Citrus Sinensis ID: 007704

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590--
MAVSNSHVSSRNLQKSYLGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFLFNYTDRKLHGIFEAASPGMMNINPYGWTDGSERTSYPAQVQIRVRMQCQPLNEEKFKPIIAANYYTPHHFWFELDHSQASKLIALLSSMAIAPRACVPQNRENQRTIFLPLLKRNRMEEDNSLDGDDRPLESHLDMKDVDQDEKSLILMALKELAINHEHQDFSSTDYENELATGGDRHCSFIGEQMSSEEKIETCSSSRCQSIINELIKEVAELKAFKTEQTLKMKELEQKLVDAEAEIQRLKEHCLMVQSPNNDTKECMYEKLLESSDELHLDPSESIYLPMSSARSYASAAMLNGELYIFGGGDGNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGATIDNKIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVERFKEGQGWEEINSRAIGKRCFMSVVTV
cccccccccccccccccccEEEEEEccccHHHHHHHHHccccccccccEEcccccccEEEEEcccccEEEEEEEccccccccccccccccccccccccEEEEEEEcccccccccccccHHHccccccccEEEEccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHccccccccccHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEccEEEEEEEccccccccEEEEEEcccccEEcccccccccccEEEEEEccEEEEEccccccccccEEEEEEcccccEEEccccccccccEEEEEEccEEEEEccccccccccEEEEEEcccccEEEcccccccccccEEEEEccEEEEEccccccccccEEEEEEcccccEEEcccccccccccEEEEEccEEEEEcccccccccccEEEEEcccccEEEccccccccccEEEEEEc
ccccccHHHHHcccHHcccEEEEEcccccHHHHHHHHHcccccccEEEEEEccccccEEEEEcccccccEEEEEcccccccccccccccccccccccHHHHHHHHHHccHHHHHHHcHHHHHHccccEEEEEEcccHcHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHccHHcccccccccccccHHHHHHHHHHHHHcccccccccccccccccccEEEEEccEEEEEEcccccccccEEEEEccccccEEEccccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEccccccccEcEEEEEcccccEEEEcccccccccEEEEEEc
mavsnshvssrnlqksylggvifgCKKSTIKECLAKQlfglpaqhflyvrkvdpglplflfnytdrklhgifeaaspgmmninpygwtdgsertsypaQVQIRVRMqcqplneekfkpiiaanyytphhfwfeLDHSQASKLIALLSSmaiapracvpqnrenqrtiflpllkrnrmeednsldgddrpleshldmkdvdqDEKSLILMALKELAInhehqdfsstdyenelatggdrhcsfigeqmsseekietCSSSRCQSIINELIKEVAELKAFKTEQTLKMKELEQKLVDAEAEIQRLKEHCLmvqspnndtkecMYEKLlessdelhldpsesiylpmssaRSYASAAMLNGELYifgggdgnswhntvesyspandewtsrpslngtkgslagatidnkifaigggnglecfsdvemldldIGKWIRTRSMLQKRFALAAAELNGVLYatggydgneymnsaerfdprehYWTKIAnmnrrrgcHSLAVLNGKlyalggfdgsamvpsievydprlgswmsgepmklsrgylgaAVVKEAIYVIGGVKNGSEIVDTVErfkegqgweeinsraigkrcfmsvvtv
mavsnshvssrnlqksylGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFLFNYTDRKLHGIFEAASPGMMNINPYGWTDGSERTSYPAQVQIRVRMQCQPLNEEKFKPIIAANYYTPHHFWFELDHSQASKLIALLSSMAIAPracvpqnrenqrtiflpllkrnrmeednsldgddrpleshldmkdvDQDEKSLILMALKELAINHEHQDFSSTDYENELATGGDRHCSFIGEQMSSEEKIETCSSSRCQSIINELIKEVAELKAFKTEQTLKMKELEQKLVDAEAEIQRLKEhclmvqspnndTKECMYEKLLESSDELHLDPSESIYLPMSSARSYASAAMLNGELYIFGGGDGNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGATIDNKIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIggvkngseIVDTVerfkegqgweeinsraigkrcfmsvvtv
MAVSNSHVSSRNLQKSYLGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFLFNYTDRKLHGIFEAASPGMMNINPYGWTDGSERTSYPAQVQIRVRMQCQPLNEEKFKPIIAANYYTPHHFWFELDHSQASKLIALLSSMAIAPRACVPQNRENQRTIFLPLLKRNRMEEDNSLDGDDRPLESHLDMKDVDQDEKSLILMALKELAINHEHQDFSSTDYENELATGGDRHCSFIGEQMSSEEKIETCSSSRCQSIINELIKEVAELKAFKTEQTLKMKELEQKLVDAEAEIQRLKEHCLMVQSPNNDTKECMYEKLLESSDELHLDPSESIYLPMssarsyasaaMLNGELYIFGGGDGNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGATIDNKIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVERFKEGQGWEEINSRAIGKRCFMSVVTV
**************KSYLGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFLFNYTDRKLHGIFEAASPGMMNINPYGWTDGSERTSYPAQVQIRVRMQCQPLNEEKFKPIIAANYYTPHHFWFELDHSQASKLIALLSSMAIAPRACVPQNRENQRTIFLPLL*********************************LILMALKELAINH*********************CSF*****************RCQSIINELIKEVAELKAFKTEQTL********LVDAEAEIQRLKEHCLMV**************************************SYASAAMLNGELYIFGGGDGNSWHNTVE********************SLAGATIDNKIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVERFKEGQGWEEINSRAIGKRCFMSV***
*************QKSYLGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFLFNYTDRKLHGIFEAASPGMMNINPYGWTDGSERTSYPAQVQIRVRMQCQPLNEEKFKPIIAANYYTPHHFWFELDHSQASKLIALLSSMAI**********ENQRTIFLPLLKRNRMEEDNSLDGDDRPLESHLDMKDVDQDEKSLILMALKELAINHEHQDFSSTDYENELATGGDRHCSFIGEQMSSEEKIETCSSSRCQSIINELIKEVAELKAFKTEQTLKMKELEQKLVDAEAEIQRLKEHCLMVQSPNNDTKECMYEKLLESSDELHLDPSESIYLPMSSARSYASAAMLNGELYIFGGGDGNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGATIDNKIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVERFKEGQGWEEINSRAIGKRCFMSVVTV
***********NLQKSYLGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFLFNYTDRKLHGIFEAASPGMMNINPYGWTDGSERTSYPAQVQIRVRMQCQPLNEEKFKPIIAANYYTPHHFWFELDHSQASKLIALLSSMAIAPRACVPQNRENQRTIFLPLLKRNRMEEDNSLDGDDRPLESHLDMKDVDQDEKSLILMALKELAINHEHQDFSSTDYENELATGGDRHCSFIGEQ*************RCQSIINELIKEVAELKAFKTEQTLKMKELEQKLVDAEAEIQRLKEHCLMVQSPNNDTKECMYEKLLESSDELHLDPSESIYLPMSSARSYASAAMLNGELYIFGGGDGNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGATIDNKIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVERFKEGQGWEEINSRAIGKRCFMSVVTV
*****SHVSSRNLQKSYLGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFLFNYTDRKLHGIFEAASPGMMNINPYGWTDGSERTSYPAQVQIRVRMQCQPLNEEKFKPIIAANYYTPHHFWFELDHSQASKLIALLSSMAIAPRACVPQNRENQRTIFLPLLKRNRMEEDNSLDGDDRPLESHLDMKDVDQDEKSLILMALKELAINHEHQDFSSTDYENELATGGDRHCSFIGEQMSSEEKIETCSSSRCQSIINELIKEVAELKAFKTEQTLKMKELEQKLVDAEAEIQRLKEHCLMVQSPNNDTKECMYEKLLESSDELHLDPSESIYLPMSSARSYASAAMLNGELYIFGGGDGNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGATIDNKIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVERFKEGQGWEEINSRAIGKRCFMSVVTV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVSNSHVSSRNLQKSYLGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFLFNYTDRKLHGIFEAASPGMMNINPYGWTDGSERTSYPAQVQIRVRMQCQPLNEEKFKPIIAANYYTPHHFWFELDHSQASKLIALLSSMAIAPRACVPQNRENQRTIFLPLLKRNRMEEDNSLDGDDRPLESHLDMKDVDQDEKSLILMALKELAINHEHQDFSSTDYENELATGGDRHCSFIGEQMSSEEKIETCSSSRCQSIINELIKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCLMVQSPNNDTKECMYEKLLESSDELHLDPSESIYLPMSSARSYASAAMLNGELYIFGGGDGNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGATIDNKIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVERFKEGQGWEEINSRAIGKRCFMSVVTV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query592 2.2.26 [Sep-21-2011]
Q8K430640 Kelch-like protein 17 OS= yes no 0.429 0.396 0.347 3e-37
Q6TDP3640 Kelch-like protein 17 OS= yes no 0.429 0.396 0.347 3e-37
Q9JI74751 Kelch-like protein 1 OS=M no no 0.412 0.324 0.354 3e-37
Q7QGL0582 Kelch-like protein diablo yes no 0.378 0.384 0.358 6e-37
Q9NR64748 Kelch-like protein 1 OS=H yes no 0.412 0.326 0.354 6e-37
Q16RL8589 Kelch-like protein diablo N/A no 0.378 0.380 0.358 7e-37
B0WWP2582 Kelch-like protein diablo N/A no 0.378 0.384 0.358 7e-37
Q2M0J9628 Kelch-like protein diablo no no 0.378 0.356 0.358 7e-37
B4GRJ2628 Kelch-like protein diablo N/A no 0.378 0.356 0.358 8e-37
B3M9V8633 Kelch-like protein diablo N/A no 0.378 0.353 0.358 2e-36
>sp|Q8K430|KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus GN=Klhl17 PE=1 SV=1 Back     alignment and function desciption
 Score =  157 bits (396), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 91/262 (34%), Positives = 136/262 (51%), Gaps = 8/262 (3%)

Query: 316 DTKECMYEKLLESSDELHLDPSESIYLPMSSARSYASAAMLNGELYIFGGGDGNSWHNTV 375
           D K+ + E L     + HL P +   L  S  R           L+  GGG   + H   
Sbjct: 304 DCKDLLIEAL-----KFHLLPEQRGVLGTSRTRPRRCEGA-GPVLFAVGGGSLFAIHGDC 357

Query: 376 ESYSPANDEWTSRPSLNGTKGSLAGATIDNKIFAIGGGNGLECFSDVEMLDLDIGKWIRT 435
           E+Y    D W    S++  +  +  A + N+++A+GG +G    + VE  D     W   
Sbjct: 358 EAYDTRTDRWHVVASMSTRRARVGVAAVGNRLYAVGGYDGTSDLATVESYDPVTNTWQPE 417

Query: 436 RSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIANMNRRRGCHSLA 495
            SM  +R  L  A L+G+LYA GGYDG   +NSAER+DP    WT IA M+ RR    +A
Sbjct: 418 VSMGTRRSCLGVAALHGLLYAAGGYDGASCLNSAERYDPLTGTWTSIAAMSTRRRYVRVA 477

Query: 496 VLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVK 555
            L+G LYA+GG+D S+ + ++E Y+P++ SW     M   R   G AV++ A+YV GG  
Sbjct: 478 TLDGNLYAVGGYDSSSHLATVEKYEPQVNSWTPVASMLSRRSSAGVAVLEGALYVAGG-N 536

Query: 556 NGSEIVDTVERFKEGQG-WEEI 576
           +G+  +++VER+    G WE +
Sbjct: 537 DGTSCLNSVERYSTKAGAWESV 558
Substrate-recognition component of some cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex. The BCR(KLHL17) mediates the ubiquitination and subsequenct degradation of GLUR6. May play a role in the actin-based neuronal function.
Rattus norvegicus (taxid: 10116)
>sp|Q6TDP3|KLH17_MOUSE Kelch-like protein 17 OS=Mus musculus GN=Klhl17 PE=2 SV=1 Back     alignment and function description
>sp|Q9JI74|KLHL1_MOUSE Kelch-like protein 1 OS=Mus musculus GN=Klhl1 PE=1 SV=2 Back     alignment and function description
>sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 Back     alignment and function description
>sp|Q9NR64|KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens GN=KLHL1 PE=2 SV=1 Back     alignment and function description
>sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|B0WWP2|KLHDB_CULQU Kelch-like protein diablo OS=Culex quinquefasciatus GN=dbo PE=3 SV=2 Back     alignment and function description
>sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 Back     alignment and function description
>sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|B3M9V8|KLHDB_DROAN Kelch-like protein diablo OS=Drosophila ananassae GN=dbo PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query592
297735605645 unnamed protein product [Vitis vinifera] 0.986 0.905 0.590 0.0
225439558664 PREDICTED: uncharacterized protein LOC10 0.993 0.885 0.566 0.0
224140525657 predicted protein [Populus trichocarpa] 0.996 0.898 0.554 0.0
255571483665 conserved hypothetical protein [Ricinus 0.972 0.866 0.519 0.0
356566722 714 PREDICTED: uncharacterized protein LOC10 0.937 0.777 0.525 0.0
240256249656 uncharacterized protein [Arabidopsis tha 0.988 0.891 0.490 1e-168
297806043621 predicted protein [Arabidopsis lyrata su 0.925 0.882 0.490 1e-157
7327825621 putative protein [Arabidopsis thaliana] 0.925 0.882 0.480 1e-153
357127417688 PREDICTED: uncharacterized protein LOC10 0.979 0.843 0.379 1e-120
413947460 696 hypothetical protein ZEAMMB73_766737 [Ze 0.979 0.833 0.379 1e-116
>gi|297735605|emb|CBI18099.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/623 (59%), Positives = 458/623 (73%), Gaps = 39/623 (6%)

Query: 2   AVSNSHVSSRNLQKSYLGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFLF 61
           ++SNS +S+RNL+K +LGGVIFGCK STIKECL KQLFGLPAQHFLYV+ VDPGLPLFLF
Sbjct: 28  SLSNSSISARNLRKGHLGGVIFGCKNSTIKECLFKQLFGLPAQHFLYVKNVDPGLPLFLF 87

Query: 62  NYTDRKLHGIFEAASPGMMNINPYGWT-DGSERTSYPAQVQIRVRMQCQPLNEEKFKPII 120
           NY+DRKLHGIFEAASPG MNINPYGWT DG+ERT YPAQVQIRVR+QCQPL EE+F+PII
Sbjct: 88  NYSDRKLHGIFEAASPGQMNINPYGWTTDGAERTLYPAQVQIRVRLQCQPLPEEQFRPII 147

Query: 121 AANYYTPHHFWFELDHSQASKLIALLSSMAIAPRACVPQNRENQRTIFLPLLKRNRMEED 180
           A NYY+  HFWFELDH+QASKLI+LLSS A+AP A VPQN    RT+F PL   N+ EED
Sbjct: 148 ADNYYSQSHFWFELDHAQASKLISLLSSRAVAPSASVPQNSAAWRTLFRPLPLCNKKEED 207

Query: 181 NSLDGDDRPLESHLDMKDVDQDEKSLILMALKELAINHEHQDFSSTDYENELATGGDRHC 240
            S    + PLE+  D + V+ DEK LIL+ L+EL +N E++D SS+ Y  + A   D H 
Sbjct: 208 ES----NLPLEASSDKQVVENDEKGLILLKLQELVLNREYKDSSSSSYVEDSAVVNDSHL 263

Query: 241 S---FIGEQMSSEEKIE--TCSSSRCQSIINELIKEVAELKAFKTEQTLKMKELEQKLVD 295
                + EQM  E++ E    SSS    +I +LI+E  ELK FK E   +M  +EQ+L D
Sbjct: 264 DDKGLVKEQMVLEDRNEDSPVSSSDFHPVIAQLIRE--ELKGFKAEYIQRMSYMEQRLAD 321

Query: 296 AEAEIQRLKEHCLMVQSPNNDTKECMYEKLLESSDELHLDPSESIYL------------- 342
           AE EIQ+LKEHC+M++S  + +   + + + ES DE+++DP + I+L             
Sbjct: 322 AEKEIQQLKEHCMMLESICSPSMSLVDQTVNESFDEMNMDPDDLIFLVGGCDGESWLSTL 381

Query: 343 --------------PMSSARSYASAAMLNGELYIFGGGDGNSWHNTVESYSPANDEWTSR 388
                         PM+  RSYAS A+LNGELYIFGGG+G+ W++TVE+Y+  ++EWT R
Sbjct: 382 DSYSPSQDMKKSLSPMTMPRSYASVAVLNGELYIFGGGNGSEWYDTVEAYNLVSNEWTLR 441

Query: 389 PSLNGTKGSLAGATIDNKIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAA 448
             LN  KGSLAGAT++ KIFA+GGGNG+ECFSDV+M DLD+G+WI TRSMLQKRFAL AA
Sbjct: 442 APLNKEKGSLAGATLNGKIFALGGGNGIECFSDVDMFDLDVGRWIPTRSMLQKRFALGAA 501

Query: 449 ELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFD 508
           ELNGVLYA GGYDG +Y+NS ER DPREH WT+I  M  +RG H++ VLN KLYA+GGFD
Sbjct: 502 ELNGVLYAVGGYDGKDYLNSVERLDPREHSWTRIGGMKTKRGSHTVVVLNEKLYAMGGFD 561

Query: 509 GSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVERFK 568
           G+ MVPS+E+YDPR+ SWM G+ M  SRGY  AAVV ++IYVIGGV++G  +V TVE ++
Sbjct: 562 GNTMVPSVEIYDPRVDSWMDGDSMNQSRGYSAAAVVNKSIYVIGGVEDGENVVGTVELYE 621

Query: 569 EGQGWEEINSRAIGKRCFMSVVT 591
           EG+GW  I   AIGKRCF S + 
Sbjct: 622 EGEGWRVIKQTAIGKRCFASAIV 644

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225439558|ref|XP_002264808.1| PREDICTED: uncharacterized protein LOC100267149 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140525|ref|XP_002323633.1| predicted protein [Populus trichocarpa] gi|222868263|gb|EEF05394.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255571483|ref|XP_002526689.1| conserved hypothetical protein [Ricinus communis] gi|223533989|gb|EEF35711.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356566722|ref|XP_003551578.1| PREDICTED: uncharacterized protein LOC100811782 [Glycine max] Back     alignment and taxonomy information
>gi|240256249|ref|NP_195786.4| uncharacterized protein [Arabidopsis thaliana] gi|332002990|gb|AED90373.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297806043|ref|XP_002870905.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297316742|gb|EFH47164.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|7327825|emb|CAB82282.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357127417|ref|XP_003565377.1| PREDICTED: uncharacterized protein LOC100833476 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|413947460|gb|AFW80109.1| hypothetical protein ZEAMMB73_766737 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query592
TAIR|locus:2149835656 AT5G01660 "AT5G01660" [Arabido 0.951 0.858 0.350 3.1e-83
TAIR|locus:2085492607 AT3G11000 [Arabidopsis thalian 0.256 0.250 0.563 5.3e-49
ZFIN|ZDB-GENE-070209-226604 klhl8 "kelch-like 8 (Drosophil 0.371 0.364 0.355 9.6e-35
FB|FBgn0030114654 CG17754 [Drosophila melanogast 0.381 0.345 0.370 1.8e-33
MGI|MGI:2678948640 Klhl17 "kelch-like 17" [Mus mu 0.364 0.337 0.371 2.5e-33
RGD|708444640 Klhl17 "kelch-like family memb 0.364 0.337 0.371 2.5e-33
UNIPROTKB|F1N065583 KLHL1 "Uncharacterized protein 0.430 0.437 0.344 4e-33
UNIPROTKB|B4DUR0420 KLHL20 "Kelch-like protein 20" 0.383 0.540 0.356 4e-33
UNIPROTKB|Q9C0H6718 KLHL4 "Kelch-like protein 4" [ 0.425 0.350 0.343 5.4e-33
UNIPROTKB|F1RJ37583 KLHL1 "Uncharacterized protein 0.430 0.437 0.344 7.2e-33
TAIR|locus:2149835 AT5G01660 "AT5G01660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 834 (298.6 bits), Expect = 3.1e-83, P = 3.1e-83
 Identities = 210/599 (35%), Positives = 319/599 (53%)

Query:     1 MAVSNSHVSSRNLQKSYLGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFL 60
             MA      S RNL KS LGGV+FGC K+TIKEC++KQLFGLP+ H+ YV+K+D GLPLFL
Sbjct:     1 MAQRRGKFSFRNLTKSQLGGVVFGCTKNTIKECMSKQLFGLPSNHYPYVQKIDIGLPLFL 60

Query:    61 FNYTDRKLHGIFEAASPGMMNINPYGWT-DGSERTSYPAQVQIRVRMQCQPLNEEKFKPI 119
             FNY+DR LHGIFEAA  G +N +PYGWT DGSERTSYPAQV I VR+QC+PL+EEKFKP 
Sbjct:    61 FNYSDRTLHGIFEAAGCGQLNFDPYGWTSDGSERTSYPAQVPISVRLQCEPLSEEKFKPA 120

Query:   120 IAANYYTPHHFWFELDHSQASKLIALLSSMAIAPRACVPQNRENQRTIFLPLLKRNRMEE 179
             IA NYY+ HHFWFELDH Q  KL  LL+S A+ P+   P N  N R IF  +    + E 
Sbjct:   121 IADNYYSSHHFWFELDHFQTRKLTCLLTSFAVKPKP--PMNTPNTRQIFRLISSSEKKEN 178

Query:   180 DNSLD-GDDRPLES-HLDMKDVDQDEKSLILMALKELAINH-EHQDFSSTDYENELATGG 236
              + +   ++ P+ S  + +    + + S    +    + NH + Q+    D ++ L    
Sbjct:   179 SDEVKPSENEPVGSLEVSLSSGGESDSSAAA-SHPGFSENHPDVQNPKQIDKDHVLEKLK 237

Query:   237 DRHCSFI--GEQMSSEEKIETCSSSRCQSIINELIKEVAELKAFKTEQT-LKMKELEQKL 293
             D   S    G+  S  E +E  +   C+++ +    E       K + + L    L   +
Sbjct:   238 DLVFSHDEHGDN-SLTETVEQANIPTCKNLEDRDTLEEETCSEGKIDGSCLVSSPLPHTI 296

Query:   294 VDAEAEIQRLKEHCLMVQSPNNDTKEC-MYEKLLESSDELH-----LDPSESIYLPMXXX 347
                  E++ L+  C +     N TK C + EKL ++  E++      +  ESI  P+   
Sbjct:   297 SQLMHEVKELRA-CGL----ENSTKICYLEEKLDKAHKEIYQLTERCNMLESISGPLITK 351

Query:   348 XXXXXXXMLNGE---------LYIFGGGDGNS--WHNTVESYSPANDEWTSRPSLNGTKG 396
                    + + +         + + GG D +S  W ++V+SY P+ +   +  S++  + 
Sbjct:   352 AGGSDLEIHSPDDTSLDPTEAILLLGGFDKDSETWLSSVQSYFPSRNVVKAHSSMSCIRS 411

Query:   397 SLAGATIDNKIFAIGGGNGLECFSD-VEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLY 455
             + + A +D KI+  GG +G   +++  E  +   G+W     + +++ +L  A L+G ++
Sbjct:   412 NASVAKLDGKIYVFGGDDGGRGWTNSAESFNQTDGQWSLCPPLNERKGSLGGATLDGKIF 471

Query:   456 ATGGYDGNEYMNSAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPS 515
             A GG +G    +  E  DP    W +  +M + R   +       +YA+GG+DG   + +
Sbjct:   472 AIGGGNGMVSFSDVEMLDPDIGRWIRTRSMGQERFAVASVEHKSSIYAVGGYDGKEYLNT 531

Query:   516 IEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVERFKEGQG-W 573
              E +DPR  SWM+   MK  RG     V+ E +Y IGG  +G  +V +VE ++   G W
Sbjct:   532 AERFDPREHSWMNIASMKSRRGCHSLVVLNEKLYAIGGF-DGETMVSSVEIYEPRTGTW 589
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0048451 "petal formation" evidence=RCA
GO:0048453 "sepal formation" evidence=RCA
TAIR|locus:2085492 AT3G11000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070209-226 klhl8 "kelch-like 8 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0030114 CG17754 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:2678948 Klhl17 "kelch-like 17" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708444 Klhl17 "kelch-like family member 17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N065 KLHL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B4DUR0 KLHL20 "Kelch-like protein 20" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9C0H6 KLHL4 "Kelch-like protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJ37 KLHL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00037409001
SubName- Full=Chromosome chr8 scaffold_88, whole genome shotgun sequence; (633 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query592
pfam10539130 pfam10539, Dev_Cell_Death, Development and cell de 5e-65
smart00767132 smart00767, DCD, DCD is a plant specific domain in 4e-63
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 7e-28
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-26
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-22
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-16
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-14
smart0061247 smart00612, Kelch, Kelch domain 3e-12
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-11
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-11
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-11
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 3e-11
smart0061247 smart00612, Kelch, Kelch domain 1e-09
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-09
smart0061247 smart00612, Kelch, Kelch domain 4e-08
smart0061247 smart00612, Kelch, Kelch domain 5e-08
pfam0134446 pfam01344, Kelch_1, Kelch motif 4e-07
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 1e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 5e-06
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 6e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 8e-06
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 4e-05
PHA02713 557 PHA02713, PHA02713, hypothetical protein; Provisio 6e-05
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 3e-04
PHA02713557 PHA02713, PHA02713, hypothetical protein; Provisio 3e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 4e-04
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 6e-04
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 6e-04
PRK14131 376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 6e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 0.002
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 0.002
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 0.004
>gnl|CDD|204508 pfam10539, Dev_Cell_Death, Development and cell death domain Back     alignment and domain information 
 Score =  208 bits (532), Expect = 5e-65
 Identities = 78/130 (60%), Positives = 91/130 (70%), Gaps = 1/130 (0%)

Query: 18  LGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFLFNYTDRKLHGIFEAASP 77
           LGGVIFGC   T +EC  KQLFGLPA++  YV+ + PGLPLFLFNY DRKLHGIFEAAS 
Sbjct: 1   LGGVIFGCNNKTRRECFKKQLFGLPARYIDYVKNIKPGLPLFLFNYDDRKLHGIFEAASN 60

Query: 78  GMMNINPYGWT-DGSERTSYPAQVQIRVRMQCQPLNEEKFKPIIAANYYTPHHFWFELDH 136
           G MNI+P  W   G   T YPAQV+ R+R  C+PL E KF+P I  NYY  + F FEL H
Sbjct: 61  GGMNIDPNAWGSKGKGETRYPAQVRFRIRKDCKPLPESKFRPAIIENYYDKNKFRFELSH 120

Query: 137 SQASKLIALL 146
            Q +KL+ L 
Sbjct: 121 KQVNKLLDLF 130

The DCD domain is found in plant proteins involved in development and cell death. The DCD domain is an approximately 130 amino acid long stretch that contains several mostly invariable motifs. These include a FGLP and a LFL motif at the N-terminus and a PAQV and a PLxE motif towards the C-terminus of the domain. The DCD domain is present in proteins with different architectures. Some of these proteins contain additional recognisable motifs, like the KELCH repeats or the ParB domain. Length = 130
>gnl|CDD|214811 smart00767, DCD, DCD is a plant specific domain in proteins involved in development and programmed cell death Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 592
PF10539130 Dev_Cell_Death: Development and cell death domain; 100.0
smart00767132 DCD DCD is a plant specific domain in proteins inv 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG1230 521 consensus Protein containing repeated kelch motifs 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 99.97
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.97
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
PHA02790480 Kelch-like protein; Provisional 99.97
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.93
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.93
KOG1230 521 consensus Protein containing repeated kelch motifs 99.9
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.88
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.68
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.61
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.61
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.35
PF1396450 Kelch_6: Kelch motif 99.13
PF1396450 Kelch_6: Kelch motif 99.09
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.84
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.83
PF1341549 Kelch_3: Galactose oxidase, central domain 98.78
PF1341549 Kelch_3: Galactose oxidase, central domain 98.76
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.7
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.68
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.65
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.62
smart0061247 Kelch Kelch domain. 98.56
smart0061247 Kelch Kelch domain. 98.55
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.47
PLN02772 398 guanylate kinase 98.42
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.41
PLN02772 398 guanylate kinase 98.36
PF1385442 Kelch_5: Kelch motif 98.31
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.29
PF1385442 Kelch_5: Kelch motif 98.17
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.06
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.73
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.54
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.26
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.15
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.1
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.99
PRK00809144 hypothetical protein; Provisional 96.49
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.47
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.47
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.99
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 95.94
PRK04792448 tolB translocation protein TolB; Provisional 95.87
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.81
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 95.78
PF12768281 Rax2: Cortical protein marker for cell polarity 95.78
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 95.58
KOG0310 487 consensus Conserved WD40 repeat-containing protein 95.57
PRK04792448 tolB translocation protein TolB; Provisional 95.49
PF12768 281 Rax2: Cortical protein marker for cell polarity 95.47
PRK00178430 tolB translocation protein TolB; Provisional 95.42
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 95.34
PRK04922433 tolB translocation protein TolB; Provisional 95.19
PRK05137435 tolB translocation protein TolB; Provisional 95.16
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.11
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 95.07
PRK00178430 tolB translocation protein TolB; Provisional 94.88
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 94.78
KOG2055514 consensus WD40 repeat protein [General function pr 94.66
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 94.59
KOG0310 487 consensus Conserved WD40 repeat-containing protein 94.55
PRK04922433 tolB translocation protein TolB; Provisional 94.54
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 94.46
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 94.3
PRK05137435 tolB translocation protein TolB; Provisional 94.16
PTZ00421 493 coronin; Provisional 94.11
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 93.96
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 93.86
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 93.34
KOG2055 514 consensus WD40 repeat protein [General function pr 93.18
KOG0286343 consensus G-protein beta subunit [General function 93.04
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 93.03
PF09910339 DUF2139: Uncharacterized protein conserved in arch 92.88
PLN00181793 protein SPA1-RELATED; Provisional 92.51
PRK03629429 tolB translocation protein TolB; Provisional 92.4
PRK04043419 tolB translocation protein TolB; Provisional 92.25
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 92.04
PRK03629429 tolB translocation protein TolB; Provisional 91.99
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 91.98
PRK11028 330 6-phosphogluconolactonase; Provisional 91.87
PRK02889427 tolB translocation protein TolB; Provisional 91.61
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 91.6
PLN00181793 protein SPA1-RELATED; Provisional 91.41
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 91.3
COG1520370 FOG: WD40-like repeat [Function unknown] 90.91
smart00284255 OLF Olfactomedin-like domains. 90.88
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 90.78
PRK02889427 tolB translocation protein TolB; Provisional 90.49
PTZ00420 568 coronin; Provisional 89.46
PRK01742429 tolB translocation protein TolB; Provisional 89.4
smart00284255 OLF Olfactomedin-like domains. 89.16
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 89.04
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 88.69
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 88.15
KOG0266456 consensus WD40 repeat-containing protein [General 88.09
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 87.69
PRK13684334 Ycf48-like protein; Provisional 87.37
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 87.29
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 86.24
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 85.69
KOG0316307 consensus Conserved WD40 repeat-containing protein 84.35
PF13088275 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 84.0
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 83.69
KOG0316 307 consensus Conserved WD40 repeat-containing protein 83.49
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 82.51
PTZ00421 493 coronin; Provisional 82.47
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 82.27
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 81.83
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 81.69
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 80.6
PF09910339 DUF2139: Uncharacterized protein conserved in arch 80.32
>PF10539 Dev_Cell_Death: Development and cell death domain; InterPro: IPR013989 The DCD (Development and Cell Death) domain is found in plant proteins involved in development and cell death Back     alignment and domain information 
Probab=100.00  E-value=3.8e-63  Score=435.95  Aligned_cols=129  Identities=56%  Similarity=1.046  Sum_probs=127.6

Q ss_pred             cceEEEeecCCChHHHhhhccccCCccCccchhccCCCCeEEEEecCCCeEeeEEEeccCCCccccCCCCC-CCCCCCCC
Q 007704           18 LGGVIFGCKKSTIKECLAKQLFGLPAQHFLYVRKVDPGLPLFLFNYTDRKLHGIFEAASPGMMNINPYGWT-DGSERTSY   96 (592)
Q Consensus        18 ~~g~if~c~~~t~~e~~~~~~fgl~~~~~~~v~~i~~g~~lfl~~~~~~~l~g~~~a~s~g~~~~~~~a~~-~~~~~~~~   96 (592)
                      |||||||||++|++|||+++|||||+.++++|++||||||||||||++|+|||||||+|+|+|||+|+||+ +|+.+++|
T Consensus         1 lgG~IF~Cn~~T~~ECf~~~lFGLP~~~~~~V~~I~pG~~LFLfn~~~r~L~GifeA~S~G~~ni~p~Af~~~~~~~~~f   80 (130)
T PF10539_consen    1 LGGFIFMCNNKTKPECFRRQLFGLPAGHKDFVKKIKPGMPLFLFNYSDRKLYGIFEATSDGGMNIEPYAFSGSGSGESPF   80 (130)
T ss_pred             CceEEEEECCCCHHHHHhcccccCChhhhhHHheeCCCCEEEEEEcCCCEEEEEEEecCCCccCcChhhhCCCCCCCccc
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999 78899999


Q ss_pred             CceEEEEEeeeecCCCCCcchhHHHhcccCCCCCCCCCCHHHHHHHHHhh
Q 007704           97 PAQVQIRVRMQCQPLNEEKFKPIIAANYYTPHHFWFELDHSQASKLIALL  146 (592)
Q Consensus        97 paqv~~~~~~~~~pl~e~~~~~~i~~n~~~~~~f~~~l~~~q~~~l~~lf  146 (592)
                      ||||||+|+++|+||+|++||+||+||||.++||+||||++||++|++||
T Consensus        81 PAQVrf~i~~~C~PL~E~~fk~aI~~Ny~~~~kF~~eLs~~Qv~~L~~LF  130 (130)
T PF10539_consen   81 PAQVRFRIRWDCPPLPESQFKPAIKDNYYDKNKFRFELSHQQVRKLLSLF  130 (130)
T ss_pred             ceEEEEEEeeeeecCCHHHHHHHHHHhCCCCCcccCcCCHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999998

The DCD domain is an ~130 amino acid long stretch that contains several mostly invariable motifs. These include a FGLP and a LFL motif at the N terminus and a PAQV and a PLxE motif towards the C terminus of the domain. The DCD domain is present in proteins with different architectures. Some of these proteins contain additional recognizable motifs, like the KELCH repeats or the ParB domain []. Biological studies indicate a role of these proteins in phytohormone response, embryo development and programmed cell death by pathogens or ozone. The predicted secondary structure of the DCD domain is mostly composed of beta strands and confined by an alpha-helix at the N- and at the C terminus []. Proteins known to contain a DCD domain are listed below: Carrot B2 protein. Pea Gda-1 protein. Soybean N-rich protein (NRP).
>smart00767 DCD DCD is a plant specific domain in proteins involved in development and programmed cell death Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK00809 hypothetical protein; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13088 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 1VCU_B 2F25_B 1SO7_A 2F29_A 1SNT_A 2F13_A 2F28_A 2F27_A Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query592
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 3e-31
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 4e-31
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 8e-30
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-29
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 2e-29
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-28
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 7e-27
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-18
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 8e-10
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 5e-07
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure 
Iteration: 1

 Score =  133 bits (334), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 124/243 (51%), Gaps = 6/243 (2%)
Query: 355 MLNGELYIFGG----GDGNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGATIDNKIFAI 410
           ++ G LY  GG     DGN+  + ++ Y+P  ++W+   S++  +  +    ID  I+A+
Sbjct: 62  VVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGHIYAV 121
Query: 411 GGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAE 470
           GG +G    S VE  + +  +W     ML +R  +  A LN +LYA GG+DG   +NSAE
Sbjct: 122 GGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAE 181
Query: 471 RFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGE 530
            + P  + W  I  MN  R    + VL+  +YA GG+DG   + S+E YD    +W    
Sbjct: 182 CYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVA 241
Query: 531 PMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVERF-KEGQGWEEINSRAIGKRCFMSV 589
           PM+  R  LG  V +  IYV+GG  +G   +D+VE +  +   W E+     G+      
Sbjct: 242 PMRHHRSALGITVHQGKIYVLGGY-DGHTFLDSVECYDPDSDTWSEVTRMTSGRSGVGVA 300
Query: 590 VTV 592
           VT+
Sbjct: 301 VTM 303
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query592
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 7e-94
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-82
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-50
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 8e-39
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-91
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-82
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-79
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 9e-38
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 9e-90
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-80
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 2e-38
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-85
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-74
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-73
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 3e-48
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-81
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-68
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-65
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 8e-47
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-46
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-79
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-73
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-65
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 4e-44
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-41
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 2e-13
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 1e-24
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 9e-17
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 2e-13
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 4e-11
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 3e-19
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 7e-19
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 5e-17
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
 Score =  289 bits (741), Expect = 7e-94
 Identities = 77/253 (30%), Positives = 127/253 (50%), Gaps = 4/253 (1%)

Query: 343 PMSSARSYASAAMLNGELYIFGGGDGNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGAT 402
            + S R  A    + G ++  GG +G+    TV+SY P  D+WTS  ++   + +L  A 
Sbjct: 47  ELPSRRCRAGMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAV 106

Query: 403 IDNKIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDG 462
           ++  ++A+GG +G    S VE  ++   +W     M  +R ++    + G+LYA GGYD 
Sbjct: 107 LNGLLYAVGGFDGSTGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDV 166

Query: 463 --NEYMNSAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYD 520
              + +++ E ++   + WT IA M+ RR    + VLN  LYA+GG DG  +  S+EVYD
Sbjct: 167 ASRQCLSTVECYNATTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYD 226

Query: 521 PRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVERFKEGQG-WEEINSR 579
           P   +W     M + R   G   V   +YV+GG  +GS  + +VE +      W  ++S 
Sbjct: 227 PTTNAWRQVADMNMCRRNAGVCAVNGLLYVVGGD-DGSCNLASVEYYNPTTDKWTVVSSC 285

Query: 580 AIGKRCFMSVVTV 592
               R +  V  +
Sbjct: 286 MSTGRSYAGVTVI 298
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query592
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.97
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.95
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.9
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.9
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.75
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.51
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.49
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.37
3jrp_A379 Fusion protein of protein transport protein SEC13 97.3
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.18
3jrp_A 379 Fusion protein of protein transport protein SEC13 97.17
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.14
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.04
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.01
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.0
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.98
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.82
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.81
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.8
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.78
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.77
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.72
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.71
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.69
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.69
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.67
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.67
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.64
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.63
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.62
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.59
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.58
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.56
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.54
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.53
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 96.51
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.5
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.5
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.43
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.42
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.41
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.4
3jro_A 753 Fusion protein of protein transport protein SEC13 96.34
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.33
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.29
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.27
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.27
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.24
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.21
3jro_A 753 Fusion protein of protein transport protein SEC13 96.18
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.13
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.09
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.09
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.05
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.04
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.03
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.03
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.02
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.01
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.96
2pm7_B297 Protein transport protein SEC13, protein transport 95.96
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.94
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.88
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.8
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.79
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.77
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.75
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.71
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 95.66
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.64
2pm7_B297 Protein transport protein SEC13, protein transport 95.62
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.61
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.59
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.58
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.53
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.51
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.48
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.48
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.41
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.32
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.31
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 95.29
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 95.27
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 95.26
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.24
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.23
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.22
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 95.15
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.13
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.12
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.02
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.01
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.99
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.98
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.95
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 94.95
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.94
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 94.91
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.9
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 94.85
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.85
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 94.82
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.78
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.77
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 94.76
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.75
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.64
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 94.61
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 94.52
4e54_B435 DNA damage-binding protein 2; beta barrel, double 94.49
1qhu_A 460 Protein (hemopexin); beta propeller, HAEM binding 94.47
3v9f_A 781 Two-component system sensor histidine kinase/RESP 94.47
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 94.47
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.41
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 94.38
3v9f_A 781 Two-component system sensor histidine kinase/RESP 94.36
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 94.31
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 94.3
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.27
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 94.27
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.26
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 94.21
1itv_A195 MMP9; adaptive molecular recognition, beta propell 94.19
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.18
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 94.15
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 94.14
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.12
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.1
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 94.08
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 94.04
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.03
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.0
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 93.98
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 93.97
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 93.96
2p5d_A147 UPF0310 protein mjecl36; NPPSFA, national project 93.87
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 93.87
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 93.85
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 93.85
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 93.78
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 93.78
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.73
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 93.56
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 93.51
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 93.5
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 93.46
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.46
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 93.39
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 93.38
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 93.37
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 93.3
2p4o_A306 Hypothetical protein; putative lactonase, structur 93.25
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 93.17
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 93.17
2fp8_A322 Strictosidine synthase; six bladed beta propeller 93.16
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.15
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 93.14
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 93.12
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 93.02
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 93.01
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 93.0
2hd9_A145 UPF0310 protein PH1033; pyrococcus horikoshii OT3, 92.84
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 92.83
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 92.81
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 92.78
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 92.78
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 92.76
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 92.73
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 92.7
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 92.68
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 92.62
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 92.56
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 92.52
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 92.51
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 92.44
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.4
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 92.31
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 92.2
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 92.13
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 92.04
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.85
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 91.76
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 91.62
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 91.52
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 91.35
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 91.29
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 91.28
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 91.26
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 91.18
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 91.14
2p4o_A306 Hypothetical protein; putative lactonase, structur 91.08
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 91.04
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 90.82
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 90.68
3ott_A 758 Two-component system sensor histidine kinase; beta 90.61
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 90.44
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 90.33
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 90.3
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 90.29
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 90.23
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 90.16
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 89.66
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 89.65
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 89.61
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 89.61
2xyi_A430 Probable histone-binding protein CAF1; transcripti 89.59
3ott_A 758 Two-component system sensor histidine kinase; beta 89.43
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 89.3
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 89.19
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 89.18
1itv_A195 MMP9; adaptive molecular recognition, beta propell 89.06
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 88.97
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 88.91
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 88.83
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 88.82
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 88.76
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 88.49
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 88.38
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 88.1
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 88.06
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 87.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 87.96
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 87.08
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 87.04
2xyi_A430 Probable histone-binding protein CAF1; transcripti 87.04
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 86.43
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 86.43
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 86.24
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 85.89
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 85.6
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 85.53
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 84.99
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 84.49
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 84.44
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 84.31
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 83.82
1k32_A 1045 Tricorn protease; protein degradation, substrate g 82.96
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 82.73
2ymu_A577 WD-40 repeat protein; unknown function, two domain 82.27
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 81.99
3v65_B386 Low-density lipoprotein receptor-related protein; 81.9
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 81.5
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 81.38
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 81.17
1k32_A 1045 Tricorn protease; protein degradation, substrate g 81.16
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 80.9
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 80.88
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 80.64
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 80.34
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 80.29
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 80.16
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=1.2e-43  Score=366.06  Aligned_cols=259  Identities=32%  Similarity=0.602  Sum_probs=238.2

Q ss_pred             ccccCCCcccc---CCCccCcceEEEEECCEEEEEeeC----CCCCCcceEEEEECCCCeEEECCCCCCCCcceEEEEEC
Q 007704          332 LHLDPSESIYL---PMSSARSYASAAMLNGELYIFGGG----DGNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGATID  404 (592)
Q Consensus       332 ~~~~p~~~~~~---p~p~~R~~~s~v~~~~~Iyv~GG~----~~~~~~~~v~~yd~~t~~W~~l~~lp~~r~~~~~~~~~  404 (592)
                      +.+++....|.   ++|.+|.+|++++++++|||+||.    ++....+++++||+.+++|+.++++|.+|..|++++++
T Consensus        42 ~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~  121 (308)
T 1zgk_A           42 EAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVID  121 (308)
T ss_dssp             EEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSSCCBTCEEEEET
T ss_pred             EEEcCCCCeEeECCCCCcccccceEEEECCEEEEECCCcCCCCCCeecceEEEECCCCCeEeECCCCCcCccccEEEEEC
Confidence            44555554443   678899999999999999999998    56667899999999999999999999999999999999


Q ss_pred             CEEEEEecCCCCcccceEEEEeCCCCeEEEcccccCcccceEEEEECCEEEEEeccCCCCCCCeeEEEeCCCCeEEEecc
Q 007704          405 NKIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIAN  484 (592)
Q Consensus       405 ~~Iyv~GG~~~~~~~~~v~~yD~~t~~W~~i~~~p~~R~~~~a~~~~g~IYV~GG~~~~~~~~~v~~yD~~t~~W~~i~~  484 (592)
                      ++|||+||.+.....+++++||+.+++|+.++++|.+|..|++++++++||++||.++...++++++||+.+++|+.+++
T Consensus       122 ~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~  201 (308)
T 1zgk_A          122 GHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITA  201 (308)
T ss_dssp             TEEEEECCEETTEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCCEEEEETTTTEEEECCC
T ss_pred             CEEEEEcCCCCCcccccEEEECCCCCeEeECCCCCccccceEEEEECCEEEEEeCCCCCCcCceEEEEeCCCCeEeeCCC
Confidence            99999999877777899999999999999999999999999999999999999999888778999999999999999999


Q ss_pred             CCCCCceeEEEEECCEEEEEecCCCCCCCCeEEEEeCCCCeEEEcCCCCCCCcceEEEEECCEEEEEecccCCCccccEE
Q 007704          485 MNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTV  564 (592)
Q Consensus       485 ~p~~R~~~s~v~~~~~Lyv~GG~~~~~~~~~v~~yD~~t~~W~~v~~lp~~R~~~s~~v~~~~Iyv~GG~~~~~~~~~~v  564 (592)
                      +|.+|..|++++++++||++||.++....+++++||+.+++|+.+.++|.+|..+++++++++|||+||.++. ...+++
T Consensus       202 ~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~i~v~GG~~~~-~~~~~v  280 (308)
T 1zgk_A          202 MNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGH-TFLDSV  280 (308)
T ss_dssp             CSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSS-CBCCEE
T ss_pred             CCCccccceEEEECCEEEEEeCCCCCCccceEEEEeCCCCcEEECCCCCCCccceEEEEECCEEEEEcCcCCC-cccceE
Confidence            9999999999999999999999987777899999999999999999999999999999999999999998653 578999


Q ss_pred             EEEcCC-CcEEEccccCCCCccceEEEEC
Q 007704          565 ERFKEG-QGWEEINSRAIGKRCFMSVVTV  592 (592)
Q Consensus       565 ~~Yd~~-~~W~~v~~~p~~~r~~~savvl  592 (592)
                      ++||++ ++|+.++.+|.+ |+.++|++|
T Consensus       281 ~~yd~~~~~W~~~~~~p~~-r~~~~~~~l  308 (308)
T 1zgk_A          281 ECYDPDTDTWSEVTRMTSG-RSGVGVAVT  308 (308)
T ss_dssp             EEEETTTTEEEEEEECSSC-CBSCEEEEC
T ss_pred             EEEcCCCCEEeecCCCCCC-cccceeEeC
Confidence            999999 999999999988 777777765
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2p5d_A UPF0310 protein mjecl36; NPPSFA, national project on protein structural and functional analyses; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2hd9_A UPF0310 protein PH1033; pyrococcus horikoshii OT3, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: CIT; 1.35A {Pyrococcus horikoshii} SCOP: b.122.1.8 PDB: 1wmm_A* 2zbn_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 592
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-23
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-20
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-18
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-12
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-10
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 9e-17
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 5e-16
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-15
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-12
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 6e-09
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 7e-09
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 5e-06
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 97.3 bits (240), Expect = 5e-23
 Identities = 62/196 (31%), Positives = 95/196 (48%)

Query: 348 RSYASAAMLNGELYIFGGGDGNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGATIDNKI 407
           R+     +++G +Y  GG  G   HN+VE Y P  DEW     +   +  +  A ++  +
Sbjct: 92  RNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLL 151

Query: 408 FAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMN 467
           +A+GG +G    +  E    +  +W    +M   R       L+  +YA GGYDG + +N
Sbjct: 152 YAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLN 211

Query: 468 SAERFDPREHYWTKIANMNRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWM 527
           S ER+D     WT +A M  RR    + V  G++Y LGG+DG   + S+E YDP   +W 
Sbjct: 212 SVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWS 271

Query: 528 SGEPMKLSRGYLGAAV 543
               M   R  +G AV
Sbjct: 272 EVTRMTSGRSGVGVAV 287
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query592
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.96
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.94
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.63
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.21
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 96.15
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 96.12
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.86
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.62
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.6
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 95.38
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.35
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.32
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.99
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 94.94
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 94.9
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 94.82
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.75
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.61
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 94.3
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.17
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.01
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 93.89
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 93.63
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.47
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.17
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.01
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 92.93
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 92.9
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 92.72
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 92.53
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 92.35
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 92.27
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 92.19
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 92.19
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 92.17
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 91.71
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 90.83
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 90.68
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 90.11
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 89.51
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 89.03
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 89.0
d2hd9a1145 Hypothetical protein PH1033 {Pyrococcus horikoshii 88.99
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 88.54
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 87.57
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 86.5
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 84.47
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 83.86
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 83.08
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 82.13
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 81.32
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 80.44
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.5e-39  Score=322.27  Aligned_cols=257  Identities=32%  Similarity=0.607  Sum_probs=237.4

Q ss_pred             cccCCCcccc---CCCccCcceEEEEECCEEEEEeeCC----CCCCcceEEEEECCCCeEEECCCCCCCCcceEEEEECC
Q 007704          333 HLDPSESIYL---PMSSARSYASAAMLNGELYIFGGGD----GNSWHNTVESYSPANDEWTSRPSLNGTKGSLAGATIDN  405 (592)
Q Consensus       333 ~~~p~~~~~~---p~p~~R~~~s~v~~~~~Iyv~GG~~----~~~~~~~v~~yd~~t~~W~~l~~lp~~r~~~~~~~~~~  405 (592)
                      .++|....|.   ++|.+|.+|++++++++|||+||..    +....+++++||+.+++|+.++++|.+|..|+++++++
T Consensus        23 ~yd~~t~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~~p~~r~~~~~~~~~~  102 (288)
T d1zgka1          23 AYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDG  102 (288)
T ss_dssp             EEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSSCCBTCEEEEETT
T ss_pred             EEECCCCeEEECCCCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccccccccccccceecceeccccce
Confidence            4566655443   6888999999999999999999954    34567899999999999999999999999999999999


Q ss_pred             EEEEEecCCCCcccceEEEEeCCCCeEEEcccccCcccceEEEEECCEEEEEeccCCCCCCCeeEEEeCCCCeEEEeccC
Q 007704          406 KIFAIGGGNGLECFSDVEMLDLDIGKWIRTRSMLQKRFALAAAELNGVLYATGGYDGNEYMNSAERFDPREHYWTKIANM  485 (592)
Q Consensus       406 ~Iyv~GG~~~~~~~~~v~~yD~~t~~W~~i~~~p~~R~~~~a~~~~g~IYV~GG~~~~~~~~~v~~yD~~t~~W~~i~~~  485 (592)
                      +||++||..+....++++.||+.+++|...+.++.+|.+|+++.+++++|++||.+......+++.||+.++.|...+..
T Consensus       103 ~i~~~gg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~~~~~~~~~~~~d~~~~~~~~~~~~  182 (288)
T d1zgka1         103 HIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAM  182 (288)
T ss_dssp             EEEEECCEETTEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCCEEEEETTTTEEEECCCC
T ss_pred             eeEEecceecccccceeeeeccccCccccccccccccccceeeeeeecceEecCcccccccceEEEeecccccccccccc
Confidence            99999998888888999999999999999999999999999999999999999998888889999999999999999999


Q ss_pred             CCCCceeEEEEECCEEEEEecCCCCCCCCeEEEEeCCCCeEEEcCCCCCCCcceEEEEECCEEEEEecccCCCccccEEE
Q 007704          486 NRRRGCHSLAVLNGKLYALGGFDGSAMVPSIEVYDPRLGSWMSGEPMKLSRGYLGAAVVKEAIYVIGGVKNGSEIVDTVE  565 (592)
Q Consensus       486 p~~R~~~s~v~~~~~Lyv~GG~~~~~~~~~v~~yD~~t~~W~~v~~lp~~R~~~s~~v~~~~Iyv~GG~~~~~~~~~~v~  565 (592)
                      +..+..++++.++++||++||.+....+++.+.||..+++|+.++++|.+|..|++++++++|||+||.+.. ..++++|
T Consensus       183 ~~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~-~~~~~v~  261 (288)
T d1zgka1         183 NTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGH-TFLDSVE  261 (288)
T ss_dssp             SSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSS-CBCCEEE
T ss_pred             ccccccccccceeeeEEEecCccccccccceeeeeecceeeecccCccCcccceEEEEECCEEEEEecCCCC-eecceEE
Confidence            999999999999999999999988888899999999999999999999999999999999999999998654 6889999


Q ss_pred             EEcCC-CcEEEccccCCCCccceEEEE
Q 007704          566 RFKEG-QGWEEINSRAIGKRCFMSVVT  591 (592)
Q Consensus       566 ~Yd~~-~~W~~v~~~p~~~r~~~savv  591 (592)
                      +||++ ++|+.+++||.+ |++|+|||
T Consensus       262 ~yd~~~~~W~~~~~~p~~-R~~~~~~~  287 (288)
T d1zgka1         262 CYDPDTDTWSEVTRMTSG-RSGVGVAV  287 (288)
T ss_dssp             EEETTTTEEEEEEECSSC-CBSCEEEE
T ss_pred             EEECCCCEEEECCCCCCC-cEeEEEEE
Confidence            99999 999999999999 78888776
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2hd9a1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure