF01564.1| hypothetical protein [Arabidopsis thaliana] gi|332004124|gb|AED91507.1| ARM-repeat/tetratricopeptide repeat-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297807053|ref|XP_002871410.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297317247|gb|EFH47669.1| binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|217426797|gb|ACK44505.1| AT5G10200-like protein [Arabidopsis arenosa] Back     alignment and taxonomy information
>gi|72384486|gb|AAZ67602.1| 80A08_17 [Brassica rapa subsp. pekinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query598
TAIR|locus:2184073631 AT5G10200 [Arabidopsis thalian 0.984 0.933 0.838 5.4e-276
TAIR|locus:2167796588 AT5G43120 [Arabidopsis thalian 0.872 0.887 0.462 4.6e-128
TAIR|locus:2083068501 AT3G50030 [Arabidopsis thalian 0.361 0.431 0.55 9.2e-107
UNIPROTKB|Q99614292 TTC1 "Tetratricopeptide repeat 0.217 0.445 0.335 3e-11
MGI|MGI:1914395309 Tomm34 "translocase of outer m 0.252 0.488 0.369 5.3e-11
RGD|1359604292 Ttc1 "tetratricopeptide repeat 0.267 0.547 0.313 6.9e-11
MGI|MGI:1914077292 Ttc1 "tetratricopeptide repeat 0.217 0.445 0.335 7e-11
UNIPROTKB|F1RR38292 TTC1 "Uncharacterized protein" 0.274 0.561 0.304 1.2e-10
RGD|1309029309 Tomm34 "translocase of outer m 0.239 0.462 0.363 4.5e-10
UNIPROTKB|E1BWM0296 TTC1 "Uncharacterized protein" 0.269 0.543 0.298 6.3e-10
TAIR|locus:2184073 AT5G10200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2653 (939.0 bits), Expect = 5.4e-276, P = 5.4e-276
 Identities = 508/606 (83%), Positives = 539/606 (88%)

Query:     1 MKEGNPSKRRASILKFFRELPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMAAL 60
             MKEGNPSKRR+ ILKFFR+LPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECM+AL
Sbjct:    19 MKEGNPSKRRSCILKFFRDLPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMSAL 78

Query:    61 IWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAESAVHAGVIPPLVELLRGRLTW 120
             IWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAE AV AGVIPPLVELLRGRLTW
Sbjct:    79 IWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEEFAERAVEAGVIPPLVELLRGRLTW 138

Query:   121 VEQRVAVRALGHLATYPSTFPTVASHAEILELSIQLAMSSLEIVYSHFYQYFDRRLSYHC 180
             VEQRVAVRALGHLATYPSTFP VA H EILEL+IQLAMSSLEIVYSHFYQY DRRLSYHC
Sbjct:   139 VEQRVAVRALGHLATYPSTFPAVADHGEILELAIQLAMSSLEIVYSHFYQYPDRRLSYHC 198

Query:   181 DLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLPAICKPEFLAKLPGMWGG 240
             DLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLP +CKPEFL  LP MWGG
Sbjct:   199 DLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLPTLCKPEFLVNLPVMWGG 258

Query:   241 LVNENSPAGIGLLRTICHHKLGRGPVASCPGLIEALCNIARSSDDWQYMAIDCLLWLLQD 300
             LVNENSPAGIGLLRTIC HKLGRGPV++C G+IEALCNIARSSDDWQYMAI+CLLWLLQD
Sbjct:   259 LVNENSPAGIGLLRTICQHKLGRGPVSACAGMIEALCNIARSSDDWQYMAIECLLWLLQD 318

Query:   301 PSTCHKVIDKAVPTLIDLAEITNLGDHKKLGDSIVNVLQDCIQLQGTVRSSPSNRSKEQI 360
             P+T HKVIDKAVPTL+DLAEITNLGDHKKLGDSIV+VLQ+C        SS  NRS+E I
Sbjct:   319 PNTSHKVIDKAVPTLVDLAEITNLGDHKKLGDSIVSVLQEC--------SSMGNRSRELI 370

Query:   361 EELLNSRQRLKWEKNMLKEDLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPM 420
             EE +NSRQRLKWEK+M KEDLHIKQAAALVVKLEGNSLFS+G+I+GAA KYSEAL+LCPM
Sbjct:   371 EETVNSRQRLKWEKSMPKEDLHIKQAAALVVKLEGNSLFSSGDIAGAAEKYSEALSLCPM 430

Query:   421 RSKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALA 480
             RSKKERVVLYSNRAQCHLL+QQPL AISDATRALCLHNP+NRHAKSLWRRAQAYDML LA
Sbjct:   431 RSKKERVVLYSNRAQCHLLLQQPLVAISDATRALCLHNPVNRHAKSLWRRAQAYDMLGLA 490

Query:   481 KESLLDAILFINECSQSNDPDLSLRQNKVPDYAERLVKKQMRAAWLFREAAIKHGGVHGE 540
             KESLLDAILFINECSQSNDPDLS+RQNKVPDYAERLVKKQMRAAWLF+EAA+KHGGVH +
Sbjct:   491 KESLLDAILFINECSQSNDPDLSMRQNKVPDYAERLVKKQMRAAWLFKEAALKHGGVHRK 550

Query:   541 GNSGNIYGHETDDSEWETASESDIXXXXXXXXXXXXXXXX---------WKNEDERKDKY 591
             G    +YG+ETDDSEWETASESDI                         WKN D+  +K 
Sbjct:   551 GEEREVYGNETDDSEWETASESDIGDDGRDHMGLDDEEEEEEDEGHGEKWKNRDKSSEKN 610

Query:   592 DKPPMK 597
             +K   K
Sbjct:   611 EKTSAK 616
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2167796 AT5G43120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083068 AT3G50030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q99614 TTC1 "Tetratricopeptide repeat protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914395 Tomm34 "translocase of outer mitochondrial membrane 34" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359604 Ttc1 "tetratricopeptide repeat domain 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1914077 Ttc1 "tetratricopeptide repeat domain 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR38 TTC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1309029 Tomm34 "translocase of outer mitochondrial membrane 34" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWM0 TTC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query598
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-07
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information 
 Score = 57.3 bits (138), Expect = 1e-08
 Identities = 41/138 (29%), Positives = 60/138 (43%), Gaps = 19/138 (13%)

Query: 384 KQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQP 443
           ++  A  +K +GN  +   + + A   YS+A+        K   V YSNRA CH  +   
Sbjct: 123 RKKYAAKLKEKGNKAYRNKDFNKAIKLYSKAIEC------KPDPVYYSNRAACHNALGDW 176

Query: 444 LAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLD-AILFINECSQSNDPDL 502
              + D T AL L      ++K+L RRA AYD L    ++LLD     I +         
Sbjct: 177 EKVVEDTTAALELD---PDYSKALNRRANAYDGLGKYADALLDLTASCIID--------- 224

Query: 503 SLRQNKVPDYAERLVKKQ 520
             R  +     ERL+KK 
Sbjct: 225 GFRNEQSAQAVERLLKKF 242

[Transport and binding proteins, Amino acids, peptides and amines]. Length = 615
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 598
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.93
KOG4234271 consensus TPR repeat-containing protein [General f 99.82
KOG0553304 consensus TPR repeat-containing protein [General f 99.78
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.72
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.64
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.64
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.61
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.59
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.57
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.51
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.47
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.45
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.44
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.37
PRK15359144 type III secretion system chaperone protein SscB; 99.3
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.25
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.19
PRK11189296 lipoprotein NlpI; Provisional 99.17
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.12
PRK10370198 formate-dependent nitrite reductase complex subuni 99.08
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.03
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.0
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.99
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.97
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.96
KOG4555175 consensus TPR repeat-containing protein [Function 98.95
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 98.94
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.88
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.87
KOG0547606 consensus Translocase of outer mitochondrial membr 98.87
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.87
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.83
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.83
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.82
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.79
PRK15359144 type III secretion system chaperone protein SscB; 98.74
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.73
PRK12370553 invasion protein regulator; Provisional 98.71
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.7
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.68
KOG1125579 consensus TPR repeat-containing protein [General f 98.67
PRK15331165 chaperone protein SicA; Provisional 98.64
PLN02789320 farnesyltranstransferase 98.64
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.62
KOG1126638 consensus DNA-binding cell division cycle control 98.59
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.59
PRK12370553 invasion protein regulator; Provisional 98.59
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.58
KOG1310 758 consensus WD40 repeat protein [General function pr 98.58
PRK10803263 tol-pal system protein YbgF; Provisional 98.57
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.54
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.52
PRK11189296 lipoprotein NlpI; Provisional 98.52
PRK11788389 tetratricopeptide repeat protein; Provisional 98.52
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.51
PF13512142 TPR_18: Tetratricopeptide repeat 98.51
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.49
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.49
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.48
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.47
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.47
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.47
PF1337173 TPR_9: Tetratricopeptide repeat 98.47
KOG1126638 consensus DNA-binding cell division cycle control 98.47
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.46
PRK10370198 formate-dependent nitrite reductase complex subuni 98.46
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.44
PRK11788389 tetratricopeptide repeat protein; Provisional 98.44
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.44
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.43
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.4
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.39
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 98.33
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.3
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.28
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.28
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.27
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.25
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.25
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.24
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.24
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.22
PLN02789320 farnesyltranstransferase 98.22
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.22
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.22
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.22
PF1337173 TPR_9: Tetratricopeptide repeat 98.21
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.16
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.12
PF12688120 TPR_5: Tetratrico peptide repeat 98.11
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.09
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.07
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.07
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.05
KOG0553304 consensus TPR repeat-containing protein [General f 98.04
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.03
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.95
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.95
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.94
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.94
KOG2076 895 consensus RNA polymerase III transcription factor 97.93
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.9
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.88
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.87
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 97.86
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.86
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.85
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.84
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.83
KOG1128777 consensus Uncharacterized conserved protein, conta 97.82
PRK14574 822 hmsH outer membrane protein; Provisional 97.77
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.77
KOG2003 840 consensus TPR repeat-containing protein [General f 97.77
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.75
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.72
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.69
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.67
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.65
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.65
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.61
KOG2076 895 consensus RNA polymerase III transcription factor 97.6
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.6
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 97.6
PRK14574 822 hmsH outer membrane protein; Provisional 97.57
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 97.56
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.56
KOG2003 840 consensus TPR repeat-containing protein [General f 97.55
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.54
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.53
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.41
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.38
KOG4234271 consensus TPR repeat-containing protein [General f 97.38
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.35
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.35
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.3
PRK10803263 tol-pal system protein YbgF; Provisional 97.29
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.28
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.28
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.25
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.19
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.18
PF1343134 TPR_17: Tetratricopeptide repeat 97.18
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.18
KOG1125579 consensus TPR repeat-containing protein [General f 97.18
PRK11906458 transcriptional regulator; Provisional 97.17
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.11
PF1343134 TPR_17: Tetratricopeptide repeat 97.1
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.1
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 97.04
KOG4555175 consensus TPR repeat-containing protein [Function 97.01
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.01
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.99
PF1342844 TPR_14: Tetratricopeptide repeat 96.99
PF12688120 TPR_5: Tetratrico peptide repeat 96.98
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.98
PRK10941269 hypothetical protein; Provisional 96.97
PRK11906458 transcriptional regulator; Provisional 96.96
KOG4648 536 consensus Uncharacterized conserved protein, conta 96.83
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.82
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.8
KOG1129478 consensus TPR repeat-containing protein [General f 96.75
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.75
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.75
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.72
KOG1128777 consensus Uncharacterized conserved protein, conta 96.69
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.68
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 96.66
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.61
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.61
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.58
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.56
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.55
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.53
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 96.47
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.41
KOG1129478 consensus TPR repeat-containing protein [General f 96.33
KOG4162799 consensus Predicted calmodulin-binding protein [Si 96.33
COG4700251 Uncharacterized protein conserved in bacteria cont 96.3
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.22
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.22
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.16
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.16
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.15
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.14
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.01
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 95.99
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 95.94
PF13512142 TPR_18: Tetratricopeptide repeat 95.9
KOG0495913 consensus HAT repeat protein [RNA processing and m 95.83
KOG2376 652 consensus Signal recognition particle, subunit Srp 95.82
PRK15331165 chaperone protein SicA; Provisional 95.82
PRK04841 903 transcriptional regulator MalT; Provisional 95.8
KOG4340459 consensus Uncharacterized conserved protein [Funct 95.78
PF1342844 TPR_14: Tetratricopeptide repeat 95.54
KOG3785 557 consensus Uncharacterized conserved protein [Funct 95.49
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.46
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.44
KOG3785 557 consensus Uncharacterized conserved protein [Funct 95.44
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 95.41
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 95.34
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.18
KOG2376 652 consensus Signal recognition particle, subunit Srp 95.13
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.99
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.96
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 94.88
KOG0495913 consensus HAT repeat protein [RNA processing and m 94.86
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.83
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.79
PRK04841 903 transcriptional regulator MalT; Provisional 94.76
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 94.74
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.68
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 94.58
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.53
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.41
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.4
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.39
KOG4507886 consensus Uncharacterized conserved protein, conta 94.37
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.36
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 94.21
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.2
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 94.13
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 94.02
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.9
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.9
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.9
KOG4340 459 consensus Uncharacterized conserved protein [Funct 93.66
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 93.55
KOG2796366 consensus Uncharacterized conserved protein [Funct 93.32
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.24
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 93.18
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 93.11
COG2912269 Uncharacterized conserved protein [Function unknow 93.09
PLN03218 1060 maturation of RBCL 1; Provisional 93.08
KOG1941 518 consensus Acetylcholine receptor-associated protei 92.96
PLN03218 1060 maturation of RBCL 1; Provisional 92.96
KOG2471 696 consensus TPR repeat-containing protein [General f 92.76
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 92.72
PRK10941269 hypothetical protein; Provisional 92.41
COG4700251 Uncharacterized protein conserved in bacteria cont 92.35
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 92.2
PF1286294 Apc5: Anaphase-promoting complex subunit 5 91.95
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.85
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 91.48
KOG1586288 consensus Protein required for fusion of vesicles 91.37
COG4976287 Predicted methyltransferase (contains TPR repeat) 91.07
KOG1585308 consensus Protein required for fusion of vesicles 90.59
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 90.58
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 90.58
PLN03077857 Protein ECB2; Provisional 90.26
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 90.12
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 90.09
KOG2610 491 consensus Uncharacterized conserved protein [Funct 90.08
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 89.6
PF09986214 DUF2225: Uncharacterized protein conserved in bact 89.54
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 89.22
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 88.99
PLN03077857 Protein ECB2; Provisional 88.82
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 88.55
KOG1915677 consensus Cell cycle control protein (crooked neck 88.49
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 87.17
KOG1586288 consensus Protein required for fusion of vesicles 86.58
PF1286294 Apc5: Anaphase-promoting complex subunit 5 86.43
COG3629280 DnrI DNA-binding transcriptional activator of the 86.21
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.78
KOG1915 677 consensus Cell cycle control protein (crooked neck 85.36
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 84.71
KOG2471 696 consensus TPR repeat-containing protein [General f 84.34
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 83.73
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 83.21
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 83.08
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 83.07
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 82.8
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 82.33
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 81.93
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 81.51
COG4976 287 Predicted methyltransferase (contains TPR repeat) 81.14
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 80.89
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 80.77
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.93  E-value=5.9e-26  Score=239.97  Aligned_cols=165  Identities=22%  Similarity=0.195  Sum_probs=151.6

Q ss_pred             ccCCccceehhhccccccccCCCC---CCCCccHHHHHHHHHHHhHhhHHhhcCChHHHHHHHHHHHHHHHHHHHHHHcC
Q 007571          326 DHKKLGDSIVNVLQDCIQLQGTVR---SSPSNRSKEQIEELLNSRQRLKWEKNMLKEDLHIKQAAALVVKLEGNSLFSAG  402 (598)
Q Consensus       326 ~~~k~GE~~~~~L~pdy~~g~~g~---~ip~~~tl~~~~ELl~~kek~k~e~~ms~eElee~~~~A~~lKeeGN~lfk~G  402 (598)
                      .+|++||++.+++.|+|+||..+.   .|||++++.|+++|++|..+....|.|..+   +++..|...|+.||.+|+.|
T Consensus       146 ~~M~~GE~a~v~i~~~YayG~~~~~~p~IPPnA~l~yEVeL~~f~~~~~~s~~~~~~---e~l~~A~~~ke~Gn~~fK~g  222 (397)
T KOG0543|consen  146 RMMKVGEVALVTIDPKYAYGEEGGEPPLIPPNATLLYEVELLDFELKEDESWKMFAE---ERLEAADRKKERGNVLFKEG  222 (397)
T ss_pred             HhcCccceEEEEeCcccccCCCCCCCCCCCCCceEEEEEEEEeeecCcccccccchH---HHHHHHHHHHHhhhHHHhhc
Confidence            459999999999999999994444   899999999999999998777778888776   45899999999999999999


Q ss_pred             CHHHHHHHHHHHHHhCCCC----------chHHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCCCcCHHHHHHHHH
Q 007571          403 NISGAASKYSEALALCPMR----------SKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQ  472 (598)
Q Consensus       403 dY~eAIe~YskALel~P~~----------~~~~~a~ly~NRA~cylKLgdyeeAI~D~~kALeLdP~~~~~~KAyyRRAq  472 (598)
                      +|..|+..|.+|+...+..          ....+..+|+|+|+||+|+++|.+|+..|+++|+++|+   |+||+||||+
T Consensus       223 k~~~A~~~Yerav~~l~~~~~~~~ee~~~~~~~k~~~~lNlA~c~lKl~~~~~Ai~~c~kvLe~~~~---N~KALyRrG~  299 (397)
T KOG0543|consen  223 KFKLAKKRYERAVSFLEYRRSFDEEEQKKAEALKLACHLNLAACYLKLKEYKEAIESCNKVLELDPN---NVKALYRRGQ  299 (397)
T ss_pred             hHHHHHHHHHHHHHHhhccccCCHHHHHHHHHHHHHHhhHHHHHHHhhhhHHHHHHHHHHHHhcCCC---chhHHHHHHH
Confidence            9999999999999987643          22457899999999999999999999999999999999   9999999999


Q ss_pred             HHHHhhcHHHHHHHHHHHHHHhcc
Q 007571          473 AYDMLALAKESLLDAILFINECSQ  496 (598)
Q Consensus       473 Ay~~LGdy~EAl~d~~kALel~~k  496 (598)
                      |+..+|+|+.|+.+|++++++.|.
T Consensus       300 A~l~~~e~~~A~~df~ka~k~~P~  323 (397)
T KOG0543|consen  300 ALLALGEYDLARDDFQKALKLEPS  323 (397)
T ss_pred             HHHhhccHHHHHHHHHHHHHhCCC
Confidence            999999999999999999999987

>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query598
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 1e-07
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 3e-06
2c2l_A281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 2e-05
3fp2_A 537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 2e-04
3lca_A 533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 2e-04
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure 
Iteration: 1

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 57/96 (59%), Gaps = 5/96 (5%)
Query: 391 VKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQPLAAISDA 450
           ++ EGN LF  G+  GA + Y++AL L    + +++ VL+ NRA CHL ++    A ++A
Sbjct: 31  LRKEGNELFKCGDYGGALAAYTQALGL--DATPQDQAVLHRNRAACHLKLEDYDKAETEA 88
Query: 451 TRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLD 486
           ++A+          K+L+RR+QA + L    +++LD
Sbjct: 89  SKAI---EKDGGDVKALYRRSQALEKLGRLDQAVLD 121
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query598
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 9e-24
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 4e-21
3q49_B137 STIP1 homology and U box-containing protein 1; E3 7e-21
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 8e-20
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-19
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-19
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-19
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 3e-19
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 5e-19
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 9e-19
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 5e-18
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 6e-17
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 7e-17
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 7e-16
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 4e-15
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 4e-14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-12
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 6e-12
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 4e-11
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-09
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-05
2gw1_A 514 Mitochondrial precursor proteins import receptor; 6e-05
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-09
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-09
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-09
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-07
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-04
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 3e-06
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-05
3nmz_A458 APC variant protein; protein-protein complex, arma 8e-04
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 7e-05
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 9e-05
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 8e-04
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-04
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 3e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-04
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-04
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
 Score = 96.7 bits (241), Expect = 9e-24
 Identities = 32/108 (29%), Positives = 61/108 (56%), Gaps = 5/108 (4%)

Query: 379 EDLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHL 438
                  ++   ++ EGN LF  G+  GA + Y++AL L    + +++ VL+ NRA CHL
Sbjct: 19  RPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDA--TPQDQAVLHRNRAACHL 76

Query: 439 LMQQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLD 486
            ++    A ++A++A+   +  +   K+L+RR+QA + L    +++LD
Sbjct: 77  KLEDYDKAETEASKAIEK-DGGD--VKALYRRSQALEKLGRLDQAVLD 121
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query598
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.77
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.75
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.74
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.74
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.72
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.72
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.69
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.65
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.59
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.58
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.58
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.56
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.53
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.52
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.51
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.47
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.46
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.45
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.44
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.42
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.41
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.38
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.38
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.38
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.35
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.35
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.35
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.35
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.34
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.33
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.31
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.29
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.29
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.28
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.27
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.26
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.24
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.23
3k9i_A117 BH0479 protein; putative protein binding protein, 99.23
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.22
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.22
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.22
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.22
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.22
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.22
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.21
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.2
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.19
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.18
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.16
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.14
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.12
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.12
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.11
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.11
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.11
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.1
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.07
3u4t_A272 TPR repeat-containing protein; structural genomics 99.07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.05
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 99.05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.04
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.03
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.02
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.02
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.02
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.01
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.01
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.01
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.0
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.99
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.98
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.98
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.98
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.98
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.98
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.98
3u4t_A272 TPR repeat-containing protein; structural genomics 98.97
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.97
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.95
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.94
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.94
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.94
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.93
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.93
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.92
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.91
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.9
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.9
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.9
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.89
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.89
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.88
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.88
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.88
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.87
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 98.85
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.85
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.85
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.84
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.83
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.82
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.82
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.8
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.8
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.79
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.78
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.78
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.77
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.77
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.76
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.76
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.74
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.74
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.74
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.73
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.73
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.71
3k9i_A117 BH0479 protein; putative protein binding protein, 98.71
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.71
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.7
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.7
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.69
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 98.68
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.68
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.67
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 98.67
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.66
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.65
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.65
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.65
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.65
2gw1_A514 Mitochondrial precursor proteins import receptor; 98.65
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.64
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.64
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.63
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.62
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.57
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.57
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.56
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.54
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.54
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.54
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.53
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.53
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.52
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.51
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.51
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.51
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.5
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.49
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.49
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.49
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.48
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.45
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.44
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.43
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.41
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.41
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.4
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.39
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.37
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.33
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.31
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.31
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.29
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.21
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.19
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.16
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.12
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.1
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.08
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.07
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.06
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.98
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.97
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.96
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.95
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.94
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.87
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.83
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.69
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 97.64
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.63
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.6
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.56
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.4
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.38
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.38
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.32
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.25
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.25
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.14
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.12
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.12
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.12
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.9
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.76
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 96.75
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 96.74
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 96.65
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 96.53
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 96.36
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 96.02
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 95.72
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.67
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 95.6
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 95.51
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 95.36
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 95.31
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 95.09
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 95.05
3nmz_A458 APC variant protein; protein-protein complex, arma 94.89
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 94.85
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 94.81
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.76
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.7
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 94.45
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.42
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 94.34
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 94.2
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 93.96
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 93.87
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.77
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 93.32
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.29
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 93.28
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 93.21
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 93.2
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.02
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.61
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 92.45
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 92.25
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 92.19
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 91.56
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.18
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 90.39
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.35
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 90.04
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 89.76
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 89.19
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 89.16
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 88.99
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 88.98
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 88.95
3nmz_A458 APC variant protein; protein-protein complex, arma 88.71
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 87.99
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 86.56
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 86.27
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 83.48
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 83.19
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 83.12
1jvw_A167 Macrophage infectivity potentiator; chagas disease 81.91
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 81.72
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 80.85
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 80.83
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 80.79
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.77  E-value=3.9e-18  Score=151.68  Aligned_cols=103  Identities=23%  Similarity=0.254  Sum_probs=100.6

Q ss_pred             HHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCCCcCHH
Q 007571          386 AAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQPLAAISDATRALCLHNPLNRHAK  465 (598)
Q Consensus       386 ~~A~~lKeeGN~lfk~GdY~eAIe~YskALel~P~~~~~~~a~ly~NRA~cylKLgdyeeAI~D~~kALeLdP~~~~~~K  465 (598)
                      +.+..++++|+.+|++|+|++|+..|++||+++|.+     +.+|.|+|.||+++|++++|+.++++||+++|+   +++
T Consensus        11 ~~a~~~~~~G~~~~~~g~~~~A~~~~~~al~~~p~~-----~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~---~~~   82 (126)
T 4gco_A           11 ELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPEN-----AILYSNRAACLTKLMEFQRALDDCDTCIRLDSK---FIK   82 (126)
T ss_dssp             HHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTC-----HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT---CHH
T ss_pred             HHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCC-----HHHHHHHhhHHHhhccHHHHHHHHHHHHHhhhh---hhH
Confidence            468899999999999999999999999999999999     999999999999999999999999999999999   999


Q ss_pred             HHHHHHHHHHHhhcHHHHHHHHHHHHHHhcc
Q 007571          466 SLWRRAQAYDMLALAKESLLDAILFINECSQ  496 (598)
Q Consensus       466 AyyRRAqAy~~LGdy~EAl~d~~kALel~~k  496 (598)
                      +|+++|.+|..+|++++|+.+|++++++.|+
T Consensus        83 a~~~lg~~~~~~~~~~~A~~~~~~al~l~P~  113 (126)
T 4gco_A           83 GYIRKAACLVAMREWSKAQRAYEDALQVDPS  113 (126)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHCcC
Confidence            9999999999999999999999999999886
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 598
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.004
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.3 bits (85), Expect = 0.004
 Identities = 9/82 (10%), Positives = 24/82 (29%), Gaps = 8/82 (9%)

Query: 395 GNSLFSAGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLMQQPLAAISDATRAL 454
            +  + AG+   A     +     P     +   +    +  H   ++   +   +T A+
Sbjct: 6   AHREYQAGDFEAAERHCMQLWRQEP-----DNTGVLLLLSSIHFQCRRLDRSAHFSTLAI 60

Query: 455 CLHNPLNRHAKSLWRRAQAYDM 476
             +      A++       Y  
Sbjct: 61  KQN---PLLAEAYSNLGNVYKE 79

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query598
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.81
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.79
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.79
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.76
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.74
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.54
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.52
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.45
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.44
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.32
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.28
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.26
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.25
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.21
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.21
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.2
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.18
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.17
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.09
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.06
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.01
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.01
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.94
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.9
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.88
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.87
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.83
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.8
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.72
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.69
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.59
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.52
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.51
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.38
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.3
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.29
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.23
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.15
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.14
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.13
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.4
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.4
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.38
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.18
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.18
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.17
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.94
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.58
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.05
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.61
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 93.41
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 90.39
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 90.26
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 89.92
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 89.26
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 88.26
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 88.24
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 87.09
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 86.63
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 85.61
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 85.54
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 85.23
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 84.89
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 84.11
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 84.0
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 83.7
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 81.91
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 81.1
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 80.91
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Putative 70 kda peptidylprolyl isomerase PFL2275c
species: Plasmodium falciparum [TaxId: 5833]

Probab=99.81  E-value=4.2e-19  Score=161.85  Aligned_cols=119  Identities=22%  Similarity=0.215  Sum_probs=108.7

Q ss_pred             HhhcCChHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCc-----------hHHHHHHHHHHHHHHHHc
Q 007571          372 WEKNMLKEDLHIKQAAALVVKLEGNSLFSAGNISGAASKYSEALALCPMRS-----------KKERVVLYSNRAQCHLLM  440 (598)
Q Consensus       372 ~e~~ms~eElee~~~~A~~lKeeGN~lfk~GdY~eAIe~YskALel~P~~~-----------~~~~a~ly~NRA~cylKL  440 (598)
                      ..|.|+.+|.   +..+..++++||.+|+.|+|.+|+..|++||.+.|...           ......+|+|+|.||+++
T Consensus         4 ~~~~~~~~e~---~~~a~~~~~~G~~~f~~~~y~~A~~~Y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~Nla~~~~~l   80 (153)
T d2fbna1           4 SIYDYTDEEK---VQSAFDIKEEGNEFFKKNEINEAIVKYKEALDFFIHTEEWDDQILLDKKKNIEISCNLNLATCYNKN   80 (153)
T ss_dssp             SGGGCCHHHH---HHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTTTCTTCCCHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             chhhCCHHHH---HHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcchhhhhhHHHHHhhhhHHHHHHhhHHHHHHHh
Confidence            3477888754   88999999999999999999999999999999887641           133578999999999999


Q ss_pred             CChHHHHHHHHHHHHhCCCCCcCHHHHHHHHHHHHHhhcHHHHHHHHHHHHHHhcc
Q 007571          441 QQPLAAISDATRALCLHNPLNRHAKSLWRRAQAYDMLALAKESLLDAILFINECSQ  496 (598)
Q Consensus       441 gdyeeAI~D~~kALeLdP~~~~~~KAyyRRAqAy~~LGdy~EAl~d~~kALel~~k  496 (598)
                      |+|++|+.+|++||+++|+   ++++||++|.+|..+|++++|+.+|.+++++.|+
T Consensus        81 ~~~~~Al~~~~~al~~~p~---~~ka~~~~g~~~~~lg~~~~A~~~~~~al~l~P~  133 (153)
T d2fbna1          81 KDYPKAIDHASKVLKIDKN---NVKALYKLGVANMYFGFLEEAKENLYKAASLNPN  133 (153)
T ss_dssp             TCHHHHHHHHHHHHHHSTT---CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHSTT
T ss_pred             cccchhhhhhhccccccch---hhhhhHHhHHHHHHcCCHHHHHHHHHHHHHhCCC
Confidence            9999999999999999999   9999999999999999999999999999999886
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure