Citrus Sinensis ID: 007687

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590---
MGNILQISISCDGAIFNRCLDCFLGKAAYIRNLQENVIALETELVKLIEAKNDVMARVVNAERQPMMTRLNKVQGWLSRVDAVKAEADELIRHGSQEIEKLCLGGYCSKNCHSSYKLGKQVAKKLRDKLIDCWIGEGFLTERDRFVEQNQGYHILGILLHACLLEEGGDGKVKMHDVIRDMALWIVCDIEKEKENFLVYAGVGLTEAPEVKGWENVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDLSESDISELPGELKALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIVEELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFVFHSLKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCVAMEEMVSVGKFAAVPEVTANLNPFAKLQYLDLVGAINLKSIYWMPLSFPLLKYLRAMNCHKLKKLPFDSNSARERNIVISGYTKWWDQLEWVDEATRNAFLPCFKTLD
cccEEEEEEEcccHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccHHHHHHHcccccccHHcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccEEcccccEEEccHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccEEEEEEEcccccccccccccccEEEEEEccccccccccHHHccccccEEEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEcccccccccccHHHHcccccccEEEEcccccccccccccccHHccccccccccccccccccEEEEEEEccccHHHHHHccccccccccEEEEEEcccccHHHHcccccccccEEEEEEccccccccccccccccccccccccEEEEEccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccEEcccccccccccEEEEEcccccccccccccccccccEEEEccccccccccccccccccccccccEEcc
cccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHcccccccccHHHccccHHHHHHHEEEEcccccccEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHcccccccEEEEcccccccccccccHHHEEEEEEcccccHcccccccccccEEEEEcccccccccHHHHHccccEEEEEcccccccccccccccccHEEEEEccccccHcccHHHHccHHcEEEEEcccccHccccHcHHHcHHcccEEEcccccccccccccccccccccccccHHHHccHHcccEEEEEccccHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEcccHcHHEccccccccccccccccccccccccEEEEcccccHHHccccccccccccEEEEcccccHHccccccccHHHHEEEEcccHHHHHHcccccHHHHHHHcccccccc
MGNILQISISCDGAIFNRCLDCFLGKAAYIRNLQENVIALETELVKLIEAKNDVMARVVNAERQPMMTRLNKVQGWLSRVDAVKAEADELIRHGSQEIEKLClggycsknchssykLGKQVAKKLRDKLIDcwigegflteRDRFVEQNQGYHILGILLHACLleeggdgkvkMHDVIRDMALWIVCDIEKEKENFLVYAGvglteapevkgwenVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDffrfmpslkvlnlshaeltelpvgisDLVSlqhldlsesdiseLPGELKALVNLkclnlewtrnLITIPRQLISNLSRLHVLRMFGashnafdgasedsilFGGGALIVEELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFVFHSLKKveivnsyklkdltflvfapnlesIEVLGCVAMEEMVSvgkfaavpevtanlnpfAKLQYLDLVGAinlksiywmplsfPLLKYLRAMNchklkklpfdsnsareRNIVISGYTKWWDQLEWVDEATrnaflpcfktld
MGNILQISISCDGAIFNRCLDCFLGKAAYIRNLQENVIALETELVKLIEAKNDVMarvvnaerqpmmtrlnkvqgwLSRVDAVKAEADELIRHGSQEIEKLCLGGYCSKNCHSSYKLGKQVAKKLRDKLIDCWIGEGFLTERDRFVEQNQGYHILGILLHACLLEEGGDGKVKMHDVIRDMALWIVCDIEKEKENFLVYAGVglteapevkgweNVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDLSESDISELPGELKALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIVEELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFVFHSLKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCVAMEEMVSVGKFAAVPEVTANLNPFAKLQYLDLVGAINLKSIYWMPLSFPLLKYLRAMNCHKLkklpfdsnsareRNIVISGYTKWWDQLEWVDEATRNAFLPCFKTLD
MGNILQISISCDGAIFNRCLDCFLGKAAYIRNLQENVIALETELVKLIEAKNDVMARVVNAERQPMMTRLNKVQGWLSRVDAVKAEADELIRHGSQEIEKLCLGGYCSKNCHSSYKLGKQVAKKLRDKLIDCWIGEGFLTERDRFVEQNQGYHILGILLHACLLEEGGDGKVKMHDVIRDMALWIVCDIEKEKENFLVYAGVGLTEAPEVKGWENVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDLSESDISELPGELKALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIVEELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFVFHSLKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCVAMEEMVSVGKFAAVPEVTANLNPFAKLQYLDLVGAINLKSIYWMPLSFPLLKYLRAMNCHKLKKLPFDSNSARERNIVISGYTKWWDQLEWVDEATRNAFLPCFKTLD
***ILQISISCDGAIFNRCLDCFLGKAAYIRNLQENVIALETELVKLIEAKNDVMARVVNAERQPMMTRLNKVQGWLSRVDAVKAEADELIRHGSQEIEKLCLGGYCSKNCHSSYKLGKQVAKKLRDKLIDCWIGEGFLTERDRFVEQNQGYHILGILLHACLLEEGGDGKVKMHDVIRDMALWIVCDIEKEKENFLVYAGVGLTEAPEVKGWENVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDLSESDISELPGELKALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIVEELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFVFHSLKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCVAMEEMVSVGKFAAVPEVTANLNPFAKLQYLDLVGAINLKSIYWMPLSFPLLKYLRAMNCHKLKKLPFDSNSARERNIVISGYTKWWDQLEWVDEATRNAFLPCFK***
***ILQISISCDGAIFNRCLDCFLGKAAYIRNLQEN**A****LVKLIEAKNDVMARVVNAERQPMMTR****QGWLSRVDAVKA*******HGSQEIEKLCLGGYCSKNCHSSYKLGKQVAKKLRDKLIDCWIGEGFLTERDRFVEQNQGYHILGILLHACLLEEGGDGKVKMHDVIRDMALWIVCDIEKEKENFLVYAGVGLTEAPEVKGWENVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDLSESDISELPGELKALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIVEELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFVFHSLKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCVAMEEMVSVGKFAA**E*****NPFAKLQYLDLVGAINLKSIYWMPLSFPLLKYLRAMNCHKLKKLPFD*********VISGYTKWWDQLEWVDEATRNAFLPCFKTL*
MGNILQISISCDGAIFNRCLDCFLGKAAYIRNLQENVIALETELVKLIEAKNDVMARVVNAERQPMMTRLNKVQGWLSRVDAVKAEADELIRHGSQEIEKLCLGGYCSKNCHSSYKLGKQVAKKLRDKLIDCWIGEGFLTERDRFVEQNQGYHILGILLHACLLEEGGDGKVKMHDVIRDMALWIVCDIEKEKENFLVYAGVGLTEAPEVKGWENVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDLSESDISELPGELKALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIVEELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFVFHSLKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCVAMEEMVSVGKFAAVPEVTANLNPFAKLQYLDLVGAINLKSIYWMPLSFPLLKYLRAMNCHKLKKLPFDSNSARERNIVISGYTKWWDQLEWVDEATRNAFLPCFKTLD
*GNILQISISCDGAIFNRCLDCFLGKAAYIRNLQENVIALETELVKLIEAKNDVMARVVNAERQPMMTRLNKVQGWLSRVDAVKAEADELIRHGSQEIEKLCLGGYCSKNCHSSYKLGKQVAKKLRDKLIDCWIGEGFLTERDRFVEQNQGYHILGILLHACLLEEGGDGKVKMHDVIRDMALWIVCDIEKEKENFLVYAGVGLTEAPEVKGWENVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDLSESDISELPGELKALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIVEELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFVFHSLKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCVAMEEMVSVGKFAAV*EVTANLNPFAKLQYLDLVGAINLKSIYWMPLSFPLLKYLRAMNCHKLKKLPFDSNSARERNIVISGYTKWWDQLEWVDEATRNAFLPCFKTLD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNILQISISCDGAIFNRCLDCFLGKAAYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPMMTRLNKVQGWLSRVDAVKAEADELIRHGSQEIEKLCLGGYCSKNCHSSYKLGKQVAKKLRDKLIDCWIGEGFLTERDRFVEQNQGYHILGILLHACLLEEGGDGKVKMHDVIRDMALWIVCDIEKEKENFLVYAGVGLTEAPEVKGWENVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDLSESDISELPGELKALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIVEELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFVFHSLKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCVAMEEMVSVGKFAAVPEVTANLNPFAKLQYLDLVGAINLKSIYWMPLSFPLLKYLRAMNCHKLKKLPFDSNSARERNIVISGYTKWWDQLEWVDEATRNAFLPCFKTLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query593 2.2.26 [Sep-21-2011]
Q8RXS5888 Probable disease resistan yes no 0.844 0.564 0.360 3e-72
O64973889 Disease resistance protei no no 0.745 0.497 0.4 8e-71
P60838894 Probable disease resistan no no 0.834 0.553 0.371 2e-68
O82484892 Putative disease resistan no no 0.750 0.498 0.379 7e-65
Q9C8T9898 Putative disease resistan no no 0.767 0.506 0.374 2e-64
Q8L3R3885 Disease resistance protei no no 0.789 0.528 0.387 5e-64
Q9SH22884 Probable disease resistan no no 0.740 0.496 0.370 5e-64
Q940K0889 Probable disease resistan no no 0.777 0.518 0.363 3e-61
P60839884 Probable disease resistan no no 0.747 0.501 0.380 6e-61
Q9SI85893 Probable disease resistan no no 0.741 0.492 0.367 9e-60
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function desciption
 Score =  273 bits (698), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 195/541 (36%), Positives = 283/541 (52%), Gaps = 40/541 (7%)

Query: 67  MTRLNKVQGWLSRVDAVKAEADELIRHGSQEIEKLCLGGYCSKN--------CHSSYKLG 118
           M     VQ W S +D + + A E       E E L +  Y   N        C     L 
Sbjct: 360 MAYKRTVQEWRSAIDVLTSSAAEF---SGMEDEILPILKYSYDNLKSEQLKLCFQYCALF 416

Query: 119 KQVAKKLRDKLIDCWIGEGFLTERDRFVEQNQGYHILGILLHACLLEEGGDGKVKMHDVI 178
            +     ++ L+D WIGEGF+ +R++   +NQGY I+GIL+ +CLL E     VKMHDV+
Sbjct: 417 PEDHNIEKNDLVDYWIGEGFI-DRNKGKAENQGYEIIGILVRSCLLMEENQETVKMHDVV 475

Query: 179 RDMALWIVCDIEKEKENFLVYAGVGLTEAPEVKGWENVRRISLMDNQITNLSEVATCRHL 238
           R+MALWI  D  K+KENF+V AG+     PE++ W+  RR+SLM N I ++ +      L
Sbjct: 476 REMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQL 535

Query: 239 LTLFLNQNKLQMIHNDFFRFMPSLKVLNLS-HAELTELPVGISDLVSLQHLDLSESDISE 297
           +TL L +N L  I + FFR MP L VL+LS + +L  LP  IS+ VSLQ+L LS + I  
Sbjct: 536 ITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRI 595

Query: 298 LPGELKALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFG 357
            P  L  L  L  LNLE+TR + +I    IS L+ L VLR+F        G  ED     
Sbjct: 596 WPAGLVELRKLLYLNLEYTRMVESICG--ISGLTSLKVLRLF------VSGFPED----- 642

Query: 358 GGALIVEELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSAL 417
               ++ EL  L+ L+ ++ TL  +  L+  LS+ +L  CTRAL ++  N  +S+ +S +
Sbjct: 643 --PCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSV-ISFV 699

Query: 418 ADLKQLNRLRIAECK------KLEELKMDYTGEVQQFVFHSLKKVEIVNSYKLKDLTFLV 471
           A +  L  L  A+        K  E  +          F +L +V +    +L+DLT+L+
Sbjct: 700 ATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLI 759

Query: 472 FAPNLESIEVLGCVAMEEMVSVGKFAAVPEVTANLNPFAKLQYLDLVGAINLKSIYWMPL 531
           FAPNL  + V+    ++E+++  K         NL PF +L+ L L     LK I+  PL
Sbjct: 760 FAPNLTVLRVISASDLKEVINKEKAEQ-----QNLIPFQELKELRLENVQMLKHIHRGPL 814

Query: 532 SFPLLKYLRAMNCHKLKKLPFDSNSARERNIVISGYTKWWDQLEWVDEATRNAFLPCFKT 591
            FP L+ +    C +L+KLP +  S    ++VI  + KW + LEW DEAT+  FLP  K 
Sbjct: 815 PFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARFLPTLKA 874

Query: 592 L 592
            
Sbjct: 875 F 875
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query593
24461866 890 NBS-LRR type disease resistance protein 0.779 0.519 0.841 0.0
24461865 892 NBS-LRR type disease resistance protein 0.809 0.538 0.751 0.0
24461861 890 NBS-LRR type disease resistance protein 0.777 0.517 0.620 1e-150
24461864 899 NBS-LRR type disease resistance protein 0.782 0.516 0.594 1e-148
24461863 889 NBS-LRR type disease resistance protein 0.775 0.517 0.589 1e-144
359482672 905 PREDICTED: probable disease resistance p 0.880 0.576 0.443 1e-113
225443158 903 PREDICTED: probable disease resistance p 0.780 0.512 0.485 1e-110
225442867 893 PREDICTED: probable disease resistance p 0.755 0.501 0.465 1e-106
147852651 882 hypothetical protein VITISV_017542 [Viti 0.726 0.488 0.462 1e-105
359482674 991 PREDICTED: probable disease resistance p 0.908 0.543 0.4 1e-103
>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/466 (84%), Positives = 417/466 (89%)

Query: 126 RDKLIDCWIGEGFLTERDRFVEQNQGYHILGILLHACLLEEGGDGKVKMHDVIRDMALWI 185
           ++ LIDCWIGEGFLTERDRF EQNQGYHILGILLHACLLEEGGDG+VKMHDV+RDMALWI
Sbjct: 425 KEILIDCWIGEGFLTERDRFGEQNQGYHILGILLHACLLEEGGDGEVKMHDVVRDMALWI 484

Query: 186 VCDIEKEKENFLVYAGVGLTEAPEVKGWENVRRISLMDNQITNLSEVATCRHLLTLFLNQ 245
            C IEKEK+NFLVYAGVGL EAP+V GWE  RR+SLM NQITNLSEVATC HLLTLFLN+
Sbjct: 485 ACAIEKEKDNFLVYAGVGLIEAPDVSGWEKARRLSLMHNQITNLSEVATCPHLLTLFLNE 544

Query: 246 NKLQMIHNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDLSESDISELPGELKAL 305
           N+LQMIHNDFFRFMPSLKVLNL+ + LT LP GIS LVSLQHLDLS+S I ELP ELKAL
Sbjct: 545 NELQMIHNDFFRFMPSLKVLNLADSSLTNLPEGISKLVSLQHLDLSKSSIEELPLELKAL 604

Query: 306 VNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIVEE 365
           VNLKCLNLE+T +L TIPRQLISNLSRLHVLRMF ASH+AFD ASEDSILFGGG LIVEE
Sbjct: 605 VNLKCLNLEYTWSLTTIPRQLISNLSRLHVLRMFAASHSAFDRASEDSILFGGGELIVEE 664

Query: 366 LLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNR 425
           LLGLKYLEVISFTLRSSHGLQS LSSHKLR CTRALLLQCFNDSTSLEVSALADLKQLNR
Sbjct: 665 LLGLKYLEVISFTLRSSHGLQSFLSSHKLRSCTRALLLQCFNDSTSLEVSALADLKQLNR 724

Query: 426 LRIAECKKLEELKMDYTGEVQQFVFHSLKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCV 485
           L I ECKKLEELKMDYT EVQQFVFHSLKKVEI+   KLKDLTFLVFAPNLESIE++GC 
Sbjct: 725 LWITECKKLEELKMDYTREVQQFVFHSLKKVEILACSKLKDLTFLVFAPNLESIELMGCP 784

Query: 486 AMEEMVSVGKFAAVPEVTANLNPFAKLQYLDLVGAINLKSIYWMPLSFPLLKYLRAMNCH 545
           AMEEMVS+GKFA VPEV ANLNPFAKLQ L L GA NLKSIYW PL FP LK +   +C+
Sbjct: 785 AMEEMVSMGKFAEVPEVVANLNPFAKLQNLKLFGATNLKSIYWKPLPFPHLKSMSFSHCY 844

Query: 546 KLKKLPFDSNSARERNIVISGYTKWWDQLEWVDEATRNAFLPCFKT 591
           KLKKLP DSNSARERNIVISG  +WW+QLEWVDEATRNAFLPCF +
Sbjct: 845 KLKKLPLDSNSARERNIVISGTRRWWEQLEWVDEATRNAFLPCFDS 890

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147852651|emb|CAN80649.1| hypothetical protein VITISV_017542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482674|ref|XP_002281708.2| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query593
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.829 0.554 0.370 8.8e-96
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.784 0.523 0.387 2.1e-88
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.785 0.526 0.393 1.3e-86
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.682 0.475 0.378 3.3e-79
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.745 0.457 0.375 3.6e-79
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.883 0.586 0.375 1.9e-76
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.735 0.493 0.347 1.7e-73
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.888 0.590 0.354 3.1e-67
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.887 0.585 0.345 1.5e-65
TAIR|locus:2031356884 AT1G63360 [Arabidopsis thalian 0.870 0.583 0.343 7.6e-64
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 718 (257.8 bits), Expect = 8.8e-96, Sum P(2) = 8.8e-96
 Identities = 198/534 (37%), Positives = 288/534 (53%)

Query:    73 VQGWLSRVDAVKAEADELIRHGSQEIEKLCLGGYCSKNCHSSY-KLGKQVAKKL------ 125
             VQ W S +D + + A E       E E L +  Y   N  S   KL  Q           
Sbjct:   366 VQEWRSAIDVLTSSAAEF---SGMEDEILPILKYSYDNLKSEQLKLCFQYCALFPEDHNI 422

Query:   126 -RDKLIDCWIGEGFLTERDRFVEQNQGYHILGILLHACLLEEGGDGKVKMHDVIRDMALW 184
              ++ L+D WIGEGF+ +R++   +NQGY I+GIL+ +CLL E     VKMHDV+R+MALW
Sbjct:   423 EKNDLVDYWIGEGFI-DRNKGKAENQGYEIIGILVRSCLLMEENQETVKMHDVVREMALW 481

Query:   185 IVCDIEKEKENFLVYAGVGLTEAPEVKGWENVRRISLMDNQITNLSEVATCRHLLTLFLN 244
             I  D  K+KENF+V AG+     PE++ W+  RR+SLM N I ++ +      L+TL L 
Sbjct:   482 IASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLR 541

Query:   245 QNKLQMIHNDFFRFMPSLKVLNLS-HAELTELPVGISDLVSLQHLDLSESDISELPGELK 303
             +N L  I + FFR MP L VL+LS + +L  LP  IS+ VSLQ+L LS + I   P  L 
Sbjct:   542 KNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLV 601

Query:   304 ALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIV 363
              L  L  LNLE+TR + +I    IS L+ L VLR+F        G  ED         ++
Sbjct:   602 ELRKLLYLNLEYTRMVESICG--ISGLTSLKVLRLF------VSGFPEDPC-------VL 646

Query:   364 EELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQL 423
              EL  L+ L+ ++ TL  +  L+  LS+ +L  CTRAL ++  N  +S+ +S +A +  L
Sbjct:   647 NELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSV-ISFVATMDSL 705

Query:   424 NRLRIAECKKLEELKMDYTGEVQQF-------VFHSLKKVEIVNSYKLKDLTFLVFAPNL 476
               L  A+   + E+K+     V           F +L +V +    +L+DLT+L+FAPNL
Sbjct:   706 QELHFAD-SDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNL 764

Query:   477 ESIEVLGCVAMEEMVSVGKFAAVPEVTANLNPFAKLQYLDLVGAINLKSIYWMPLSFPLL 536
               + V+    ++E+++  K  A  +   NL PF +L+ L L     LK I+  PL FP L
Sbjct:   765 TVLRVISASDLKEVINKEK--AEQQ---NLIPFQELKELRLENVQMLKHIHRGPLPFPCL 819

Query:   537 KYLRAMNCHKLKKLPFDSNSARERNIVISGYTKWWDQLEWVDEATRNAFLPCFK 590
             + +    C +L+KLP +  S    ++VI  + KW + LEW DEAT+  FLP  K
Sbjct:   820 QKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARFLPTLK 873
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034581001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (878 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.001
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information 
 Score = 58.4 bits (141), Expect = 4e-09
 Identities = 43/125 (34%), Positives = 72/125 (57%), Gaps = 5/125 (4%)

Query: 215 NVRRISLMDNQITNLSEV--ATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAEL 272
           N+  + L +N IT++  +      +L  L L+ NK++ + +   R +P+LK L+LS  +L
Sbjct: 117 NLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPL-RNLPNLKNLDLSFNDL 175

Query: 273 TELPVGISDLVSLQHLDLSESDISELPGELKALVNLKCLNLEWTRNLITIPRQLISNLSR 332
           ++LP  +S+L +L +LDLS + IS+LP E++ L  L+ L+L    N I      +SNL  
Sbjct: 176 SDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLS--NNSIIELLSSLSNLKN 233

Query: 333 LHVLR 337
           L  L 
Sbjct: 234 LSGLE 238

Length = 394
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 593
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.77
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.7
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.69
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.69
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.5
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.48
KOG4237498 consensus Extracellular matrix protein slit, conta 99.43
KOG4237498 consensus Extracellular matrix protein slit, conta 99.29
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.19
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.12
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.93
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.9
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.9
KOG4341483 consensus F-box protein containing LRR [General fu 98.85
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.83
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.81
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.78
KOG4341483 consensus F-box protein containing LRR [General fu 98.73
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.69
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.57
PLN03150623 hypothetical protein; Provisional 98.49
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.43
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.36
PLN03150623 hypothetical protein; Provisional 98.32
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.29
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.24
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.2
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.19
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.18
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.08
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.03
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.02
PRK15386426 type III secretion protein GogB; Provisional 97.98
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.9
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.87
PRK15386426 type III secretion protein GogB; Provisional 97.84
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.84
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.83
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.79
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.56
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.24
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.15
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.11
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.8
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.45
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.43
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.42
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.09
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.07
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.58
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.49
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.85
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.39
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.33
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.19
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.87
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.8
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.6
smart0037026 LRR Leucine-rich repeats, outliers. 90.6
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.97
smart0037026 LRR Leucine-rich repeats, outliers. 87.97
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 83.04
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-59  Score=511.99  Aligned_cols=546  Identities=35%  Similarity=0.543  Sum_probs=445.0

Q ss_pred             CCCeeEEeeecCchhhhhhhhhhccccchhhchHHHHHHHHHHHHHHHHHHHHHHHHH---HHhhc--cchhhhhhhHHH
Q 007687            1 MGNILQISISCDGAIFNRCLDCFLGKAAYIRNLQENVIALETELVKLIEAKNDVMARV---VNAER--QPMMTRLNKVQG   75 (593)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~f~~~a~~~~~~~~~~~~l~~~~~~L~~~~~~i~~k~---~~a~~--~~~l~~~~~~~~   75 (593)
                      ||+...+++.|.+.  +++|++|.+.||... ..+..        ++.+++++|+++|   |+|..  |+.|++|+++++
T Consensus       306 m~~~~~~~v~~L~~--~eaW~LF~~~v~~~~-~~~~~--------~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~e  374 (889)
T KOG4658|consen  306 MGVDYPIEVECLTP--EEAWDLFQKKVGPNT-LGSHP--------DIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQE  374 (889)
T ss_pred             ccCCccccccccCc--cccHHHHHHhhcccc-ccccc--------cHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHH
Confidence            78888899999998  999999999997542 22222        2566799999999   88876  779999999999


Q ss_pred             HHHHHHHHHHH-----------HHHH---HhhChHHHHHhHhccccCCcccchhhhhHHHHHHhHHHHHHHHHhcCCCCC
Q 007687           76 WLSRVDAVKAE-----------ADEL---IRHGSQEIEKLCLGGYCSKNCHSSYKLGKQVAKKLRDKLIDCWIGEGFLTE  141 (593)
Q Consensus        76 W~~~l~~l~~~-----------~~~i---~~~~l~~~lk~Cf~~yc~s~fp~~~~i~~~~~~~~~~~Li~~WiaeGfi~~  141 (593)
                      |+++.+.+.+.           +..+   .+++||.++|.|| +|| |+|||||+|++       ++||.+||||||+++
T Consensus       375 W~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CF-Lyc-alFPED~~I~~-------e~Li~yWiaEGfi~~  445 (889)
T KOG4658|consen  375 WRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCF-LYC-ALFPEDYEIKK-------EKLIEYWIAEGFIDP  445 (889)
T ss_pred             HHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHH-Hhh-ccCCcccccch-------HHHHHHHHhccCcCc
Confidence            99999866432           2233   3458999999999 999 99999999999       999999999999999


Q ss_pred             -chhhhHHHhHHHHHHHHHHhccccccC----CCceeehhHHHHHHHHHHhhcccccCcEEEEcCCcceecCCCCCCcce
Q 007687          142 -RDRFVEQNQGYHILGILLHACLLEEGG----DGKVKMHDVIRDMALWIVCDIEKEKENFLVYAGVGLTEAPEVKGWENV  216 (593)
Q Consensus       142 -~~~~~~e~~~~~~~~~L~~~~ll~~~~----~~~~~mhdli~dl~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  216 (593)
                       +++++++++|+.|+.+|+++++++...    ..+|+|||+|||||.|++++.+.++++++..++.+....|+...+..+
T Consensus       446 ~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~  525 (889)
T KOG4658|consen  446 LDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSV  525 (889)
T ss_pred             cccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhhe
Confidence             789999999999999999999999973    489999999999999999987777788777777677778888888999


Q ss_pred             eEEEeeccCcccccccccCCcccEEEccCcc--CcccchhhhccCCCCcEEEcCCC-CCCcCCcccCCCCCCcEeeCCCC
Q 007687          217 RRISLMDNQITNLSEVATCRHLLTLFLNQNK--LQMIHNDFFRFMPSLKVLNLSHA-ELTELPVGISDLVSLQHLDLSES  293 (593)
Q Consensus       217 r~L~l~~~~~~~l~~~~~~~~Lr~L~l~~~~--l~~~~~~~~~~l~~Lr~L~L~~~-~l~~lp~~i~~L~~L~~L~L~~~  293 (593)
                      |++++.+|.+..++....+++|++|.+.+|.  +..++..+|..++.||+|||++| .+.++|.+|+.|.+||||+++++
T Consensus       526 rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t  605 (889)
T KOG4658|consen  526 RRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDT  605 (889)
T ss_pred             eEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCC
Confidence            9999999999999988888899999999996  78899999999999999999988 78899999999999999999999


Q ss_pred             cCcccchhhhccccCceeeccccccccccchhhcCCCccCceeeccCCCCCCCCCCCccccccCCcccchhhhcCCCCCc
Q 007687          294 DISELPGELKALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIVEELLGLKYLE  373 (593)
Q Consensus       294 ~i~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~l~~L~  373 (593)
                      .++.+|.++++|++|.+|++..+..+..+|. ++..|++|++|.+......             .+...+.++..|++|+
T Consensus       606 ~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~-i~~~L~~Lr~L~l~~s~~~-------------~~~~~l~el~~Le~L~  671 (889)
T KOG4658|consen  606 GISHLPSGLGNLKKLIYLNLEVTGRLESIPG-ILLELQSLRVLRLPRSALS-------------NDKLLLKELENLEHLE  671 (889)
T ss_pred             CccccchHHHHHHhhheeccccccccccccc-hhhhcccccEEEeeccccc-------------cchhhHHhhhcccchh
Confidence            9999999999999999999999977777755 4777999999999876521             1567888899999999


Q ss_pred             eEEEEecCccchhhhhhcccccccceEEEecccCCCceeeeccccccccccceeeccccccceeeeccCCcccccC-CCC
Q 007687          374 VISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFV-FHS  452 (593)
Q Consensus       374 ~L~i~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~l~~~~~~~~~~~~-l~~  452 (593)
                      .++++..+......+.....+....+.+.+.++  .......++..+.+|+.|.|.+|...+. ...|........ |++
T Consensus       672 ~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~--~~~~~~~~~~~l~~L~~L~i~~~~~~e~-~~~~~~~~~~~~~f~~  748 (889)
T KOG4658|consen  672 NLSITISSVLLLEDLLGMTRLRSLLQSLSIEGC--SKRTLISSLGSLGNLEELSILDCGISEI-VIEWEESLIVLLCFPN  748 (889)
T ss_pred             hheeecchhHhHhhhhhhHHHHHHhHhhhhccc--ccceeecccccccCcceEEEEcCCCchh-hcccccccchhhhHHH
Confidence            999876555333444444444445555555442  2223335678899999999999987652 334443322233 678


Q ss_pred             ccEEEEeCCCCCCCCcccccCCCCCEEeeccCccchhhcccCcccccccccCCCCCCccccee-cccccccCcccCCCCC
Q 007687          453 LKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCVAMEEMVSVGKFAAVPEVTANLNPFAKLQYL-DLVGAINLKSIYWMPL  531 (593)
Q Consensus       453 L~~L~l~~c~~l~~l~~l~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L-~l~~c~~L~~l~~~~~  531 (593)
                      +..+.+.+|...+++.|....|+|+.|.+..|..++++++......  .+......|+++..+ .+.+.+++.++...+.
T Consensus       749 l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~--~l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l  826 (889)
T KOG4658|consen  749 LSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALL--ELKELILPFNKLEGLRMLCSLGGLPQLYWLPL  826 (889)
T ss_pred             HHHHHhhccccccccchhhccCcccEEEEecccccccCCCHHHHhh--hcccEEecccccccceeeecCCCCceeEeccc
Confidence            8899999999999999988899999999999999999876422211  111124567777777 5777788888888888


Q ss_pred             CCCccceeeeccCcCCCCCCCCCCcc--cc-cceEEeccccccccCccCchhhhccc
Q 007687          532 SFPLLKYLRAMNCHKLKKLPFDSNSA--RE-RNIVISGYTKWWDQLEWVDEATRNAF  585 (593)
Q Consensus       532 ~~~~L~~L~i~~C~~L~~lP~~~~~~--~l-~~l~I~~~~~~~~~l~w~~~~~~~~~  585 (593)
                      .+++|+.+.+..||+++.+|......  .- ..+......+|.+.+.|.+++++..+
T Consensus       827 ~~~~l~~~~ve~~p~l~~~P~~~~~~i~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~  883 (889)
T KOG4658|consen  827 SFLKLEELIVEECPKLGKLPLLSTLTIVGCEEKLKEYPDGEWLEGVYWEDELTKLRF  883 (889)
T ss_pred             CccchhheehhcCcccccCccccccceeccccceeecCCccceeeEEehhhhhhhhc
Confidence            88999999999999999999877665  22 33444466677899999999998876

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-07
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 9e-06
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 2e-05
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-05
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-05
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 5e-04
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure 
Iteration: 1

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 71/127 (55%), Gaps = 3/127 (2%)
Query: 215 NVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAELTE 274
           NVR ++L  N++ ++S +    +L  L L  N+LQ + N  F  + +LK L L   +L  
Sbjct: 64  NVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQS 123
Query: 275 LPVGISD-LVSLQHLDLSESDISELP-GELKALVNLKCLNLEWTRNLITIPRQLISNLSR 332
           LP G+ D L +L +L+L+ + +  LP G    L NL  L+L + + L ++P  +   L++
Sbjct: 124 LPDGVFDKLTNLTYLNLAHNQLQSLPKGVFDKLTNLTELDLSYNQ-LQSLPEGVFDKLTQ 182
Query: 333 LHVLRMF 339
           L  LR++
Sbjct: 183 LKDLRLY 189
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-09
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 9e-04
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
 Score =  104 bits (262), Expect = 5e-24
 Identities = 62/291 (21%), Positives = 124/291 (42%), Gaps = 45/291 (15%)

Query: 215 NVRRISLMDNQITNLSEVA--TCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAEL 272
           ++  + L +N ++ +   A     +L TL L  N+L++I    F  + +L  L++S  ++
Sbjct: 57  HLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKI 116

Query: 273 TELPVGI-SDLVSLQHLDLSESDISELP-GELKALVNLKCLNLEWTRNLIT-IPRQLISN 329
             L   +  DL +L+ L++ ++D+  +       L +L+ L LE  +  +T IP + +S+
Sbjct: 117 VILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLE--KCNLTSIPTEALSH 174

Query: 330 LSRLHVLRMFGASHNAFDGASEDSILFGG-GALIVEELLGLKYLEVISFTLRSSHGLQSV 388
           L  L VLR+    H   +   + S  F     L V E+    YL+ ++        L S+
Sbjct: 175 LHGLIVLRL---RHLNINAIRDYS--FKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSL 229

Query: 389 LSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAE-------------CKKLE 435
             +H               + T++   A+  L  L  L ++                +L+
Sbjct: 230 SITH--------------CNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQ 275

Query: 436 ELKMDYT--GEVQQFVFHSLKKVEIVNSY--KLKDLTFLVFAPNLESIEVL 482
           E+++       V+ + F  L  + ++N    +L  L   VF   + ++E L
Sbjct: 276 EIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESVFHS-VGNLETL 325
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query593
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.92
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.86
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.86
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.85
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.78
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.75
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.75
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.74
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.73
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.71
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.7
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.7
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.68
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.67
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.66
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.63
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.63
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.6
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.6
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.59
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.58
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.57
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.53
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.53
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.49
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.43
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.42
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.41
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.41
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.38
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.36
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.35
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.34
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.33
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.32
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.3
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.25
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.23
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.22
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.2
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.19
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.16
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.16
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.07
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.94
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.92
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.88
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 98.87
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.86
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.85
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.58
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.53
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.52
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.96
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.93
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.89
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.85
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.82
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.78
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.54
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.63
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.77
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.82
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.31
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.95  E-value=9.1e-27  Score=236.17  Aligned_cols=303  Identities=18%  Similarity=0.206  Sum_probs=209.3

Q ss_pred             CCCcceeEEEeeccCcccccccccCCcccEEEccCccCcccchhhhccCCCCcEEEcCCCCCCcCCcccCCCCCCcEeeC
Q 007687          211 KGWENVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDL  290 (593)
Q Consensus       211 ~~~~~lr~L~l~~~~~~~l~~~~~~~~Lr~L~l~~~~l~~~~~~~~~~l~~Lr~L~L~~~~l~~lp~~i~~L~~L~~L~L  290 (593)
                      ..++++++|++.++.+..++....+++|++|++++|.++.++.  +..+++|++|++++|.++.+| .++.+++|++|++
T Consensus        41 ~~l~~L~~L~l~~~~i~~~~~~~~~~~L~~L~l~~n~i~~~~~--~~~l~~L~~L~L~~n~i~~~~-~~~~l~~L~~L~l  117 (347)
T 4fmz_A           41 EELESITKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDISP--LSNLVKLTNLYIGTNKITDIS-ALQNLTNLRELYL  117 (347)
T ss_dssp             HHHTTCSEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSSCCCCCG-GGTTCTTCSEEEC
T ss_pred             hhcccccEEEEeCCccccchhhhhcCCccEEEccCCccccchh--hhcCCcCCEEEccCCcccCch-HHcCCCcCCEEEC
Confidence            3456788888888888888777778888888888888887776  778888888888888888775 5888888888888


Q ss_pred             CCCcCcccchhhhccccCceeeccccccccccchhhcCCCccCceeeccCCCCCCCCCCCccccccCCcccchhhhcCCC
Q 007687          291 SESDISELPGELKALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNAFDGASEDSILFGGGALIVEELLGLK  370 (593)
Q Consensus       291 ~~~~i~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~l~  370 (593)
                      ++|.++.+|. +..+++|++|++++|.....++.  +..+++|++|++.++...                 ....+..++
T Consensus       118 ~~n~i~~~~~-~~~l~~L~~L~l~~n~~~~~~~~--~~~l~~L~~L~l~~~~~~-----------------~~~~~~~l~  177 (347)
T 4fmz_A          118 NEDNISDISP-LANLTKMYSLNLGANHNLSDLSP--LSNMTGLNYLTVTESKVK-----------------DVTPIANLT  177 (347)
T ss_dssp             TTSCCCCCGG-GTTCTTCCEEECTTCTTCCCCGG--GTTCTTCCEEECCSSCCC-----------------CCGGGGGCT
T ss_pred             cCCcccCchh-hccCCceeEEECCCCCCcccccc--hhhCCCCcEEEecCCCcC-----------------CchhhccCC
Confidence            8888887776 77888888888888866666655  788888888888877653                 122266777


Q ss_pred             CCceEEEEecCccchhhhhhcccccccceEEEecccCCCceeeeccccccccccceeeccccccceeeeccCCcccccCC
Q 007687          371 YLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSLEVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFVF  450 (593)
Q Consensus       371 ~L~~L~i~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~l~~~~~~~~~~~~l  450 (593)
                      +|+.|+++.+....++.    .....+|+.|+++++.-.. ..  .+..+++|++|++++|.... +. . .     ..+
T Consensus       178 ~L~~L~l~~n~l~~~~~----~~~l~~L~~L~l~~n~l~~-~~--~~~~~~~L~~L~l~~n~l~~-~~-~-~-----~~l  242 (347)
T 4fmz_A          178 DLYSLSLNYNQIEDISP----LASLTSLHYFTAYVNQITD-IT--PVANMTRLNSLKIGNNKITD-LS-P-L-----ANL  242 (347)
T ss_dssp             TCSEEECTTSCCCCCGG----GGGCTTCCEEECCSSCCCC-CG--GGGGCTTCCEEECCSSCCCC-CG-G-G-----TTC
T ss_pred             CCCEEEccCCccccccc----ccCCCccceeecccCCCCC-Cc--hhhcCCcCCEEEccCCccCC-Cc-c-h-----hcC
Confidence            78888877665555443    2234577788877764322 21  26677788888888775433 21 1 2     237


Q ss_pred             CCccEEEEeCCCCCCCCcccccCCCCCEEeeccCccchhhcccCcccccccccCCCCCCcccceecccccccCcccCCCC
Q 007687          451 HSLKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCVAMEEMVSVGKFAAVPEVTANLNPFAKLQYLDLVGAINLKSIYWMP  530 (593)
Q Consensus       451 ~~L~~L~l~~c~~l~~l~~l~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~l~~~~  530 (593)
                      ++|+.|++++| .++.++.+..+++|++|++++|.. ..+.             .+..+++|+.|++++|.--...+...
T Consensus       243 ~~L~~L~l~~n-~l~~~~~~~~l~~L~~L~l~~n~l-~~~~-------------~~~~l~~L~~L~L~~n~l~~~~~~~l  307 (347)
T 4fmz_A          243 SQLTWLEIGTN-QISDINAVKDLTKLKMLNVGSNQI-SDIS-------------VLNNLSQLNSLFLNNNQLGNEDMEVI  307 (347)
T ss_dssp             TTCCEEECCSS-CCCCCGGGTTCTTCCEEECCSSCC-CCCG-------------GGGGCTTCSEEECCSSCCCGGGHHHH
T ss_pred             CCCCEEECCCC-ccCCChhHhcCCCcCEEEccCCcc-CCCh-------------hhcCCCCCCEEECcCCcCCCcChhHh
Confidence            78888888887 677777777888888888887732 2221             34567788888888764322222223


Q ss_pred             CCCCccceeeeccCcCCCCCCCCCCcc-cccceEEeccc
Q 007687          531 LSFPLLKYLRAMNCHKLKKLPFDSNSA-RERNIVISGYT  568 (593)
Q Consensus       531 ~~~~~L~~L~i~~C~~L~~lP~~~~~~-~l~~l~I~~~~  568 (593)
                      ..+++|++|++++|+ ++.+|. .... +|+.+.+.+++
T Consensus       308 ~~l~~L~~L~L~~n~-l~~~~~-~~~l~~L~~L~l~~N~  344 (347)
T 4fmz_A          308 GGLTNLTTLFLSQNH-ITDIRP-LASLSKMDSADFANQV  344 (347)
T ss_dssp             HTCTTCSEEECCSSS-CCCCGG-GGGCTTCSEESSSCC-
T ss_pred             hccccCCEEEccCCc-cccccC-hhhhhccceeehhhhc
Confidence            457888888888875 555544 3333 56777666553
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 593
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 62.3 bits (150), Expect = 5e-11
 Identities = 32/162 (19%), Positives = 64/162 (39%), Gaps = 28/162 (17%)

Query: 204 LTEAPEVKGWENVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMI------------ 251
           L +   +    N+  + L +NQI+NL+ ++    L  L L  N++  I            
Sbjct: 231 LKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNL 290

Query: 252 --------HNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDLSESDISELPGELK 303
                          + +L  L L    ++++   +S L  LQ L  + + +S++   L 
Sbjct: 291 ELNENQLEDISPISNLKNLTYLTLYFNNISDIS-PVSSLTKLQRLFFANNKVSDVS-SLA 348

Query: 304 ALVNLKCLNLEWTRNLITIPRQLISNLSRLHVLRMFGASHNA 345
            L N+  L+    +     P   ++NL+R+  L +   +  A
Sbjct: 349 NLTNINWLSAGHNQISDLTP---LANLTRITQLGL---NDQA 384
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query593
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.7
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.7
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.66
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.51
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.38
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.15
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.02
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.94
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.92
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.72
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.49
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.96
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.88
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.92
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.05
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.95
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.86  E-value=1.5e-20  Score=190.50  Aligned_cols=297  Identities=16%  Similarity=0.205  Sum_probs=190.7

Q ss_pred             cceeEEEeeccCcccccccccCCcccEEEccCccCcccchhhhccCCCCcEEEcCCCCCCcCCcccCCCCCCcEeeCCCC
Q 007687          214 ENVRRISLMDNQITNLSEVATCRHLLTLFLNQNKLQMIHNDFFRFMPSLKVLNLSHAELTELPVGISDLVSLQHLDLSES  293 (593)
Q Consensus       214 ~~lr~L~l~~~~~~~l~~~~~~~~Lr~L~l~~~~l~~~~~~~~~~l~~Lr~L~L~~~~l~~lp~~i~~L~~L~~L~L~~~  293 (593)
                      .++++|++.++.++.+.....+++|++|++++|.++.+++  ++++++|++|++++|.+..++ .++.+++|++|++.++
T Consensus        44 ~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~--l~~L~~L~~L~L~~n~i~~i~-~l~~l~~L~~L~~~~~  120 (384)
T d2omza2          44 DQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNNQIADIT-PLANLTNLTGLTLFNN  120 (384)
T ss_dssp             TTCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCSS
T ss_pred             CCCCEEECCCCCCCCccccccCCCCCEEeCcCCcCCCCcc--ccCCccccccccccccccccc-cccccccccccccccc
Confidence            5788888888888887777778888888888888888875  788888888888888888775 4778888888888877


Q ss_pred             cCcccchhhhccccCceeeccccc-----------------------------------------cccccchhhcCCCcc
Q 007687          294 DISELPGELKALVNLKCLNLEWTR-----------------------------------------NLITIPRQLISNLSR  332 (593)
Q Consensus       294 ~i~~lp~~i~~L~~L~~L~l~~~~-----------------------------------------~l~~lp~~~i~~l~~  332 (593)
                      .++.++.. .....+..+....+.                                         .....+.. ...+++
T Consensus       121 ~~~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~l~~  198 (384)
T d2omza2         121 QITDIDPL-KNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISV-LAKLTN  198 (384)
T ss_dssp             CCCCCGGG-TTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGG-GGGCTT
T ss_pred             cccccccc-cccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccc-cccccc
Confidence            66655432 112222222211110                                         00111122 556777


Q ss_pred             CceeeccCCCCCCCCCCCccccccCCcccchhhhcCCCCCceEEEEecCccchhhhhhcccccccceEEEecccCCCcee
Q 007687          333 LHVLRMFGASHNAFDGASEDSILFGGGALIVEELLGLKYLEVISFTLRSSHGLQSVLSSHKLRCCTRALLLQCFNDSTSL  412 (593)
Q Consensus       333 L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~l~~L~~L~i~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~  412 (593)
                      ++.+.+.++...                 .+.......+|+.|.++.+....++.+    ....+|+.|++.++.-. . 
T Consensus       199 ~~~l~l~~n~i~-----------------~~~~~~~~~~L~~L~l~~n~l~~~~~l----~~l~~L~~L~l~~n~l~-~-  255 (384)
T d2omza2         199 LESLIATNNQIS-----------------DITPLGILTNLDELSLNGNQLKDIGTL----ASLTNLTDLDLANNQIS-N-  255 (384)
T ss_dssp             CSEEECCSSCCC-----------------CCGGGGGCTTCCEEECCSSCCCCCGGG----GGCTTCSEEECCSSCCC-C-
T ss_pred             cceeeccCCccC-----------------CCCcccccCCCCEEECCCCCCCCcchh----hcccccchhccccCccC-C-
Confidence            777777766543                 122345566777777776655554432    22347778888776422 2 


Q ss_pred             eeccccccccccceeeccccccceeeeccCCcccccCCCCccEEEEeCCCCCCCCcccccCCCCCEEeeccCccchhhcc
Q 007687          413 EVSALADLKQLNRLRIAECKKLEELKMDYTGEVQQFVFHSLKKVEIVNSYKLKDLTFLVFAPNLESIEVLGCVAMEEMVS  492 (593)
Q Consensus       413 ~~~~l~~l~~L~~L~l~~~~~~~~l~~~~~~~~~~~~l~~L~~L~l~~c~~l~~l~~l~~l~~L~~L~l~~c~~l~~~~~  492 (593)
                       +..+..+++|++|+++++....  .+.+.      .++.++.+.+.++ .++.++.+..+++++.|++++|. ++.+. 
T Consensus       256 -~~~~~~~~~L~~L~l~~~~l~~--~~~~~------~~~~l~~l~~~~n-~l~~~~~~~~~~~l~~L~ls~n~-l~~l~-  323 (384)
T d2omza2         256 -LAPLSGLTKLTELKLGANQISN--ISPLA------GLTALTNLELNEN-QLEDISPISNLKNLTYLTLYFNN-ISDIS-  323 (384)
T ss_dssp             -CGGGTTCTTCSEEECCSSCCCC--CGGGT------TCTTCSEEECCSS-CCSCCGGGGGCTTCSEEECCSSC-CSCCG-
T ss_pred             -CCcccccccCCEeeccCcccCC--CCccc------ccccccccccccc-ccccccccchhcccCeEECCCCC-CCCCc-
Confidence             2236667888888887765433  12222      3677888888777 67777777788888888888773 33321 


Q ss_pred             cCcccccccccCCCCCCcccceecccccccCcccCCCCCCCCccceeeeccCcCCCCCCCCCCcc-cccceEEec
Q 007687          493 VGKFAAVPEVTANLNPFAKLQYLDLVGAINLKSIYWMPLSFPLLKYLRAMNCHKLKKLPFDSNSA-RERNIVISG  566 (593)
Q Consensus       493 ~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~l~~~~~~~~~L~~L~i~~C~~L~~lP~~~~~~-~l~~l~I~~  566 (593)
                                  .+..+|+|++|++++| .++.++ ....+|+|++|++++| +++.+|. +..+ +|+.+.|++
T Consensus       324 ------------~l~~l~~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~N-~l~~l~~-l~~l~~L~~L~L~~  382 (384)
T d2omza2         324 ------------PVSSLTKLQRLFFANN-KVSDVS-SLANLTNINWLSAGHN-QISDLTP-LANLTRITQLGLND  382 (384)
T ss_dssp             ------------GGGGCTTCCEEECCSS-CCCCCG-GGGGCTTCCEEECCSS-CCCBCGG-GTTCTTCSEEECCC
T ss_pred             ------------ccccCCCCCEEECCCC-CCCCCh-hHcCCCCCCEEECCCC-cCCCChh-hccCCCCCEeeCCC
Confidence                        2456788888888886 566665 3455788888888776 5777664 2333 577777653
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure