Citrus Sinensis ID: 007693

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590---
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSREELLELQYSSLSLARPDDSSTQDAMGLR
cccccccHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHHHccccEEEEcccccccHHHHHHHHccccccEEEcccccccccHHHHHccccccccEEEcccccccccccHHHHcccccccEEEccccccccHHHHHHcccccccEEEccccccccccHHHccccccccEEEccccccccccHHHHcccccccEEEccccccccccccccccEEEccccccccccccccccccccEEEccccccccHHHHHHHHccccccEEEcccccccccccccccccccEEEccccccccccHHHHHHccccccEEEEEccccccccHHHHHcccccccEEEccccccccccHHHHHccccccEEEccccccccccccccccHHHHHcHHHccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccHHHHHHHHcccccEEEcccccccccccccccccccccHHcccccccccccccccccccHHHHHccccHHHHHHHcccccccccccccccccccccc
cccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccEEEccccccccHHHHHHHHcHHcccEEEccccccccHHHHHHHHcHHHccEEEcccccccHHHHHHHHHHHcccEEccccccccHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHHcccEEEcccccccccccccHHcHccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHcHHccccccccccHHHHHHHHHHHHHccEEccccccccHHHHHHHHHHHHHHcEEccccccccHHHHHHHHHHHHHccEEEcccccccHHHHHHHHHHHcccEEEcccccccccEcccccccccHHHHHHHHHHHHccEEccccccccHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHHcccEEEcccccccHHHHHHHHcHHcccEEEccccccccHHHHHHHHHHcccEEEEEccccEcccccccccccccccccccHHHHHcccccccccccHHHHHccccHHHHHHHHHcccHccccccccHHHccccc
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIElrgensvdAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTgmtclkeldlsrcvkVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLqnlsvldlgglpvtDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKmfprlsflnlawtgvtklpnissleclnlsnctidsilegnenkaplakISLAGTTFINEREAFLYIETSLLSFldvsnsslsrFCFLTQMKALEhldlsssmigddSVEMVACVGANlrnlnlsntrfssagvgilaghlpnleilslsgtqiDDYAISYMsmmpslkfidisnTDIKGFIQQVGAETDLVLSLTALQNLNHLERLnleqtqvsdatlfplstFKELIHLSLrnasltdvslhqlsslskltnlsirdavltnsglgsfkpprslklldlhggwllTEDAILQFCKMHPRIEVWHELSvicpsdqigsngpspsrtSLRASLVkqkqdpmpmshsfLDQRLKYSREELLELQYSSlslarpddsstqdamglr
MERERESELVRLCIEaacqsgesvqkWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIelrgensvdAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTnsglgsfkppRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLvkqkqdpmpmsHSFLDQRLKYSREELLELQysslslarpddsstqdamglr
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSllrhlirrrliFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSlklldlhggwllTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSReellelqysslslARPDDSSTQDAMGLR
********LVRLCIEAACQSG**VQKW******LERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICP***********************************************************************
*****ES**VRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVI*************************************DQRLKYSREELLELQYS************Q*AMG**
*********VRLCIEAACQ***********RRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQ*************************PMSHSFLDQRLKYSREELLELQYSSLSL***************
*****ESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICP******************************SHSFLDQRLKYSREELLELQYS*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSREELLELQYSSLSLARPDDSSTQDAMGLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query593 2.2.26 [Sep-21-2011]
Q8YA32 1778 Internalin-I OS=Listeria yes no 0.561 0.187 0.263 5e-09
Q723X5 1775 Internalin-I OS=Listeria yes no 0.568 0.189 0.265 4e-08
Q8N1E6418 F-box/LRR-repeat protein yes no 0.482 0.684 0.253 6e-07
Q8BID8400 F-box/LRR-repeat protein yes no 0.478 0.71 0.258 8e-07
Q17R01400 F-box/LRR-repeat protein yes no 0.478 0.71 0.258 8e-07
Q8CDU4790 F-box/LRR-repeat protein no no 0.401 0.301 0.241 2e-06
P0DJM0 800 Internalin-A OS=Listeria no no 0.453 0.336 0.283 3e-05
G2K3G6 800 Internalin-A OS=Listeria no no 0.438 0.325 0.275 4e-05
Q723K6 800 Internalin-A OS=Listeria no no 0.438 0.325 0.275 5e-05
P34284466 Uncharacterized F-box/LRR yes no 0.537 0.684 0.252 0.0001
>sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=4 SV=1 Back     alignment and function desciption
 Score = 63.5 bits (153), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 106/403 (26%), Positives = 176/403 (43%), Gaps = 70/403 (17%)

Query: 81  EWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSIS 140
           E +  L     L++L ++D   +T+  + A+T +  LK L L  C  +T  G   L ++ 
Sbjct: 380 EDLGTLNNLPKLQTLVLSDNENLTN--ITAITDLPQLKTLTLDGC-GITSIGT--LDNLP 434

Query: 141 TLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQV 200
            LEKL L E  +T             S+ ++  LP             +L YLD+  + +
Sbjct: 435 KLEKLDLKENQIT-------------SISEITDLP-------------RLSYLDVSVNNL 468

Query: 201 SNRGAAVLKMFPRLSFLNLA---WTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLA 257
           +  G   LK  P L +LN++    + V+ L N  SL  +N+SN  I ++  G   + P  
Sbjct: 469 TTIGD--LKKLPLLEWLNVSSNRLSDVSTLTNFPSLNYINISNNVIRTV--GKMTELPSL 524

Query: 258 KISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDS 317
           K   A    I++    +  +   L  +D SN+ ++       +  L+ LD+ S+ I   S
Sbjct: 525 KEFYAQNNSISDIS--MIHDMPNLRKVDASNNLITNIGTFDNLPKLQSLDVHSNRITSTS 582

Query: 318 V--------------EMVACVGA--NLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGT 361
           V               ++  +G   NL +L   N  F+        G LPNLE L +S  
Sbjct: 583 VIHDLPSLETFNAQTNLITNIGTMDNLPDLTYVNLSFNRIPSLAPIGDLPNLETLIVSDN 642

Query: 362 QIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQT 421
                ++  M  +P L+ +D+ N     ++   G E +    L++L +L +L  LNL   
Sbjct: 643 NSYLRSLGTMDGVPKLRILDLQN----NYLNYTGTEGN----LSSLSDLTNLTELNLRNN 694

Query: 422 QVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNL 464
              D  +  LST   LI+L+L +  + D+     S+LS LTNL
Sbjct: 695 VYID-DISGLSTLSRLIYLNLDSNKIEDI-----SALSNLTNL 731
Unknown. A role in virulence could not be demonstrated.
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) (taxid: 169963)
>sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 Back     alignment and function description
>sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 Back     alignment and function description
>sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 Back     alignment and function description
>sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 Back     alignment and function description
>sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 Back     alignment and function description
>sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 Back     alignment and function description
>sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 Back     alignment and function description
>sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 Back     alignment and function description
>sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=4 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query593
356513289589 PREDICTED: uncharacterized protein LOC10 0.974 0.981 0.650 0.0
255537779597 protein binding protein, putative [Ricin 0.964 0.958 0.666 0.0
297742329588 unnamed protein product [Vitis vinifera] 0.954 0.962 0.635 0.0
225426352598 PREDICTED: uncharacterized protein LOC10 0.966 0.958 0.628 0.0
449464060586 PREDICTED: uncharacterized protein LOC10 0.978 0.989 0.583 0.0
297803756590 hypothetical protein ARALYDRAFT_492485 [ 0.957 0.962 0.542 1e-157
186701224600 leucine-rich repeat family protein [Arab 0.974 0.963 0.550 1e-156
42567079597 leucine-rich repeat-containing protein [ 0.971 0.964 0.525 1e-148
326513166627 predicted protein [Hordeum vulgare subsp 0.954 0.902 0.513 1e-146
218196286601 hypothetical protein OsI_18882 [Oryza sa 0.959 0.946 0.506 1e-145
>gi|356513289|ref|XP_003525346.1| PREDICTED: uncharacterized protein LOC100814174 [Glycine max] Back     alignment and taxonomy information
 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/581 (65%), Positives = 474/581 (81%), Gaps = 3/581 (0%)

Query: 4   ERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVF 63
           + ESELV  CIEAAC+S ESV KWR Q RSL+RLP+HLADSLLR LI RRL++PSLLEVF
Sbjct: 2   KSESELVGFCIEAACESRESVDKWRMQSRSLDRLPSHLADSLLRRLIARRLLYPSLLEVF 61

Query: 64  KHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLS 123
           KH+AE +++RG+NSVDAEWMAYLGA+R+LR LN++DC RV++SALW +TGM+ L+ELDLS
Sbjct: 62  KHSAEEVDVRGDNSVDAEWMAYLGAYRHLRYLNLSDCHRVSTSALWPITGMSSLQELDLS 121

Query: 124 RCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRS 183
           RC KV DAG+ H+LSI  LE+L +SET +TA G+ LL+SL+NLS+LDLGGLPV D+ L S
Sbjct: 122 RCFKVNDAGINHILSIPNLERLRISETSVTAKGVKLLASLKNLSLLDLGGLPVDDVALTS 181

Query: 184 LQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTI 243
           LQVL +L Y+DLWGS++SN+GA+VL  FP+L++LNLAWT VTKLP +S LE LN+SNCTI
Sbjct: 182 LQVLKRLHYIDLWGSKISNKGASVLNTFPKLTYLNLAWTSVTKLPKLSFLEYLNMSNCTI 241

Query: 244 DSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKAL 303
           DSILE  ++KAPLAK+ L+G  F+NE EA LY  T+ LSFLDV+NSS  RF FL++MK +
Sbjct: 242 DSILE--DDKAPLAKLILSGAMFMNEAEALLYANTNFLSFLDVANSSFHRFFFLSKMKVI 299

Query: 304 EHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQI 363
           EHL+LSS M+GDDSVEMVAC G NL++LNLS TR SSAG+GILAGH+P+LEILSLS T +
Sbjct: 300 EHLNLSSCMMGDDSVEMVACAGGNLKSLNLSGTRVSSAGLGILAGHVPHLEILSLSQTPV 359

Query: 364 DDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQV 423
           DD AIS++SMMPSLK +D+SNT+IKGF+ Q   + + +LSL ALQNL  LERLNLE TQV
Sbjct: 360 DDTAISFISMMPSLKDVDLSNTNIKGFLHQGRTDVNSLLSLMALQNLK-LERLNLEHTQV 418

Query: 424 SDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPR 483
            D  L+PLS+F+EL +LSL++ASL D+SL+ LSS+ KLTNLSI DAVLTN GL  FK P 
Sbjct: 419 RDEALYPLSSFQELRYLSLKSASLADISLYYLSSIPKLTNLSICDAVLTNYGLDMFKAPE 478

Query: 484 SLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLV 543
           +LKLLDL G WLLTED IL FC+ HP++EV HEL  + P +Q G N  SPSR++ +   +
Sbjct: 479 TLKLLDLKGCWLLTEDTILSFCRNHPQVEVRHELGTLFPVNQNGLNHSSPSRSTSKTMQM 538

Query: 544 KQKQDPMPMSHSFLDQRLKYSREELLELQYSSLSLARPDDS 584
            +K+D +P+S  F+DQRLKYSR+ELL LQ++SL LA   +S
Sbjct: 539 TKKKDQIPLSPYFVDQRLKYSRDELLALQFTSLPLASSSES 579

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255537779|ref|XP_002509956.1| protein binding protein, putative [Ricinus communis] gi|223549855|gb|EEF51343.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297742329|emb|CBI34478.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225426352|ref|XP_002266070.1| PREDICTED: uncharacterized protein LOC100261612 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449464060|ref|XP_004149747.1| PREDICTED: uncharacterized protein LOC101203036 [Cucumis sativus] gi|449505065|ref|XP_004162366.1| PREDICTED: uncharacterized protein LOC101225004 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297803756|ref|XP_002869762.1| hypothetical protein ARALYDRAFT_492485 [Arabidopsis lyrata subsp. lyrata] gi|297315598|gb|EFH46021.1| hypothetical protein ARALYDRAFT_492485 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|186701224|gb|ACC91251.1| leucine-rich repeat family protein [Arabidopsis halleri] Back     alignment and taxonomy information
>gi|42567079|ref|NP_194115.3| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|20466546|gb|AAM20590.1| unknown protein [Arabidopsis thaliana] gi|22136448|gb|AAM91302.1| unknown protein [Arabidopsis thaliana] gi|51971383|dbj|BAD44356.1| putative protein [Arabidopsis thaliana] gi|332659411|gb|AEE84811.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|326513166|dbj|BAK06823.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|218196286|gb|EEC78713.1| hypothetical protein OsI_18882 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query593
TAIR|locus:2138131597 AT4G23840 "AT4G23840" [Arabido 0.939 0.932 0.500 2.2e-137
TAIR|locus:2036199585 AT1G15740 [Arabidopsis thalian 0.671 0.680 0.267 2.8e-22
UNIPROTKB|Q723K6 800 inlA "Internalin-A" [Listeria 0.500 0.371 0.285 2.6e-11
TAIR|locus:2143320642 AT5G27920 "AT5G27920" [Arabido 0.650 0.601 0.252 1.1e-10
DICTYBASE|DDB_G0291424902 DDB_G0291424 "Transcription fa 0.531 0.349 0.236 2.3e-10
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.460 0.252 0.264 4.6e-09
ZFIN|ZDB-GENE-030131-5920411 fbxl14a "F-box and leucine-ric 0.477 0.688 0.267 9.7e-09
UNIPROTKB|Q17R01400 FBXL14 "F-box/LRR-repeat prote 0.482 0.715 0.266 1.2e-08
MGI|MGI:2141676400 Fbxl14 "F-box and leucine-rich 0.482 0.715 0.266 1.2e-08
RGD|1305523400 Fbxl14 "F-box and leucine-rich 0.482 0.715 0.266 1.2e-08
TAIR|locus:2138131 AT4G23840 "AT4G23840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1345 (478.5 bits), Expect = 2.2e-137, P = 2.2e-137
 Identities = 284/567 (50%), Positives = 375/567 (66%)

Query:     6 ESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSXXXXXXXXXXXFPSLLEVFKH 65
             ES LVRLC++ AC+SG++V++WR QRRSLE LP HLAD+           FPSLLE FK+
Sbjct:     2 ESPLVRLCLKEACKSGDAVERWRLQRRSLESLPPHLADALLRRLLKKRLLFPSLLEGFKY 61

Query:    66 NAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRC 125
             + E I+LRG++SV+AEWMAY+G F  L +LN++DC+R+ SS LW +TG+T L ELDLSRC
Sbjct:    62 SVENIDLRGKSSVNAEWMAYIGGFVNLITLNLSDCQRINSSTLWPITGLTSLTELDLSRC 121

Query:   126 VKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQ 185
              KVTDAGMKHL S+  L+KLW+S+TG+T  GI+LL+SL+ LS+LDLGGLPVTD  L SLQ
Sbjct:   122 FKVTDAGMKHLQSVVNLKKLWISQTGVTEVGISLLASLKKLSLLDLGGLPVTDQNLISLQ 181

Query:   186 VLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDS 245
              LTKLEYLD+WGS V+N+GA  +  F  LSFLNL+WT +T+ PNI  LECL+++ CTI S
Sbjct:   182 ALTKLEYLDIWGSNVTNQGAVSILKFSNLSFLNLSWTSITQTPNIPHLECLHMNTCTIVS 241

Query:   246 ILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEH 305
               + + + A L K+ L+G  F  E E+  +   S +++LDVS +SL  F FL  M  LEH
Sbjct:   242 EPKTHSSLASLKKLVLSGANFSAETESLSFTNKSCITYLDVSKTSLKNFSFLETMFNLEH 301

Query:   306 LDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDD 365
             LDLSS+  GDDSV  VACVG NL+NLN+S+T+ + +GVG LAGH+P LE LS+S T +DD
Sbjct:   302 LDLSSTAFGDDSVGFVACVGENLKNLNVSDTQITPSGVGNLAGHVPQLETLSMSQTFVDD 361

Query:   366 YAISYMSM-MPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVS 424
              +I  +S  MP +K +D+      GF   +  + +   SL ALQ+L  LE L+LE   + 
Sbjct:   362 LSILLISTTMPCIKALDLGMNSTLGFYYLISPQEEKEKSLAALQSLTSLETLSLEHPYLG 421

Query:   425 DATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRS 484
             D  L  LS+   L HLSL + SLTD +LH LSSL  L +L +RD VLT++GL  F+PP  
Sbjct:   422 DKALSGLSSLTGLTHLSLTSTSLTDSTLHHLSSLPNLVSLGVRDGVLTSNGLEKFRPPNR 481

Query:   485 XXXXXXXXXXXXTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSP-SRTSLRASLV 543
                         T+D I   CK +P I+V HE +    S  +  N   P S T      V
Sbjct:   482 LRTLDLQGCWLLTKDDIAGLCKRYPHIKVRHEHA---DSSSLDQNQLLPRSSTPQSFGKV 538

Query:   544 KQKQDPMPMS-----HSFLDQRLKYSR 565
              ++ +  P S      SFLDQR+KY+R
Sbjct:   539 ARRNNQRPESSVAVPRSFLDQRVKYNR 565
GO:0005575 "cellular_component" evidence=ND
TAIR|locus:2036199 AT1G15740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q723K6 inlA "Internalin-A" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
TAIR|locus:2143320 AT5G27920 "AT5G27920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291424 DDB_G0291424 "Transcription factor SKN7" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5920 fbxl14a "F-box and leucine-rich repeat protein 14a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q17R01 FBXL14 "F-box/LRR-repeat protein 14" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2141676 Fbxl14 "F-box and leucine-rich repeat protein 14" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305523 Fbxl14 "F-box and leucine-rich repeat protein 14" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00006759001
SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (629 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00001958001
SubName- Full=Chromosome chr5 scaffold_124, whole genome shotgun sequence; (353 aa)
      • 0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-07
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score = 53.7 bits (129), Expect = 2e-07
 Identities = 102/425 (24%), Positives = 160/425 (37%), Gaps = 80/425 (18%)

Query: 138 SISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWG 197
           SI  LE L LS   L+ +    + S  +L VLDLGG  +   +  SL  LT LE+L L  
Sbjct: 138 SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLAS 197

Query: 198 SQVSNRGAAVLKMFPRLSFLNLAWTGVT-KLPN----ISSLECLNLS-NCTIDSILEGNE 251
           +Q+  +    L     L ++ L +  ++ ++P     ++SL  L+L  N     I     
Sbjct: 198 NQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG 257

Query: 252 NKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFC--FLTQMKALEHLDLS 309
           N   L  + L            ++    L+S LD+S++SLS      + Q++ LE L L 
Sbjct: 258 NLKNLQYLFLYQNKLSGPIPPSIFSLQKLIS-LDLSDNSLSGEIPELVIQLQNLEILHLF 316

Query: 310 SSMIGDDSVEMVACVGANLRNLNLSNTRFSSA----------------GVGILAGHLP-- 351
           S+         +  +   L+ L L + +FS                      L G +P  
Sbjct: 317 SNNFTGKIPVALTSL-PRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEG 375

Query: 352 -----NLEILSLSGTQIDDYAISYMSMMPSLK------------------------FIDI 382
                NL  L L    ++      +    SL+                        F+DI
Sbjct: 376 LCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDI 435

Query: 383 SNTDIKGFIQQVGAETDLVLSLTALQNLN-----------------HLERLNLEQTQVSD 425
           SN +++G I     +      + +LQ L+                  LE L+L + Q S 
Sbjct: 436 SNNNLQGRINSRKWD------MPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSG 489

Query: 426 ATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSL 485
           A    L +  EL+ L L    L+     +LSS  KL +L +    L+     SF     L
Sbjct: 490 AVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVL 549

Query: 486 KLLDL 490
             LDL
Sbjct: 550 SQLDL 554

Length = 968
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 593
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.74
KOG4341483 consensus F-box protein containing LRR [General fu 99.55
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.46
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.43
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.42
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.41
KOG0617264 consensus Ras suppressor protein (contains leucine 99.39
KOG0617264 consensus Ras suppressor protein (contains leucine 99.37
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.33
KOG4341483 consensus F-box protein containing LRR [General fu 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.11
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.04
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.03
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.03
PLN03150623 hypothetical protein; Provisional 98.97
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.89
PLN03150623 hypothetical protein; Provisional 98.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.84
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.83
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.76
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.68
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.68
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.63
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.6
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.59
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.47
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.43
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.28
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.25
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.21
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.15
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.02
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.94
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.7
KOG4308478 consensus LRR-containing protein [Function unknown 97.6
PRK15386426 type III secretion protein GogB; Provisional 97.58
PRK15386426 type III secretion protein GogB; Provisional 97.57
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.43
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.38
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.31
KOG4308478 consensus LRR-containing protein [Function unknown 97.31
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.26
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.15
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.83
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.16
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 94.14
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.91
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 93.74
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.17
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 91.8
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.26
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.75
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.02
smart0037026 LRR Leucine-rich repeats, outliers. 90.02
smart0037026 LRR Leucine-rich repeats, outliers. 89.98
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.98
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 87.95
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.18
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 85.12
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 82.6
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 82.14
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.7
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.5e-45  Score=416.23  Aligned_cols=440  Identities=21%  Similarity=0.231  Sum_probs=252.2

Q ss_pred             cCCccEEEecCCCCCChhHHHHHhcCCCccEEEcCCCCccCchHHHhhhCCCCCcEEecCCCCCCChhhHHhhcCCCCCc
Q 007693           64 KHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLE  143 (593)
Q Consensus        64 ~~~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~i~~~~~~~l~~l~~L~~L~L~~~~~l~~~~~~~l~~~~~L~  143 (593)
                      .++|++|+|++|+ +.+..+.  +.+++|++|+|++|. +....+..++.+++|++|++++| .+....+..++++++|+
T Consensus       117 l~~L~~L~Ls~n~-l~~~~p~--~~l~~L~~L~Ls~n~-~~~~~p~~~~~l~~L~~L~L~~n-~l~~~~p~~~~~l~~L~  191 (968)
T PLN00113        117 SSSLRYLNLSNNN-FTGSIPR--GSIPNLETLDLSNNM-LSGEIPNDIGSFSSLKVLDLGGN-VLVGKIPNSLTNLTSLE  191 (968)
T ss_pred             CCCCCEEECcCCc-cccccCc--cccCCCCEEECcCCc-ccccCChHHhcCCCCCEEECccC-cccccCChhhhhCcCCC
Confidence            3455555555554 2222221  234555555555554 43334444555556666666555 34444445555555566


Q ss_pred             EEEccCCCCChhHHHHhcCCCCCCEEEcCCCCCChhhHHHhhcCCCCCEEEccCCccCccchHhhcCCCCCCeeeccccC
Q 007693          144 KLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTG  223 (593)
Q Consensus       144 ~L~L~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~  223 (593)
                      +|++++|.+.+..+..++++++|++|++++|.+.+..|..++++++|++|++++|.+++..|..+..+++|+.|++++|.
T Consensus       192 ~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~  271 (968)
T PLN00113        192 FLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNK  271 (968)
T ss_pred             eeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCe
Confidence            66665555555555555555555555555555555555555555555555555555555555555555555555555555


Q ss_pred             CcC-----CCCCCCCcEEEcCCCccc-chhcccCCCCCcceEeccCccccchhhHHhhhcCCCccEEeccCCCcchh--h
Q 007693          224 VTK-----LPNISSLECLNLSNCTID-SILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRF--C  295 (593)
Q Consensus       224 l~~-----l~~l~~L~~L~l~~n~l~-~l~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~ls~n~l~~~--~  295 (593)
                      +.+     +..+++|++|++++|.+. .+|..+..+++|+.|++++|.+.+..+. .+..+++|+.|++++|.+.+.  .
T Consensus       272 l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~-~~~~l~~L~~L~L~~n~l~~~~p~  350 (968)
T PLN00113        272 LSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPV-ALTSLPRLQVLQLWSNKFSGEIPK  350 (968)
T ss_pred             eeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCCh-hHhcCCCCCEEECcCCCCcCcCCh
Confidence            432     223455555555555554 3444444555555555555555432221 123455555555555555432  3


Q ss_pred             hcccCCCccEEEccCCCCChhHHHHHHhc-----------------------cCCCcEEEcCCCCCCCchHHHHHcCCCC
Q 007693          296 FLTQMKALEHLDLSSSMIGDDSVEMVACV-----------------------GANLRNLNLSNTRFSSAGVGILAGHLPN  352 (593)
Q Consensus       296 ~l~~~~~L~~L~L~~n~l~~~~~~~~~~~-----------------------~~~L~~L~l~~n~l~~~~~~~~~~~~~~  352 (593)
                      .+..+++|+.|++++|.+++..+..+...                       +++|+.|++++|.+++..+..+ ..++.
T Consensus       351 ~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~-~~l~~  429 (968)
T PLN00113        351 NLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEF-TKLPL  429 (968)
T ss_pred             HHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhH-hcCCC
Confidence            34444555555555555444333333332                       1444444444444444333333 33444


Q ss_pred             CcEEEccCCCCChHHHHHhhcCCCCCEEEeeCCccCccccccccchhhhhhHHhhccCCccCEEecCCCCcCCCcccccc
Q 007693          353 LEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLS  432 (593)
Q Consensus       353 L~~L~l~~n~i~~~~~~~l~~~~~L~~L~Ls~n~i~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~  432 (593)
                      |+.|++++|.+++..+..+..+++|+.|++++|.+.+..|.             ....++|+.|++++|++++..|..+.
T Consensus       430 L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~-------------~~~~~~L~~L~ls~n~l~~~~~~~~~  496 (968)
T PLN00113        430 VYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPD-------------SFGSKRLENLDLSRNQFSGAVPRKLG  496 (968)
T ss_pred             CCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCc-------------ccccccceEEECcCCccCCccChhhh
Confidence            55555555544444444444455555555555555444443             22446788888888888888888888


Q ss_pred             CCCCCcEEecCCCCCCchhHHhhhcCCCCcEEEecCcccCcccccCccCCCCCceEecCCCccCCHHHHHHHH--hhCCc
Q 007693          433 TFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFC--KMHPR  510 (593)
Q Consensus       433 ~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~--~~~~~  510 (593)
                      .+++|+.|++++|.+++..|..+..+++|++|++++|.+++..+..+..+++|+.|++++|++ .+..+..+.  ..+..
T Consensus       497 ~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l-~~~~p~~l~~l~~L~~  575 (968)
T PLN00113        497 SLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQL-SGEIPKNLGNVESLVQ  575 (968)
T ss_pred             hhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcc-cccCChhHhcCcccCE
Confidence            889999999999999888888888999999999999999998888888889999999999988 333333332  22333


Q ss_pred             EEEEeeeccccCCCCCCCCCCCCC
Q 007693          511 IEVWHELSVICPSDQIGSNGPSPS  534 (593)
Q Consensus       511 l~~~~~~~~~~~~~~~~~~~~~p~  534 (593)
                      +++.          .|.+.|.+|.
T Consensus       576 l~ls----------~N~l~~~~p~  589 (968)
T PLN00113        576 VNIS----------HNHLHGSLPS  589 (968)
T ss_pred             Eecc----------CCcceeeCCC
Confidence            4443          6677777775

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-06
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-06
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-06
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 1e-06
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-06
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-06
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 2e-04
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 3e-04
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 154/317 (48%), Gaps = 54/317 (17%)
Query: 155 DGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSN-RGAAVLKMFPR 213
           DG+  L+   NL+ ++     +TD+    L+ LTKL  + +  +Q+++    A L     
Sbjct: 57  DGVEYLN---NLTQINFSNNQLTDIT--PLKNLTKLVDILMNNNQIADITPLANLTNLTG 111
Query: 214 LSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAF 273
           L+  N   T +  L N+++L  L LS+ TI  I             +L+G T + +    
Sbjct: 112 LTLFNNQITDIDPLKNLTNLNRLELSSNTISDI------------SALSGLTSLQQ---- 155
Query: 274 LYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNL 333
                  LSF   S++ ++    L  +  LE LD+SS+ + D SV  +A +  NL +L  
Sbjct: 156 -------LSF---SSNQVTDLKPLANLTTLERLDISSNKVSDISV--LAKL-TNLESLIA 202
Query: 334 SNTRFSS-AGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQ 392
           +N + S    +GIL     NL+ LSL+G Q+ D  I  ++ + +L  +D++N  I     
Sbjct: 203 TNNQISDITPLGILT----NLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISNLAP 256
Query: 393 QVGAE--TDLVL------SLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRN 444
             G    T+L L      +++ L  L  L  L L + Q+ D  + P+S  K L +L+L  
Sbjct: 257 LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLED--ISPISNLKNLTYLTLYF 314
Query: 445 ASLTDVSLHQLSSLSKL 461
            +++D+S   +SSL+KL
Sbjct: 315 NNISDIS--PVSSLTKL 329
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-32
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-30
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-22
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-18
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-23
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-26
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-23
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-20
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-20
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-20
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 7e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-17
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-15
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-12
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-15
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 5e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 3e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 7e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-04
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
 Score =  130 bits (329), Expect = 2e-32
 Identities = 99/521 (19%), Positives = 196/521 (37%), Gaps = 44/521 (8%)

Query: 18  CQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENS 77
           C+S   +++W R++  +    A    +++R     ++    L          +   G   
Sbjct: 34  CKSWYEIERWCRRKVFIGNCYAVSPATVIRRF--PKVRSVELKGKPHFADFNLVPDGWGG 91

Query: 78  VDAEWMAYLGA-FRYLRSLNVADCRRVTSSALWAL-TGMTCLKELDLSRCVKVTDAGMKH 135
               W+  + + + +L  + +     VT   L  +       K L LS C   +  G+  
Sbjct: 92  YVYPWIEAMSSSYTWLEEIRLKRMV-VTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAA 150

Query: 136 LLSI-STLEKLWLSETGLTADGIALLSSL----QNLSVLDLGGLP--VTDLVLRSL-QVL 187
           + +    L++L L E+ +       LS       +L  L++  L   V+   L  L    
Sbjct: 151 IAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRC 210

Query: 188 TKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSIL 247
             L+ L L  +    + A +L+  P+L  L          P++ S   + LS C     L
Sbjct: 211 PNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCL 270

Query: 248 EGNENKAPLAKISLAGTTFINEREAFLYIETSL-LSFLDVSNSSLSRFCFLTQMKALEHL 306
            G  +         A    +    + L   T+L LS+  V +  L +   L Q   L+ L
Sbjct: 271 SGFWD------AVPAYLPAVYSVCSRL---TTLNLSYATVQSYDLVK--LLCQCPKLQRL 319

Query: 307 DLSSSMIGDDSVEMVACVGANLRNLNLS---------NTRFSSAGVGILAGHLPNLEILS 357
            +    I D  +E++A    +LR L +          N   +  G+  ++   P LE + 
Sbjct: 320 WVLDY-IEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVL 378

Query: 358 LSGTQIDDYAISYMSM-MPSLKFIDISNTDIKGFIQQVGAETDLVLSLTAL-QNLNHLER 415
               Q+ + A+  ++   P++    +   + K          D  +   A+ ++   L R
Sbjct: 379 YFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLD--IGFGAIVEHCKDLRR 436

Query: 416 LNLEQTQVSDATLFPLSTF-KELIHLSLRNASLTDVSLHQL-SSLSKLTNLSIRDAVLTN 473
           L+L    ++D     + T+ K++  LS+  A  +D+ +H + S    L  L IRD    +
Sbjct: 437 LSLSG-LLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGD 495

Query: 474 SGLGS-FKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEV 513
             L +      +++ L +     ++  A     +  P++ V
Sbjct: 496 KALLANASKLETMRSLWMSSCS-VSFGACKLLGQKMPKLNV 535
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query593
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.59
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.58
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.49
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.34
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.3
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.26
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.07
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.01
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.96
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.93
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.87
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.25
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.21
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.2
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.79
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.45
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
Probab=100.00  E-value=3e-50  Score=436.34  Aligned_cols=470  Identities=19%  Similarity=0.172  Sum_probs=319.4

Q ss_pred             HHhHhhhhcccccCchHHHHHHHHHHHHhccc----ChhhHhhhcCCccEEEecCCCCCChhHHHHHhcCCCccEEEcCC
Q 007693           24 VQKWRRQRRSLERLPAHLADSLLRHLIRRRLI----FPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVAD   99 (593)
Q Consensus        24 ~~~~~~~~~~l~~lp~~l~~~~l~~l~~~~~~----~p~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L~L~~   99 (593)
                      ...++|++.++..+|..++.. ++.|...+..    .|..+.. .++|++|+|++|. +....+..|+++++|++|+|++
T Consensus        14 ~~~~~c~~~~l~~iP~~l~~~-l~~L~Ls~n~i~~~~~~~~~~-l~~L~~L~Ls~n~-i~~~~~~~~~~l~~L~~L~Ls~   90 (606)
T 3t6q_A           14 NKTYNCENLGLNEIPGTLPNS-TECLEFSFNVLPTIQNTTFSR-LINLTFLDLTRCQ-IYWIHEDTFQSQHRLDTLVLTA   90 (606)
T ss_dssp             TTEEECTTSCCSSCCTTSCTT-CCEEECTTCCCSEECTTTSTT-CTTCSEEECTTCC-CCEECTTTTTTCTTCCEEECTT
T ss_pred             CceEECCCCCcccCcCCCCCc-CcEEEccCCccCcCChhHhcc-CccceEEECCCCc-cceeChhhccCccccCeeeCCC
Confidence            356788999999999877763 2222111111    1223332 3667777777776 5555566677777777777777


Q ss_pred             CCccCchHHHhhhCCCCCcEEecCCCCCCChhhHHhhcCCCCCcEEEccCCCCChhHHHHhcCCCCCCEEEcCCCCCChh
Q 007693          100 CRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDL  179 (593)
Q Consensus       100 ~~~i~~~~~~~l~~l~~L~~L~L~~~~~l~~~~~~~l~~~~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~  179 (593)
                      |. +....+.+++++++|++|++++| .++...+..++++++|++|++++|.+++.....+..+++|++|++++|.+.+.
T Consensus        91 n~-l~~~~~~~~~~l~~L~~L~L~~n-~i~~l~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~  168 (606)
T 3t6q_A           91 NP-LIFMAETALSGPKALKHLFFIQT-GISSIDFIPLHNQKTLESLYLGSNHISSIKLPKGFPTEKLKVLDFQNNAIHYL  168 (606)
T ss_dssp             CC-CSEECTTTTSSCTTCCEEECTTS-CCSCGGGSCCTTCTTCCEEECCSSCCCCCCCCTTCCCTTCCEEECCSSCCCEE
T ss_pred             Cc-ccccChhhhcccccccEeecccc-CcccCCcchhccCCcccEEECCCCcccccCcccccCCcccCEEEcccCccccc
Confidence            76 66655666777777777777777 56665566677777788888888777765434455577888888888888777


Q ss_pred             hHHHhhcCCCCC--EEEccCCccCccchHhhcCC----------------------------------------------
Q 007693          180 VLRSLQVLTKLE--YLDLWGSQVSNRGAAVLKMF----------------------------------------------  211 (593)
Q Consensus       180 ~~~~l~~l~~L~--~L~L~~n~l~~~~~~~l~~l----------------------------------------------  211 (593)
                      .+..++.+++|+  .|++++|.+.+..+..+...                                              
T Consensus       169 ~~~~~~~l~~L~~l~L~l~~n~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~l~~l~~~~~~~~~~~~i~~~~~  248 (606)
T 3t6q_A          169 SKEDMSSLQQATNLSLNLNGNDIAGIEPGAFDSAVFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVF  248 (606)
T ss_dssp             CHHHHHTTTTCCSEEEECTTCCCCEECTTTTTTCEEEEEECTTCSCHHHHHHHTTTCEEEEEECCCCTTSCCCCCCGGGG
T ss_pred             ChhhhhhhcccceeEEecCCCccCccChhHhhhccccccccCCchhHHHHhhhccccchhheechhhccccccccChhHh
Confidence            777777777777  67777776665444332210                                              


Q ss_pred             -----CCCCeeeccccCCcCC-----CCCCCCcEEEcCCCcccchhcccCCCCCcceEeccCccccchhhH---------
Q 007693          212 -----PRLSFLNLAWTGVTKL-----PNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREA---------  272 (593)
Q Consensus       212 -----~~L~~L~l~~n~l~~l-----~~l~~L~~L~l~~n~l~~l~~~~~~~~~L~~L~l~~n~~~~~~~~---------  272 (593)
                           .+|+.|++++|.++.+     ..+++|++|++++|.++.+|..+..+++|++|++++|.+...++.         
T Consensus       249 ~~l~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~lp~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~  328 (606)
T 3t6q_A          249 EGLCEMSVESINLQKHYFFNISSNTFHCFSGLQELDLTATHLSELPSGLVGLSTLKKLVLSANKFENLCQISASNFPSLT  328 (606)
T ss_dssp             GGGGGSEEEEEECTTCCCSSCCTTTTTTCTTCSEEECTTSCCSCCCSSCCSCTTCCEEECTTCCCSBGGGGCGGGCTTCS
T ss_pred             chhhcCceeEEEeecCccCccCHHHhccccCCCEEeccCCccCCCChhhcccccCCEEECccCCcCcCchhhhhccCcCC
Confidence                 0334444444444432     245566666666666666666666666666666666666554331         


Q ss_pred             ---------------HhhhcCCCccEEeccCCCcchh----hhcccCCCccEEEccCCCCChhHHHHHHhccCCCcEEEc
Q 007693          273 ---------------FLYIETSLLSFLDVSNSSLSRF----CFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNL  333 (593)
Q Consensus       273 ---------------~~~~~~~~L~~L~ls~n~l~~~----~~l~~~~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~l  333 (593)
                                     ..+..+++|++|++++|.+.+.    ..+..+++|++|++++|.+++..+..+..+ ++|++|++
T Consensus       329 ~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l-~~L~~L~l  407 (606)
T 3t6q_A          329 HLSIKGNTKRLELGTGCLENLENLRELDLSHDDIETSDCCNLQLRNLSHLQSLNLSYNEPLSLKTEAFKEC-PQLELLDL  407 (606)
T ss_dssp             EEECCSCSSCCBCCSSTTTTCTTCCEEECCSSCCCEEEESTTTTTTCTTCCEEECCSCSCEEECTTTTTTC-TTCSEEEC
T ss_pred             EEECCCCCcccccchhhhhccCcCCEEECCCCccccccCcchhcccCCCCCEEECCCCcCCcCCHHHhcCC-ccCCeEEC
Confidence                           1123444555555555554443    134555666666666666555444444444 66777777


Q ss_pred             CCCCCCCchHHHHHcCCCCCcEEEccCCCCChHHHHHhhcCCCCCEEEeeCCccCccccccccchhhhhhHHhhccCCcc
Q 007693          334 SNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHL  413 (593)
Q Consensus       334 ~~n~l~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~l~~~~~L~~L~Ls~n~i~~~~~~~~~~~~~~~~~~~~~~l~~L  413 (593)
                      ++|.+++..+...++.+++|++|++++|.+++..+..+..+++|++|++++|.+.+....         ....+..+++|
T Consensus       408 ~~n~l~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~---------~~~~~~~l~~L  478 (606)
T 3t6q_A          408 AFTRLKVKDAQSPFQNLHLLKVLNLSHSLLDISSEQLFDGLPALQHLNLQGNHFPKGNIQ---------KTNSLQTLGRL  478 (606)
T ss_dssp             TTCCEECCTTCCTTTTCTTCCEEECTTCCCBTTCTTTTTTCTTCCEEECTTCBCGGGEEC---------SSCGGGGCTTC
T ss_pred             CCCcCCCcccchhhhCcccCCEEECCCCccCCcCHHHHhCCCCCCEEECCCCCCCccccc---------cchhhccCCCc
Confidence            776666554433335567777777777777766666677777777777777777652211         11258889999


Q ss_pred             CEEecCCCCcCCCccccccCCCCCcEEecCCCCCCchhHHhhhcCCCCcEEEecCcccCcccccCccCCCCCceEecCCC
Q 007693          414 ERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGG  493 (593)
Q Consensus       414 ~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~l~~n  493 (593)
                      ++|++++|.+++..+..|..+++|++|++++|++++..|..+.++++| .|++++|++++..+..+..+++|+.|++++|
T Consensus       479 ~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L-~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~N  557 (606)
T 3t6q_A          479 EILVLSFCDLSSIDQHAFTSLKMMNHVDLSHNRLTSSSIEALSHLKGI-YLNLASNHISIILPSLLPILSQQRTINLRQN  557 (606)
T ss_dssp             CEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCGGGGGGGTTCCSC-EEECCSSCCCCCCGGGHHHHHTSSEEECTTC
T ss_pred             cEEECCCCccCccChhhhccccCCCEEECCCCccCcCChhHhCccccc-EEECcCCcccccCHhhcccCCCCCEEeCCCC
Confidence            999999999999888899999999999999999999999999999999 9999999999998888888999999999999


Q ss_pred             ccCCHHHHHHHHhhCC
Q 007693          494 WLLTEDAILQFCKMHP  509 (593)
Q Consensus       494 ~~~~~~~~~~~~~~~~  509 (593)
                      ++.|+|...++..|+.
T Consensus       558 ~~~c~c~~~~~~~w~~  573 (606)
T 3t6q_A          558 PLDCTCSNIYFLEWYK  573 (606)
T ss_dssp             CEECSGGGHHHHHHHH
T ss_pred             CccccCCcHHHHHHHH
Confidence            9999998877766653
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 593
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 59.2 bits (142), Expect = 5e-10
 Identities = 64/374 (17%), Positives = 131/374 (35%), Gaps = 42/374 (11%)

Query: 144 KLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNR 203
           K  L +T +T       + L  ++ L    L +  +    ++ L  L  ++   +Q++  
Sbjct: 26  KTVLGKTNVT--DTVSQTDLDQVTTLQADRLGIKSI--DGVEYLNNLTQINFSNNQLT-- 79

Query: 204 GAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAP-------- 255
               LK   +L  + +    +  +  +++L  L       + I + +  K          
Sbjct: 80  DITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLEL 139

Query: 256 ----LAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSS 311
               ++ IS        ++ +F    T L    +++                    L++ 
Sbjct: 140 SSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNL 199

Query: 312 MIGDDSVEMVA-----CVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDY 366
                +   ++      +  NL  L+L+  +    G       L NL  L L+  QI + 
Sbjct: 200 ESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGT---LASLTNLTDLDLANNQISN- 255

Query: 367 AISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSL--------TALQNLNHLERLNL 418
            ++ +S +  L  + +    I       G      L L        + + NL +L  L L
Sbjct: 256 -LAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTL 314

Query: 419 EQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGS 478
               +SD  + P+S+  +L  L   N  ++DVS   L++L+ +  LS     +  S L  
Sbjct: 315 YFNNISD--ISPVSSLTKLQRLFFANNKVSDVS--SLANLTNINWLSAGHNQI--SDLTP 368

Query: 479 FKPPRSLKLLDLHG 492
                 +  L L+ 
Sbjct: 369 LANLTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query593
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.49
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.48
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.1
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.96  E-value=1.1e-27  Score=241.67  Aligned_cols=342  Identities=22%  Similarity=0.299  Sum_probs=212.7

Q ss_pred             cCCCccEEEcCCCCccCchHHHhhhCCCCCcEEecCCCCCCChhhHHhhcCCCCCcEEEccCCCCChhHHHHhcCCCCCC
Q 007693           88 AFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLS  167 (593)
Q Consensus        88 ~~~~L~~L~L~~~~~i~~~~~~~l~~l~~L~~L~L~~~~~l~~~~~~~l~~~~~L~~L~L~~~~~~~~~~~~l~~l~~L~  167 (593)
                      .+.+|++|++++|+ |++  +..+..+++|++|++++| .+++.  ..++++++|++|++++|.+.+..  .++.+++|+
T Consensus        42 ~l~~l~~L~l~~~~-I~~--l~gl~~L~nL~~L~Ls~N-~l~~l--~~l~~L~~L~~L~L~~n~i~~i~--~l~~l~~L~  113 (384)
T d2omza2          42 DLDQVTTLQADRLG-IKS--IDGVEYLNNLTQINFSNN-QLTDI--TPLKNLTKLVDILMNNNQIADIT--PLANLTNLT  113 (384)
T ss_dssp             HHTTCCEEECCSSC-CCC--CTTGGGCTTCCEEECCSS-CCCCC--GGGTTCTTCCEEECCSSCCCCCG--GGTTCTTCC
T ss_pred             HhCCCCEEECCCCC-CCC--ccccccCCCCCEEeCcCC-cCCCC--ccccCCccccccccccccccccc--ccccccccc
Confidence            34567777777766 554  234667777777777777 45553  23667777777777777776543  266777777


Q ss_pred             EEEcCCCCCChhhHHHhhcCCCCCEEEccCCccCccchHhhcCCCCCCeeeccccCCcCCCCCCCCcEEEcCCCcccchh
Q 007693          168 VLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSIL  247 (593)
Q Consensus       168 ~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~l~~l~~L~~L~l~~n~l~~l~  247 (593)
                      .|+++++.+.+...  ......+.......+.+.......................+..+...+.......         
T Consensus       114 ~L~~~~~~~~~~~~--~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------  182 (384)
T d2omza2         114 GLTLFNNQITDIDP--LKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDI---------  182 (384)
T ss_dssp             EEECCSSCCCCCGG--GTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEEC---------
T ss_pred             cccccccccccccc--ccccccccccccccccccccccccccccccccccccccchhhhhccccccccccc---------
Confidence            77777776665432  2344555566555555543332222222211111122222222222222222222         


Q ss_pred             cccCCCCCcceEeccCccccchhhHHhhhcCCCccEEeccCCCcchhhhcccCCCccEEEccCCCCChhHHHHHHhccCC
Q 007693          248 EGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGAN  327 (593)
Q Consensus       248 ~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~~l~~~~~L~~L~L~~n~l~~~~~~~~~~~~~~  327 (593)
                                    ..+......   ....+++++.+++++|.++++.....+++|++|++++|.+++..  .+... ++
T Consensus       183 --------------~~~~~~~~~---~~~~l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l~~~~--~l~~l-~~  242 (384)
T d2omza2         183 --------------SSNKVSDIS---VLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIG--TLASL-TN  242 (384)
T ss_dssp             --------------CSSCCCCCG---GGGGCTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCG--GGGGC-TT
T ss_pred             --------------ccccccccc---ccccccccceeeccCCccCCCCcccccCCCCEEECCCCCCCCcc--hhhcc-cc
Confidence                          222222211   12245666666666666666655566677777777777766532  23333 67


Q ss_pred             CcEEEcCCCCCCCchHHHHHcCCCCCcEEEccCCCCChHHHHHhhcCCCCCEEEeeCCccCccccccccchhhhhhHHhh
Q 007693          328 LRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTAL  407 (593)
Q Consensus       328 L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~l~~~~~L~~L~Ls~n~i~~~~~~~~~~~~~~~~~~~~  407 (593)
                      |+.+++++|.+++..+   ++.+++|++|++++|.+++..  .+..++.++.++++.|.+.+..              .+
T Consensus       243 L~~L~l~~n~l~~~~~---~~~~~~L~~L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~~--------------~~  303 (384)
T d2omza2         243 LTDLDLANNQISNLAP---LSGLTKLTELKLGANQISNIS--PLAGLTALTNLELNENQLEDIS--------------PI  303 (384)
T ss_dssp             CSEEECCSSCCCCCGG---GTTCTTCSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCSCCG--------------GG
T ss_pred             cchhccccCccCCCCc---ccccccCCEeeccCcccCCCC--cccccccccccccccccccccc--------------cc
Confidence            7777777777776554   245778888888888777643  3567788888888888876532              36


Q ss_pred             ccCCccCEEecCCCCcCCCccccccCCCCCcEEecCCCCCCchhHHhhhcCCCCcEEEecCcccCcccccCccCCCCCce
Q 007693          408 QNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKL  487 (593)
Q Consensus       408 ~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~  487 (593)
                      ..+++++.|++++|++++..  .+..+++|++|++++|+++++.  .+.++++|++|++++|+|++..+  +.++++|+.
T Consensus       304 ~~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n~l~~l~--~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~  377 (384)
T d2omza2         304 SNLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFANNKVSDVS--SLANLTNINWLSAGHNQISDLTP--LANLTRITQ  377 (384)
T ss_dssp             GGCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCSSCCCCCG--GGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSE
T ss_pred             chhcccCeEECCCCCCCCCc--ccccCCCCCEEECCCCCCCCCh--hHcCCCCCCEEECCCCcCCCChh--hccCCCCCE
Confidence            77788888888888888743  3677888888888888888743  57888888888888888887654  677888888


Q ss_pred             EecCCC
Q 007693          488 LDLHGG  493 (593)
Q Consensus       488 L~l~~n  493 (593)
                      |+|++|
T Consensus       378 L~L~~N  383 (384)
T d2omza2         378 LGLNDQ  383 (384)
T ss_dssp             EECCCE
T ss_pred             eeCCCC
Confidence            888877
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure