Citrus Sinensis ID: 007716

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590--
MHKSLSNSYKSSTLKRHSGSLSPFVHSIFRLNQTNNLQSQSSLANSIKTPSGYSPFRHFNQNPCFFSSGYFPNGVNLKGFGRNESGVSCAKLFFRSFCSEMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYE
cccccccccccHHHHHHccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEccccccccEEEcEEEEcHHHHHHHccccccccccccccEEEEEEEEEEccccccccccccccccEEEEHHHHHHHHHHHHHHHccEEEccccEEEEEEcccccEEEEEccccccccccccccccccccEEEEEEEEEcccccHHHHHHHHHccccccccccccEEEEccccEEEEccccccccccEEEEEccccccccccEEEEEEccccEEEEEEEEEcccccccccHHHHHHHHHccccccccccccEEEEEcEEEEcccccccccccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHHcHHHHccccHHHHHHHHHHHHHcccccccccccccccHHcccHHHcccccccccccccccccccccEEcccccccccccccEEEcccccccccccccccccccccccccccc
ccccccccccccccccccccHHHHHHHHHHccccccccccHcccccccccccccccHHccccccEEccccccccccccccccccccccEEEEEEEcccHHHHHHHcEEcEEEEcccHHHHHHHHHHHHcHHHccccEEEEEEEcccHHcHHHHccccHcHHHHHHHcccHHHccccccccccccEEEEEcccccccccccccccccEEEEHHHHHHHHHHHHHHcccEEEccccHHHHHEcccccEEEEEEcccccccccccccccccccEEEEEEEEEEcccccHHHHHHHHHcccccccccccccEEEEEHEEHEccHHHccccEEEEEccccccccccccEEEEEccccEEEEEEEEEccccccccccHHHHHHHcccHHHHHHHccccHHHHHHHHHHHccccccccccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHHcccccEEcccccccHHHcccHHHcccccccccccEEEEccccEEEEEccccccccccEEEEccccccHHccHHHccccccccccccccc
mhkslsnsyksstlkrhsgslspfvHSIFRLnqtnnlqsqsslansiktpsgyspfrhfnqnpcffssgyfpngvnlkgfgrnesgvsCAKLFFRSFCSEMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVgahiisgnvfepralnellpqwkqeeapirvpvssdkfwfltkdrafslpspfsnrgnyVISLSQLVRWLggkaeelgveiypgfaaseilydadnkvigigtndmgiakdgskkenfQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEvweidegkhnpgeilhtlgwpldqktyggsfLYHMNDRQIALGLVVALNyhnpflnpyeefqkfkhhpaikplleggtvvQYGARtlnegglqsipypvfpggaiigcaagflnvpkikgtHTAMKSGMLAAEAgfgvlhedsnmeIYWDTLQKSWVWQELQRArnyrpafeygllpglaicglehyilrgkspytlkhgkpdheatdaarlhspieypkpdgvlsfdvptslhrsntnhehdqpahlrlrdpkipelvnlpeyagpesrycparvye
mhkslsnsyksstlkrhsgslSPFVHSIFRLNQTNNLQSQSSLANSIKTPSGYSPFRHFNQNPCFFSSGYFPNGVNLKGFGRNESGVSCAKLFFRSFCSEMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPqwkqeeapirvpVSSDKFWFLTKDRAfslpspfsnrgNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNdmgiakdgskkenfqrgVELRGRITllaegcrgslSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHrsntnhehdqpahlrlrdpkipelvnlpeyagpesrycparvye
MHKSLSNSYKSSTLKRHSGSLSPFVHSIFRlnqtnnlqsqsslANSIKTPSGYSPFRHFNQNPCFFSSGYFPNGVNLKGFGRNESGVSCAKLFFRSFCSEMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYE
************************VHSIFR***********************SPFRHFNQNPCFFSSGYFPNGVNLKGFGRNESGVSCAKLFFRSFCSEMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAK*******FQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYT**********************************************************************************
*******************************************************************************************************ESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGS***NFQRGVELRGRITLLAEGCRGSLSEKLI**FKL***SHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYE
******************GSLSPFVHSIFRLNQTNNLQSQSSLANSIKTPSGYSPFRHFNQNPCFFSSGYFPNGVNLKGFGRNESGVSCAKLFFRSFCSEMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHR***********HLRLRDPKIPELVNLPEYAGPESRYCPARVYE
*******************S**P****I*****************SIKTPSGYSPFRHFNQNPCFFSSGYFPNGVNLKGFGRNESGVSCAKLFFRSFCSEMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKSLSNSYKSSTLKRHSGSLSPFVHSIFRLNQTNNLQSQSSLANSIKTPSGYSPFRHFNQNPCFFSSGYFPNGVNLKGFGRNESGVSCAKLFFRSFCSEMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query592 2.2.26 [Sep-21-2011]
Q54XM6606 Electron transfer flavopr yes no 0.863 0.843 0.543 1e-166
Q6UPE1616 Electron transfer flavopr yes no 0.827 0.795 0.539 1e-156
Q921G7616 Electron transfer flavopr yes no 0.827 0.795 0.537 1e-156
Q2KIG0617 Electron transfer flavopr yes no 0.827 0.794 0.529 1e-155
P55931617 Electron transfer flavopr yes no 0.827 0.794 0.535 1e-154
Q5RDD3617 Electron transfer flavopr yes no 0.827 0.794 0.533 1e-154
Q16134617 Electron transfer flavopr yes no 0.827 0.794 0.533 1e-154
Q9HZP5551 Electron transfer flavopr yes no 0.827 0.889 0.527 1e-143
Q11190597 Electron transfer flavopr yes no 0.826 0.819 0.5 1e-142
P94132570 Probable electron transfe yes no 0.819 0.850 0.512 1e-139
>sp|Q54XM6|ETFD_DICDI Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Dictyostelium discoideum GN=etfdh PE=3 SV=1 Back     alignment and function desciption
 Score =  586 bits (1510), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 290/534 (54%), Positives = 372/534 (69%), Gaps = 23/534 (4%)

Query: 80  FGRNESGVSCAKLFFRSFCSEM---CRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVD 136
           FG+N   +       R F SE     R+S  +DVVIVGAGP+GLS AIRLKQL  +   D
Sbjct: 26  FGKNHQNMKSIYSSIRFFSSEQELPPRDSDQFDVVIVGAGPSGLSTAIRLKQLSEKAGKD 85

Query: 137 LSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFS 196
           L VCVVEKG+EVG+HI+SG V +P+ALNEL+P WK++ AP+   V  DKF+FLT++R+  
Sbjct: 86  LRVCVVEKGSEVGSHILSGAVMDPKALNELIPDWKEKGAPLITEVKQDKFYFLTENRSLR 145

Query: 197 LPSP--FSNRGNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDM 254
           LP+P    N GNY+ISL  +VRWLG +AE +GVE+YP FAASE+LY  +  V GI TNDM
Sbjct: 146 LPTPRLMHNEGNYIISLGNVVRWLGEQAESMGVEVYPSFAASEVLYHDNGAVRGIATNDM 205

Query: 255 GIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKE 314
           GIAKDGS   NF RG+EL  R+T+ AEGCRGSL++ L + F LR++   + QT+ LGIKE
Sbjct: 206 GIAKDGSLTSNFTRGMELNARLTIFAEGCRGSLTKGLFEKFNLRDE--CEPQTFGLGIKE 263

Query: 315 VWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEE 374
            WEI   KH  G ++HTLG+PL  +  GGSF+YH  +  + LGLVV L+Y NP+LNPY+E
Sbjct: 264 TWEIKPEKHQQGLVIHTLGYPLSDELLGGSFIYHAENNTVNLGLVVGLDYSNPYLNPYQE 323

Query: 375 FQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKG 434
           FQK K HP +K +LEGGT +QYGART+NEGG QSIP  VFPGGA++GC AGF++VPK+KG
Sbjct: 324 FQKLKLHPMVKDMLEGGTCIQYGARTINEGGFQSIPKLVFPGGALVGCTAGFVHVPKVKG 383

Query: 435 THTAMKSGMLAAEAGFGVL----------------HEDSNMEIYWDTLQKSWVWQELQRA 478
           +H AMK+G+LAAEA F  L                 E   +  Y + L+KSWVW+EL+  
Sbjct: 384 SHYAMKTGILAAEAAFPQLISQQEKEQEQEQDKPSVEPLLINEYPEELKKSWVWKELREV 443

Query: 479 RNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGV 538
           RNYRP+  +G +PGL    LE YI RG +P+TL +GKPD+E    A     IEY KPDG 
Sbjct: 444 RNYRPSLHWGTIPGLIYGALEMYIFRGHTPWTLSNGKPDNERLKPAAECKKIEYKKPDGQ 503

Query: 539 LSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYE 592
           ++FD+ TS+ RS TNHE +QP HL++RD ++ + VN   Y GPE R+CPA VYE
Sbjct: 504 ITFDLMTSVMRSGTNHEENQPIHLKVRDMEVAKKVNRDIYDGPEGRFCPAGVYE 557
Accepts electrons from ETF and reduces ubiquinone.
Dictyostelium discoideum (taxid: 44689)
EC: 1EC: .EC: 5EC: .EC: 5EC: .EC: 1
>sp|Q6UPE1|ETFD_RAT Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Etfdh PE=2 SV=1 Back     alignment and function description
>sp|Q921G7|ETFD_MOUSE Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Mus musculus GN=Etfdh PE=1 SV=1 Back     alignment and function description
>sp|Q2KIG0|ETFD_BOVIN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Bos taurus GN=ETFDH PE=2 SV=1 Back     alignment and function description
>sp|P55931|ETFD_PIG Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Sus scrofa GN=ETFDH PE=1 SV=2 Back     alignment and function description
>sp|Q5RDD3|ETFD_PONAB Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Pongo abelii GN=ETFDH PE=2 SV=1 Back     alignment and function description
>sp|Q16134|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2 Back     alignment and function description
>sp|Q9HZP5|ETFD_PSEAE Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2953 PE=1 SV=1 Back     alignment and function description
>sp|Q11190|ETFD_CAEEL Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Caenorhabditis elegans GN=let-721 PE=1 SV=2 Back     alignment and function description
>sp|P94132|ETFD_ACIAD Probable electron transfer flavoprotein-ubiquinone oxidoreductase OS=Acinetobacter sp. (strain ADP1) GN=etfD PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query592
225433976676 PREDICTED: electron transfer flavoprotei 0.918 0.804 0.780 0.0
449459846659 PREDICTED: electron transfer flavoprotei 0.959 0.861 0.742 0.0
297743836536 unnamed protein product [Vitis vinifera] 0.822 0.908 0.841 0.0
356557362617 PREDICTED: electron transfer flavoprotei 0.841 0.807 0.817 0.0
449498831668 PREDICTED: electron transfer flavoprotei 0.959 0.850 0.728 0.0
255577195609 electron transfer flavoprotein-ubiquinon 0.847 0.824 0.810 0.0
15224277633 electron-transferring-flavoprotein dehyd 0.841 0.786 0.825 0.0
357454495606 Electron transfer flavoprotein-ubiquinon 0.841 0.821 0.799 0.0
297824323629 electron-transfer flavoprotein:ubiquinon 0.873 0.821 0.794 0.0
223947601584 unknown [Zea mays] gi|414870746|tpg|DAA4 0.837 0.849 0.769 0.0
>gi|225433976|ref|XP_002270682.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/557 (78%), Positives = 488/557 (87%), Gaps = 13/557 (2%)

Query: 49  TPSGYSPFRHFNQNPCF----------FSSGYFPNGVNLKGFGRNESGVSCAKLFF---R 95
           +P+G   FR  ++N  F          FSSGY  N  NLK    N  G      F    R
Sbjct: 71  SPNGSPFFRALDRNSSFSGPQMAGNRFFSSGYLLNCKNLKNGKGNRRGFLRVGSFVGESR 130

Query: 96  SFCSEMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISG 155
           +F SE  RESM YDVVIVGAGP+GLSAAIRLKQ+CR K+VD SVCVVEKGAEVGAHI+SG
Sbjct: 131 AFSSEPDRESMEYDVVIVGAGPSGLSAAIRLKQMCRAKDVDFSVCVVEKGAEVGAHILSG 190

Query: 156 NVFEPRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLV 215
           NVFEPRAL+ELLP+WKQEEAPI VPVSSDKFW LTKDRAFSLPSPF N+GNY+ISLSQLV
Sbjct: 191 NVFEPRALDELLPEWKQEEAPINVPVSSDKFWLLTKDRAFSLPSPFDNKGNYIISLSQLV 250

Query: 216 RWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGR 275
           RWLGGKAEELGVEIYPGFAASEILYDA++ VIGIGTNDMGIAKDGSKK+NFQRGVELRGR
Sbjct: 251 RWLGGKAEELGVEIYPGFAASEILYDANHNVIGIGTNDMGIAKDGSKKDNFQRGVELRGR 310

Query: 276 ITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWP 335
           +TLLAEGCRGSLSEK+++++ LREK+ AQHQTYALGIKE+WEIDE KH  G +LHTLGWP
Sbjct: 311 VTLLAEGCRGSLSEKVLRDYNLREKAQAQHQTYALGIKEIWEIDEAKHKTGTVLHTLGWP 370

Query: 336 LDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQ 395
           LD +TYGGSFLYHMNDRQ+++GLVVALNYHNPFLNPYEEFQK KHHPAIKPLL+GGTV+Q
Sbjct: 371 LDHRTYGGSFLYHMNDRQVSIGLVVALNYHNPFLNPYEEFQKLKHHPAIKPLLKGGTVLQ 430

Query: 396 YGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHE 455
           YGARTLNEGG QSIPYPVFPGGAIIGC+AGFLNVPKIKGTHTAMKSGMLAAEA F VLHE
Sbjct: 431 YGARTLNEGGFQSIPYPVFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFDVLHE 490

Query: 456 DSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGK 515
            S+ME YWD L+ SW+W+EL +ARNYRPAFEYGL+PGLA+  LEHY+L+G+SP TLKHGK
Sbjct: 491 GSSMEKYWDGLRNSWIWEELHKARNYRPAFEYGLIPGLALSALEHYVLKGRSPLTLKHGK 550

Query: 516 PDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNL 575
           PDHEATD A+LHSPI+YPKPDG++SFDVPTSL+RSNTNH+HDQP+HL LRDP+IP+ VNL
Sbjct: 551 PDHEATDVAQLHSPIQYPKPDGIVSFDVPTSLYRSNTNHDHDQPSHLHLRDPQIPDRVNL 610

Query: 576 PEYAGPESRYCPARVYE 592
           P++AGPESRYCPARVYE
Sbjct: 611 PDFAGPESRYCPARVYE 627

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449459846|ref|XP_004147657.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297743836|emb|CBI36719.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356557362|ref|XP_003546985.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|449498831|ref|XP_004160647.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255577195|ref|XP_002529480.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative [Ricinus communis] gi|223531038|gb|EEF32890.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15224277|ref|NP_181868.1| electron-transferring-flavoprotein dehydrogenase [Arabidopsis thaliana] gi|2288999|gb|AAB64328.1| putative electron transfer flavoprotein ubiquinone oxidoreductase [Arabidopsis thaliana] gi|330255167|gb|AEC10261.1| electron-transferring-flavoprotein dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357454495|ref|XP_003597528.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Medicago truncatula] gi|355486576|gb|AES67779.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297824323|ref|XP_002880044.1| electron-transfer flavoprotein:ubiquinone oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297325883|gb|EFH56303.1| electron-transfer flavoprotein:ubiquinone oxidoreductase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|223947601|gb|ACN27884.1| unknown [Zea mays] gi|414870746|tpg|DAA49303.1| TPA: hypothetical protein ZEAMMB73_777537 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query592
TAIR|locus:2058183633 ETFQO "AT2G43400" [Arabidopsis 0.917 0.857 0.765 6.4e-234
DICTYBASE|DDB_G0278849606 etfdh "electron transfer flavo 0.863 0.843 0.543 2.2e-153
ZFIN|ZDB-GENE-040912-168617 etfdh "electron-transferring-f 0.827 0.794 0.545 1.4e-149
RGD|735052616 Etfdh "electron-transferring-f 0.814 0.782 0.544 7.3e-146
MGI|MGI:106100616 Etfdh "electron transferring f 0.814 0.782 0.542 2.5e-145
UNIPROTKB|Q2KIG0617 ETFDH "Electron transfer flavo 0.814 0.781 0.534 5.1e-145
UNIPROTKB|F1RW89616 ETFDH "Electron transfer flavo 0.814 0.782 0.54 5.1e-145
UNIPROTKB|F6V7P2617 ETFDH "Uncharacterized protein 0.814 0.781 0.538 1.1e-144
UNIPROTKB|P55931617 ETFDH "Electron transfer flavo 0.814 0.781 0.54 1.4e-144
UNIPROTKB|E2QTI8618 ETFDH "Uncharacterized protein 0.814 0.779 0.536 1.7e-144
TAIR|locus:2058183 ETFQO "AT2G43400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2256 (799.2 bits), Expect = 6.4e-234, P = 6.4e-234
 Identities = 422/551 (76%), Positives = 471/551 (85%)

Query:    44 ANSIKTPSGYSPFRHFNQNPCFFSSGYFPNGVNLKGFGR--NESGVSCAKLFFRSFCSEM 101
             ++S+  P   SP    N+    +S+  F N   L    R    +G++ +    R   SE 
Sbjct:    40 SSSVSPPP--SPLNASNRFGYPYSADLFRNLSPLNPNSRILGVNGITSS----RCISSEA 93

Query:   102 CRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPR 161
              RES+ YDV+IVGAGPAGLSAAIRLKQL +EKN+DLSVCVVEKGAEVG HIISGNVFEP 
Sbjct:    94 VRESIEYDVLIVGAGPAGLSAAIRLKQLSQEKNIDLSVCVVEKGAEVGGHIISGNVFEPL 153

Query:   162 ALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLGGK 221
             AL+ELLP W+QE API +P SSDKFWFLTKDRAFSLPSPF N+GNYVISLSQLVRWLGGK
Sbjct:   154 ALDELLPHWRQEHAPIEIPASSDKFWFLTKDRAFSLPSPFDNKGNYVISLSQLVRWLGGK 213

Query:   222 AEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAE 281
             AEELG EIYPGF+ASE+L+DA +KV+GI T DMGI+KDGSKKENFQ GV+++GR+TL AE
Sbjct:   214 AEELGTEIYPGFSASEVLFDASDKVVGIATKDMGISKDGSKKENFQPGVDIKGRVTLFAE 273

Query:   282 GCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTY 341
             GCRGSLSE++IK +KLRE+ +AQHQTYALGIKEVWEIDE KHNPGE++HTLGWPLD KTY
Sbjct:   274 GCRGSLSERIIKKYKLREEVNAQHQTYALGIKEVWEIDESKHNPGEVIHTLGWPLDPKTY 333

Query:   342 GGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTL 401
             GGSFLYHMNDRQ+ALGLVVALNYHNPFLNPYEEFQK KHHPAIK +LEGGTV+QYGARTL
Sbjct:   334 GGSFLYHMNDRQVALGLVVALNYHNPFLNPYEEFQKLKHHPAIKGILEGGTVLQYGARTL 393

Query:   402 NEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEI 461
             NEGG QSIPYPVFPGGAIIGC+AGFLNVPKIKGTHTAMKSGMLAAEA FG LHE  NM  
Sbjct:   394 NEGGFQSIPYPVFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGALHEGLNMNT 453

Query:   462 YWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEAT 521
             YWD L+ SWVW+EL  ARNYRPAFEYGLLPGLAI  +EHY+L+GK P+TLKHGK DHEAT
Sbjct:   454 YWDNLRDSWVWKELYAARNYRPAFEYGLLPGLAISAMEHYVLKGKVPFTLKHGKADHEAT 513

Query:   522 DAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGP 581
             D AR  +PI YPKPDGVLSFDVPTSL+RSNTNH+HDQP+HLRLRDPKIPE VN PEYA P
Sbjct:   514 DLARKWTPIVYPKPDGVLSFDVPTSLYRSNTNHDHDQPSHLRLRDPKIPEKVNFPEYAAP 573

Query:   582 ESRYCPARVYE 592
             ESRYCPARVYE
Sbjct:   574 ESRYCPARVYE 584
GO:0003824 "catalytic activity" evidence=ISS
GO:0004174 "electron-transferring-flavoprotein dehydrogenase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0005740 "mitochondrial envelope" evidence=ISS
GO:0009055 "electron carrier activity" evidence=ISS
GO:0009228 "thiamine biosynthetic process" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009646 "response to absence of light" evidence=IEP
GO:0006552 "leucine catabolic process" evidence=IMP
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
DICTYBASE|DDB_G0278849 etfdh "electron transfer flavoprotein-ubiquinone oxidoreductase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-168 etfdh "electron-transferring-flavoprotein dehydrogenase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|735052 Etfdh "electron-transferring-flavoprotein dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:106100 Etfdh "electron transferring flavoprotein, dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIG0 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RW89 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6V7P2 ETFDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P55931 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTI8 ETFDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q16134ETFD_HUMAN1, ., 5, ., 5, ., 10.53340.82770.7941yesno
P55931ETFD_PIG1, ., 5, ., 5, ., 10.53540.82770.7941yesno
P94132ETFD_ACIAD1, ., 5, ., 5, ., 10.51240.81920.8508yesno
Q6UPE1ETFD_RAT1, ., 5, ., 5, ., 10.53930.82770.7954yesno
Q11190ETFD_CAEEL1, ., 5, ., 5, ., 10.50.82600.8190yesno
Q9HZP5ETFD_PSEAE1, ., 5, ., 5, ., 10.52770.82770.8892yesno
Q54XM6ETFD_DICDI1, ., 5, ., 5, ., 10.54300.86310.8432yesno
Q2KIG0ETFD_BOVIN1, ., 5, ., 5, ., 10.52950.82770.7941yesno
Q5RDD3ETFD_PONAB1, ., 5, ., 5, ., 10.53340.82770.7941yesno
Q921G7ETFD_MOUSE1, ., 5, ., 5, ., 10.53740.82770.7954yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.5.50.921
4th Layer1.5.5.10.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00010287001
SubName- Full=Chromosome chr5 scaffold_253, whole genome shotgun sequence; (536 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00027378001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (347 aa)
• •• •• 0.991
GSVIVG00020216001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (251 aa)
• •• •• 0.987
GSVIVG00024504001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (403 aa)
•  •  • 0.735
GSVIVG00024946001
SubName- Full=Chromosome chr4 scaffold_32, whole genome shotgun sequence; (528 aa)
   •  • 0.680
GSVIVG00036606001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (570 aa)
•  •    0.597
GSVIVG00020486001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (564 aa)
•  •    0.564
GSVIVG00023766001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (714 aa)
•  •  • 0.548
GSVIVG00020558001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (310 aa)
   • •• 0.545
GSVIVG00002216001
SubName- Full=Chromosome chr14 scaffold_128, whole genome shotgun sequence; (485 aa)
      • 0.540
GSVIVG00005777001
SubName- Full=Chromosome chr3 scaffold_158, whole genome shotgun sequence; (214 aa)
•     • 0.527

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query592
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 2e-91
pfam05187110 pfam05187, ETF_QO, Electron transfer flavoprotein- 3e-59
PRK10015429 PRK10015, PRK10015, oxidoreductase; Provisional 1e-32
PRK10157428 PRK10157, PRK10157, putative oxidoreductase FixC; 5e-29
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 3e-09
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 8e-09
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 3e-08
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 3e-07
COG2081408 COG2081, COG2081, Predicted flavoproteins [General 1e-06
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 3e-06
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 3e-06
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 5e-06
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 6e-06
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 6e-06
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 1e-05
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 1e-05
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 1e-05
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 2e-05
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 3e-05
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 3e-05
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 4e-05
PRK09126392 PRK09126, PRK09126, hypothetical protein; Provisio 4e-05
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 6e-05
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 7e-05
pfam05834374 pfam05834, Lycopene_cycl, Lycopene cyclase protein 1e-04
TIGR04018316 TIGR04018, Bthiol_YpdA, putative bacillithiol syst 1e-04
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 2e-04
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase 2e-04
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 3e-04
PRK06069577 PRK06069, sdhA, succinate dehydrogenase flavoprote 4e-04
COG2509486 COG2509, COG2509, Uncharacterized FAD-dependent de 4e-04
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 4e-04
PRK07208479 PRK07208, PRK07208, hypothetical protein; Provisio 4e-04
PLN02661357 PLN02661, PLN02661, Putative thiazole synthesis 4e-04
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General 5e-04
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 5e-04
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase 5e-04
pfam13454153 pfam13454, NAD_binding_9, FAD-NAD(P)-binding 6e-04
TIGR00562462 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase 7e-04
PRK11728393 PRK11728, PRK11728, hydroxyglutarate oxidase; Prov 8e-04
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 0.001
COG3380331 COG3380, COG3380, Predicted NAD/FAD-dependent oxid 0.001
TIGR01988387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 0.001
pfam13738202 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulp 0.001
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 0.002
PLN02568539 PLN02568, PLN02568, polyamine oxidase 0.002
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate 0.002
PLN02576496 PLN02576, PLN02576, protoporphyrinogen oxidase 0.002
PRK07333403 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl h 0.002
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase 0.003
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase 0.003
TIGR01292299 TIGR01292, TRX_reduct, thioredoxin-disulfide reduc 0.003
TIGR01813439 TIGR01813, flavo_cyto_c, flavocytochrome c 0.003
PRK09077536 PRK09077, PRK09077, L-aspartate oxidase; Provision 0.003
PRK07608388 PRK07608, PRK07608, ubiquinone biosynthesis hydrox 0.003
pfam01946229 pfam01946, Thi4, Thi4 family 0.004
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 0.004
PRK06847375 PRK06847, PRK06847, hypothetical protein; Provisio 0.004
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information 
 Score =  287 bits (735), Expect = 2e-91
 Identities = 141/452 (31%), Positives = 212/452 (46%), Gaps = 58/452 (12%)

Query: 105 SMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALN 164
            M YDVVIVGAGPAG SAA RL +        L V V+EKG+E GA    G    PRAL 
Sbjct: 1   MMEYDVVIVGAGPAGSSAARRLAKA------GLDVLVLEKGSEPGAKPCCGGGLSPRALE 54

Query: 165 ELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLGGKAEE 224
           EL+P + +E   I   V+  + +F  +  A  +P        Y++  ++  +WL  +AEE
Sbjct: 55  ELIPDFDEE---IERKVTGARIYFPGEKVAIEVP----VGEGYIVDRAKFDKWLAERAEE 107

Query: 225 LGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAEGCR 284
            G E+YPG   + ++ + D  V+G+   D                 E+R ++ + A+G  
Sbjct: 108 AGAELYPGTRVTGVIREDDGVVVGVRAGDD----------------EVRAKVVIDADGVN 151

Query: 285 GSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGS 344
            +L+ KL    K R+      + YA+G+KEV E+ +     G++   L  PLD    G  
Sbjct: 152 SALARKL--GLKDRKP-----EDYAIGVKEVIEVPD----DGDVEEFLYGPLDVGPGGYG 200

Query: 345 FLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEG 404
           +++ + D    +G+ V L+  +      E  ++FK HPAI+ LL GG +++Y A  + EG
Sbjct: 201 WIFPLGDGHANVGIGVLLDDPSLSP-FLELLERFKEHPAIRKLLLGGKILEYAAGGIPEG 259

Query: 405 GLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGF-GVLHEDSNMEIYW 463
           G  S P  V  G  ++G AAGF+N    +G   A+KSG LAAEA    +   +  +  Y 
Sbjct: 260 GPASRPL-VGDGVLLVGDAAGFVNPLTGEGIRYAIKSGKLAAEAIAEALEGGEEALAEYE 318

Query: 464 DTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDA 523
             L+KS   ++L+  R         L   L    L   +        +K           
Sbjct: 319 RLLRKSLAREDLKSLRL-LKLLLRLLDRTLPA--LIKLLADKDLLGLIKKY--------- 366

Query: 524 ARLHSPIEYPKPDGVLS-FDVPTSLHRSNTNH 554
             L   I YP   GVL+ FD+  S+ RS T  
Sbjct: 367 --LRKLILYPLLKGVLARFDLLKSVKRSLTAL 396

Length = 396
>gnl|CDD|218485 pfam05187, ETF_QO, Electron transfer flavoprotein-ubiquinone oxidoreductase Back     alignment and domain information
>gnl|CDD|182194 PRK10015, PRK10015, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|182273 PRK10157, PRK10157, putative oxidoreductase FixC; Provisional Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|232901 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|218770 pfam05834, Lycopene_cycl, Lycopene cyclase protein Back     alignment and domain information
>gnl|CDD|188533 TIGR04018, Bthiol_YpdA, putative bacillithiol system oxidoreductase, YpdA family Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|236106 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235689 PRK06069, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|225307 COG2509, COG2509, Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178267 PLN02661, PLN02661, Putative thiazole synthesis Back     alignment and domain information
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|222141 pfam13454, NAD_binding_9, FAD-NAD(P)-binding Back     alignment and domain information
>gnl|CDD|213540 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|222355 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase Back     alignment and domain information
>gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|215314 PLN02576, PLN02576, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|237942 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233345 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|233583 TIGR01813, flavo_cyto_c, flavocytochrome c Back     alignment and domain information
>gnl|CDD|236374 PRK09077, PRK09077, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181057 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>gnl|CDD|145231 pfam01946, Thi4, Thi4 family Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 592
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 100.0
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 100.0
PRK10015429 oxidoreductase; Provisional 100.0
PF05187110 ETF_QO: Electron transfer flavoprotein-ubiquinone 100.0
PRK10157428 putative oxidoreductase FixC; Provisional 100.0
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 100.0
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 100.0
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 100.0
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.97
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.97
PRK07045388 putative monooxygenase; Reviewed 99.97
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.97
PRK08013400 oxidoreductase; Provisional 99.97
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.97
PRK06753373 hypothetical protein; Provisional 99.97
PRK07538413 hypothetical protein; Provisional 99.97
PRK08244493 hypothetical protein; Provisional 99.97
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 99.97
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.97
PRK08163396 salicylate hydroxylase; Provisional 99.97
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.97
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.96
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.96
PRK06185407 hypothetical protein; Provisional 99.96
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.96
PRK06847375 hypothetical protein; Provisional 99.96
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 99.96
PRK07588391 hypothetical protein; Provisional 99.96
PRK09126392 hypothetical protein; Provisional 99.96
PRK08132547 FAD-dependent oxidoreductase; Provisional 99.96
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 99.96
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 99.96
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 99.96
PRK05868372 hypothetical protein; Validated 99.96
PRK08294 634 phenol 2-monooxygenase; Provisional 99.96
PRK06184502 hypothetical protein; Provisional 99.96
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 99.96
PRK06996398 hypothetical protein; Provisional 99.96
PLN02985514 squalene monooxygenase 99.96
PRK06475400 salicylate hydroxylase; Provisional 99.96
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.96
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.96
PRK07190487 hypothetical protein; Provisional 99.96
PRK06834488 hypothetical protein; Provisional 99.96
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.95
PTZ00367567 squalene epoxidase; Provisional 99.95
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.95
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 99.95
PRK07236386 hypothetical protein; Provisional 99.95
PRK06126545 hypothetical protein; Provisional 99.95
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.95
PRK11445351 putative oxidoreductase; Provisional 99.94
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 99.93
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 99.92
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.92
PLN02697529 lycopene epsilon cyclase 99.91
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 99.89
PLN02463447 lycopene beta cyclase 99.88
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 99.86
KOG1298509 consensus Squalene monooxygenase [Lipid transport 99.85
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 99.79
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.78
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 99.72
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.71
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.7
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.66
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.64
PLN02661357 Putative thiazole synthesis 99.53
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.53
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.51
COG2081408 Predicted flavoproteins [General function predicti 99.5
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.48
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.43
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.43
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.4
COG0579429 Predicted dehydrogenase [General function predicti 99.4
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.4
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.4
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.39
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.38
PLN02464627 glycerol-3-phosphate dehydrogenase 99.36
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 99.35
PRK11728393 hydroxyglutarate oxidase; Provisional 99.35
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.35
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.34
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.33
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.33
PRK08274466 tricarballylate dehydrogenase; Validated 99.32
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.31
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.31
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 99.3
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.3
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.29
PRK08275554 putative oxidoreductase; Provisional 99.29
PRK07121492 hypothetical protein; Validated 99.29
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 99.29
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.28
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 99.28
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 99.28
PRK07804541 L-aspartate oxidase; Provisional 99.28
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 99.27
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.27
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.27
PTZ00058561 glutathione reductase; Provisional 99.26
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.26
PLN02546558 glutathione reductase 99.26
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 99.25
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 99.24
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.24
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.23
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.22
PF01134392 GIDA: Glucose inhibited division protein A; InterP 99.21
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.21
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 99.21
PRK06175433 L-aspartate oxidase; Provisional 99.2
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.2
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 99.19
PRK12839572 hypothetical protein; Provisional 99.19
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 99.19
PRK06116450 glutathione reductase; Validated 99.18
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.18
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.18
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.18
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.18
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.18
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.17
PRK09231582 fumarate reductase flavoprotein subunit; Validated 99.17
PLN02815594 L-aspartate oxidase 99.17
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.17
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.16
PRK06370463 mercuric reductase; Validated 99.16
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 99.16
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.16
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.16
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 99.15
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.14
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.14
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.13
PRK05257494 malate:quinone oxidoreductase; Validated 99.13
PF08491276 SE: Squalene epoxidase; InterPro: IPR013698 This d 99.12
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.12
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.12
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 99.12
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.12
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 99.11
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.11
PRK14727479 putative mercuric reductase; Provisional 99.11
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.11
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 99.1
PRK07395553 L-aspartate oxidase; Provisional 99.1
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.1
PRK08401466 L-aspartate oxidase; Provisional 99.1
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.1
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 99.1
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.1
PRK09077536 L-aspartate oxidase; Provisional 99.09
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.09
PLN02507499 glutathione reductase 99.09
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 99.09
PRK14694468 putative mercuric reductase; Provisional 99.08
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 99.08
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.08
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 99.07
PRK12842574 putative succinate dehydrogenase; Reviewed 99.07
TIGR02053463 MerA mercuric reductase. This model represents the 99.07
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.07
PRK08071510 L-aspartate oxidase; Provisional 99.06
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.06
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 99.06
PRK07233434 hypothetical protein; Provisional 99.05
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.05
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.04
PRK13748561 putative mercuric reductase; Provisional 99.03
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 99.02
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 99.02
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.02
PTZ00153659 lipoamide dehydrogenase; Provisional 99.01
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 99.01
PTZ00052499 thioredoxin reductase; Provisional 99.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.99
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.99
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.99
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.98
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.97
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.97
PRK07846451 mycothione reductase; Reviewed 98.96
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.96
PRK07512513 L-aspartate oxidase; Provisional 98.94
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.94
KOG2852380 consensus Possible oxidoreductase [General functio 98.94
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.93
KOG2853509 consensus Possible oxidoreductase [General functio 98.92
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.91
PLN02612567 phytoene desaturase 98.9
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.88
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 98.87
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.84
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.84
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.84
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.83
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.81
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.81
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.81
PLN02576496 protoporphyrinogen oxidase 98.8
PRK12416463 protoporphyrinogen oxidase; Provisional 98.8
PRK13977576 myosin-cross-reactive antigen; Provisional 98.8
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.79
PRK10262321 thioredoxin reductase; Provisional 98.79
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.79
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.77
KOG2960328 consensus Protein involved in thiamine biosynthesi 98.76
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.72
PLN02676487 polyamine oxidase 98.72
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 98.71
PRK07208479 hypothetical protein; Provisional 98.71
PLN02487569 zeta-carotene desaturase 98.66
KOG0404322 consensus Thioredoxin reductase [Posttranslational 98.66
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.66
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 98.66
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.65
PRK12831464 putative oxidoreductase; Provisional 98.64
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.64
PRK09897534 hypothetical protein; Provisional 98.63
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.63
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.62
COG1231450 Monoamine oxidase [Amino acid transport and metabo 98.6
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.57
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.57
PLN03000 881 amine oxidase 98.57
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 98.56
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.56
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.56
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.56
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.55
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.53
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 98.52
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.52
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.49
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.48
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.47
PLN02852491 ferredoxin-NADP+ reductase 98.46
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.46
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 98.45
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 98.45
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 98.42
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.42
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.42
PRK13512438 coenzyme A disulfide reductase; Provisional 98.42
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.41
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.41
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.4
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.39
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 98.38
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.38
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.37
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.37
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 98.36
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.34
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.33
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.31
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.31
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.29
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.28
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.28
PRK06116450 glutathione reductase; Validated 98.27
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.27
KOG4716503 consensus Thioredoxin reductase [Posttranslational 98.27
PRK12814652 putative NADPH-dependent glutamate synthase small 98.26
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.26
PRK06370463 mercuric reductase; Validated 98.25
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 98.25
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.25
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.23
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.22
TIGR02053463 MerA mercuric reductase. This model represents the 98.22
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.22
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.22
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.2
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.2
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.18
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.16
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 98.16
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.16
COG3573552 Predicted oxidoreductase [General function predict 98.16
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.15
PTZ00188506 adrenodoxin reductase; Provisional 98.15
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.14
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 98.13
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.13
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.13
PTZ00058561 glutathione reductase; Provisional 98.12
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 98.12
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.1
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.1
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.1
PLN02507499 glutathione reductase 98.1
PRK12771564 putative glutamate synthase (NADPH) small subunit; 98.08
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 98.06
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.06
COG4529474 Uncharacterized protein conserved in bacteria [Fun 98.06
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.06
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.06
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.04
PRK13512438 coenzyme A disulfide reductase; Provisional 98.03
PLN02785587 Protein HOTHEAD 98.03
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.03
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 98.03
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 98.02
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 98.02
PRK06567 1028 putative bifunctional glutamate synthase subunit b 98.01
COG2907447 Predicted NAD/FAD-binding protein [General functio 98.01
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.99
PRK14694468 putative mercuric reductase; Provisional 97.99
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.99
PTZ00153659 lipoamide dehydrogenase; Provisional 97.98
PLN02546558 glutathione reductase 97.98
PLN02268435 probable polyamine oxidase 97.98
PRK13984604 putative oxidoreductase; Provisional 97.97
PRK14727479 putative mercuric reductase; Provisional 97.97
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.96
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 97.96
PRK07846451 mycothione reductase; Reviewed 97.95
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.91
PRK13748561 putative mercuric reductase; Provisional 97.9
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.89
PTZ00052499 thioredoxin reductase; Provisional 97.89
PRK10262321 thioredoxin reductase; Provisional 97.89
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.89
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 97.87
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.87
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.86
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.84
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.82
PLN02568539 polyamine oxidase 97.81
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.81
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.78
COG3349485 Uncharacterized conserved protein [Function unknow 97.77
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.74
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.73
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.7
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 97.57
PLN02529738 lysine-specific histone demethylase 1 97.53
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.52
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 97.52
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.51
PLN02328808 lysine-specific histone demethylase 1 homolog 97.48
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.44
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.42
KOG03992142 consensus Glutamate synthase [Amino acid transport 97.41
PRK02106560 choline dehydrogenase; Validated 97.4
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.38
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 97.3
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.21
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 97.19
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 97.19
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 97.13
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.07
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 97.06
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.03
COG2303542 BetA Choline dehydrogenase and related flavoprotei 97.03
PLN02976 1713 amine oxidase 97.03
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.02
PRK12779944 putative bifunctional glutamate synthase subunit b 97.0
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 96.95
PRK12814652 putative NADPH-dependent glutamate synthase small 96.88
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 96.87
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.85
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.83
PRK098531019 putative selenate reductase subunit YgfK; Provisio 96.64
PRK13984604 putative oxidoreductase; Provisional 96.56
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 96.45
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 96.45
KOG1238623 consensus Glucose dehydrogenase/choline dehydrogen 96.35
KOG4716503 consensus Thioredoxin reductase [Posttranslational 96.23
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 96.23
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 96.15
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 96.12
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.11
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.01
KOG2755334 consensus Oxidoreductase [General function predict 95.85
PRK065671028 putative bifunctional glutamate synthase subunit b 95.66
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 95.63
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 95.56
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 95.45
PLN02172461 flavin-containing monooxygenase FMO GS-OX 94.98
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 94.68
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 94.6
PLN02852491 ferredoxin-NADP+ reductase 94.48
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 94.06
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 94.05
KOG1439440 consensus RAB proteins geranylgeranyltransferase c 93.96
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 93.81
COG0569225 TrkA K+ transport systems, NAD-binding component [ 92.97
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 92.76
PLN02976 1713 amine oxidase 92.68
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.4
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 91.87
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 91.69
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 91.63
COG244099 FixX Ferredoxin-like protein [Energy production an 91.51
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 91.26
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.23
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 91.03
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 90.93
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 90.8
PLN02268435 probable polyamine oxidase 90.78
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 90.16
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 89.92
PLN02568539 polyamine oxidase 89.9
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 89.81
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.56
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 89.32
KOG0404322 consensus Thioredoxin reductase [Posttranslational 89.28
KOG2403 642 consensus Succinate dehydrogenase, flavoprotein su 89.08
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 88.89
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 88.79
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 88.45
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 88.44
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 88.42
PRK06719157 precorrin-2 dehydrogenase; Validated 88.41
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 88.33
PRK05708305 2-dehydropantoate 2-reductase; Provisional 88.17
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 88.1
PRK12831464 putative oxidoreductase; Provisional 87.9
KOG4405547 consensus GDP dissociation inhibitor [Signal trans 87.76
PLN02529738 lysine-specific histone demethylase 1 87.44
PRK06718202 precorrin-2 dehydrogenase; Reviewed 87.42
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.37
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 87.06
PRK06249313 2-dehydropantoate 2-reductase; Provisional 87.01
PRK08229341 2-dehydropantoate 2-reductase; Provisional 86.68
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.67
PF0925739 BCMA-Tall_bind: BCMA, TALL-1 binding; InterPro: IP 86.52
PLN02328808 lysine-specific histone demethylase 1 homolog 86.35
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.16
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 86.01
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.0
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 85.77
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 85.74
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 85.71
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.61
PRK12921305 2-dehydropantoate 2-reductase; Provisional 85.6
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 85.46
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 85.46
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 84.97
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 84.5
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 84.47
PRK04148134 hypothetical protein; Provisional 83.84
PRK10669558 putative cation:proton antiport protein; Provision 83.71
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 83.27
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 83.24
PRK12549284 shikimate 5-dehydrogenase; Reviewed 83.07
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 82.63
PRK08306296 dipicolinate synthase subunit A; Reviewed 82.33
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 82.24
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 81.74
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 81.37
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 81.26
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 81.06
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.06
PRK06223307 malate dehydrogenase; Reviewed 80.85
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 80.79
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.72
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.45
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 80.37
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 80.31
PRK15116268 sulfur acceptor protein CsdL; Provisional 80.28
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 80.04
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-124  Score=925.99  Aligned_cols=491  Identities=65%  Similarity=1.097  Sum_probs=478.3

Q ss_pred             ccccccccccEEEECCCHHHHHHHHHHHHhhhhcCCCCcEEEEcCCCCCCCcccccCccChHHHHHhhHhhhhcCCCeee
Q 007716          100 EMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKQEEAPIRV  179 (592)
Q Consensus       100 ~~~~~~~~~DVvIVGaG~aGl~aA~~La~~~~~~~~g~~V~vlEk~~~~g~~~~~g~~i~~~~l~~ll~~~~~~~~~~~~  179 (592)
                      .|+|+..++||+|||||||||+|||+|+|++++.+..++|||+||..++|+|+++|++|+|.+++||+|+|++..+|+.+
T Consensus        69 ~~~R~~e~~Dv~IVG~GPAGLsaAIrlKQla~~~~~dlrVcvvEKaa~~GghtlSGaviep~aldEL~P~wke~~apl~t  148 (621)
T KOG2415|consen   69 NMERESEEVDVVIVGAGPAGLSAAIRLKQLAAKANKDLRVCVVEKAAEVGGHTLSGAVIEPGALDELLPDWKEDGAPLNT  148 (621)
T ss_pred             cchhhhccccEEEECCCchhHHHHHHHHHHHHhcCCceEEEEEeeccccCCceecceeeccchhhhhCcchhhcCCcccc
Confidence            46778889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccCCcEEEeecCCcccCCC--CCCCCCcEEEcHHHHHHHHHHHHHHcCCEEecCceEEEEEEcCCCcEEEEEeccCccc
Q 007716          180 PVSSDKFWFLTKDRAFSLPS--PFSNRGNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIA  257 (592)
Q Consensus       180 ~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~v~~~~l~~~L~~~a~~~Gv~i~~g~~v~~i~~~~~g~v~~V~~~d~g~~  257 (592)
                      .++.+.+++++....+.+|.  +|.|+++|+++.+.+.+||.++||+.||+|++++++.++.+++||.|.||.|+|+|+.
T Consensus       149 ~vT~d~~~fLt~~~~i~vPv~~pm~NhGNYvv~L~~~v~wLg~kAEe~GvEiyPg~aaSevly~edgsVkGiaT~D~GI~  228 (621)
T KOG2415|consen  149 PVTSDKFKFLTGKGRISVPVPSPMDNHGNYVVSLGQLVRWLGEKAEELGVEIYPGFAASEVLYDEDGSVKGIATNDVGIS  228 (621)
T ss_pred             cccccceeeeccCceeecCCCcccccCCcEEEEHHHHHHHHHHHHHhhCceeccccchhheeEcCCCcEeeEeecccccc
Confidence            99999999999988887765  8999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcccccccceEEEcCEEEEecCCCCcchHHHHHHcCCCcccccCcccceeeEEEEEeecCCCCCCCcEEEEeccCCC
Q 007716          258 KDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLD  337 (592)
Q Consensus       258 ~~G~~~~~f~~g~~i~a~~vI~A~G~~s~vr~~l~~~~~l~~~~~~~~~~~~~g~~~~~~i~~~~~~~g~~~~~~~~~~~  337 (592)
                      +||.+|++|++|++++|+.+|+|+|+|+++.+|++++|+++  ....+|+||+|++++|+++++++.+|.+.|++|||++
T Consensus       229 k~G~pKd~FerGme~hak~TifAEGc~G~Lskqi~kkf~Lr--~n~e~qtYglGlKEvWei~~~~~~pG~v~HT~GwPl~  306 (621)
T KOG2415|consen  229 KDGAPKDTFERGMEFHAKVTIFAEGCHGSLSKQIIKKFDLR--ENCEPQTYGLGLKEVWEIDPENHNPGEVAHTLGWPLD  306 (621)
T ss_pred             CCCCccccccccceecceeEEEeccccchhHHHHHHHhCcc--cCCCcceeccccceeEecChhhcCCcceeeeccCccc
Confidence            99999999999999999999999999999999999999999  5889999999999999999999999999999999999


Q ss_pred             CCCcceEEEEEcCCCeEEEEEEecccCCCCCCCcHHHHHHhhcCccccccccCCceeeecceeeecCCccccCcccCCCE
Q 007716          338 QKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGG  417 (592)
Q Consensus       338 ~~~~g~~~~~~~~~~~~~vg~~~~~~~~~~~~~~~~~~~~~~~~p~i~~~l~~~~~~~~~~~~i~~gg~~~~p~~~~~~v  417 (592)
                      .++|||+|+|+++++.+.+|+++.+||.||+++|+.|||++|+||.+++.+++++++.|++|++++||+|++|++++|+.
T Consensus       307 ~~tYGGsFlYh~~d~~VavGlVVgLdY~NP~lsP~~EFQk~K~hP~i~~vleGgk~i~YgARaLNEGGfQsiPkl~FPGG  386 (621)
T KOG2415|consen  307 NDTYGGSFLYHFNDPLVAVGLVVGLDYKNPYLSPYKEFQKMKHHPSISKVLEGGKRIAYGARALNEGGFQSIPKLVFPGG  386 (621)
T ss_pred             CCccCceeEEEcCCCeEEEEEEEEecCCCCCCCHHHHHHHhhcCcchhhhhcCcceeeehhhhhccCCcccCcccccCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEcCCCcccCCCCccchHHHHHHHHHHHHHHhhhccCC-------chHHHHHHHHHHhHHHHHHHHHHcchhhhh--hc
Q 007716          418 AIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHED-------SNMEIYWDTLQKSWVWQELQRARNYRPAFE--YG  488 (592)
Q Consensus       418 ~LiGDAA~~~~P~~g~G~~~Am~dg~~aA~~l~~~~~~~-------~~l~~Y~~~~~~~~~~~~l~~~r~~~~~~~--~g  488 (592)
                      +||||+||+||....+|.|+||+||+++||+|++++...       ..+..|++.++++|+++||+.+||+|+.|+  .|
T Consensus       387 ~liGcSaGFlNVpKIKGTHtAMKSGmlAAesif~ai~~~~~~k~~~~~~~~Ye~nlkds~V~KeLysvRNirPsf~~~lG  466 (621)
T KOG2415|consen  387 ALIGCSAGFLNVPKIKGTHTAMKSGMLAAESIFEAIKGLPQSKMAGLDPTTYEENLKDSYVWKELYSVRNIRPSFHGKLG  466 (621)
T ss_pred             eEeecccccccccccccchhhhhcchhHHHHHHHHHhcCccccccccChhhHHHhhhhhHHHHHHHHhhccCcccccccc
Confidence            999999999999999999999999999999999998552       236699999999999999999999999997  89


Q ss_pred             chHHHHHHHHHHHHccCCCCccccCCCCCcccchhhhcCCCCCCCCCCCcccccccccccccCCCCCCCCCCcEEecCCC
Q 007716          489 LLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPK  568 (592)
Q Consensus       489 ~~~~~~~~~~~~~~~~~~~p~~~~~~~~d~~~~~~~~~~~~~~y~~pd~~l~~d~~~~~~~~~~~h~~~~~~h~~~~~~~  568 (592)
                      .|.||+++++..++.+|+.||||+|++.|++.+.++++|+||+||||||+||||.+|||++|||||+|||||||+++|++
T Consensus       467 ~ygGmiySgi~~~~lkG~~PwTLkh~~~D~e~l~pa~k~~pI~YPKPDg~lSFDlltSvs~sgTnH~~dqP~HL~l~~~~  546 (621)
T KOG2415|consen  467 LYGGMIYSGIFSYVLKGKVPWTLKHGKNDHEALKPASKYKPIVYPKPDGVLSFDLLTSVSRSGTNHDEDQPAHLTLRDDD  546 (621)
T ss_pred             cccchhhhhhHHHhhcCccceeeccCCCchhhccchhhCCCcccCCCCceEEEeecchhhccCCCCCCCCCceeeecCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccCccCccCccccccCCCcCC
Q 007716          569 IPELVNLPEYAGPESRYCPARVYE  592 (592)
Q Consensus       569 ~~~~~~~~~~~~~~~~~cp~~vy~  592 (592)
                      +|+++|+++|++||+|||||||||
T Consensus       547 ip~~~nf~~y~gpE~rfCPAgVYE  570 (621)
T KOG2415|consen  547 IPVKVNFPVYKGPESRFCPAGVYE  570 (621)
T ss_pred             cchhcCcccccChhhccCCcccee
Confidence            999999999999999999999998

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF05187 ETF_QO: Electron transfer flavoprotein-ubiquinone oxidoreductase; InterPro: IPR007859 Electron-transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>COG2440 FixX Ferredoxin-like protein [Energy production and conversion] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2403 consensus Succinate dehydrogenase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF09257 BCMA-Tall_bind: BCMA, TALL-1 binding; InterPro: IPR015337 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query592
2gmh_A584 Structure Of Porcine Electron Transfer Flavoprotein 1e-155
2q7v_A325 Crystal Structure Of Deinococcus Radiodurans Thiore 4e-04
>pdb|2GMH|A Chain A, Structure Of Porcine Electron Transfer Flavoprotein- Ubiquinone Oxidoreductase In Complexed With Ubiquinone Length = 584 Back     alignment and structure 
Iteration: 1

 Score =  546 bits (1406), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 272/508 (53%), Positives = 351/508 (69%), Gaps = 18/508 (3%)
Query: 101 MCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEP 160
           M R +   DVVIVGAGPAGLSAA RLKQL  +   DL VC+VEK A +GAH +SG   +P
Sbjct: 29  MERFAEEADVVIVGAGPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACLDP 88
Query: 161 RALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPS----PFSNRGNYVISLSQLVR 216
           RA  EL P WK++ AP+  PV+ D+F  LT+     +P     P +N GNYV+ L  LV 
Sbjct: 89  RAFEELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYVVRLGHLVS 148
Query: 217 WLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRI 276
           W+G +AE LGVE+YPG+AA+EIL+  D  V GI TND+GI KDG+ K  F+RG+EL  ++
Sbjct: 149 WMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKV 208
Query: 277 TLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPL 336
           T+ AEGC G L+++L K F LR  ++ + QTY +G+KE+W IDE K  PG + HT+GWPL
Sbjct: 209 TIFAEGCHGHLAKQLYKKFDLR--ANCEPQTYGIGLKELWVIDEKKWKPGRVDHTVGWPL 266
Query: 337 DQKTYGGSFLYHMNDRQ--IALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVV 394
           D+ TYGGSFLYH+N+ +  +ALG VV L+Y NP+L+P+ EFQ++KHHP+IKP LEGG  +
Sbjct: 267 DRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGGKRI 326
Query: 395 QYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLH 454
            YGAR LNEGG QSIP   FPGG +IGC+ GF+NVPKIKGTHTAMKSG LAAE+ F  L 
Sbjct: 327 AYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLT 386
Query: 455 EDS--------NMEIYWDTLQKSWVWQELQRARNYRPAFE--YGLLPGLAICGLEHYILR 504
            ++        ++  Y D L+ SWVW+EL   RN RP+     G+  G+   G+ ++I R
Sbjct: 387 SENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIFR 446
Query: 505 GKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRL 564
           G  P+TLKH   D +    A+  +PIEYPKPDG +SFD+ +S+  S TNHEHDQPAHL L
Sbjct: 447 GMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTL 506
Query: 565 RDPKIPELVNLPEYAGPESRYCPARVYE 592
           +D  +P   NL  Y GPE R+CPA VYE
Sbjct: 507 KDDSVPVNRNLSIYDGPEQRFCPAGVYE 534
>pdb|2Q7V|A Chain A, Crystal Structure Of Deinococcus Radiodurans Thioredoxin Reductase Length = 325 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query592
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 0.0
3atr_A453 Conserved archaeal protein; saturating double bond 1e-50
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 1e-38
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 3e-35
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 2e-28
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 6e-21
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 2e-20
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 1e-18
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 6e-18
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 2e-12
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 5e-12
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 8e-11
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 2e-10
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 3e-10
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 3e-10
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 2e-09
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 5e-09
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 5e-09
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 6e-09
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 7e-09
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 8e-09
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 2e-08
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 3e-08
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 3e-08
2gqf_A401 Hypothetical protein HI0933; structural genomics, 3e-08
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 9e-08
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 1e-07
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 2e-07
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 2e-07
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 2e-07
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 2e-07
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 2e-07
4fk1_A304 Putative thioredoxin reductase; structural genomic 2e-07
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 3e-07
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 3e-07
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 3e-07
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 5e-07
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 7e-07
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 9e-07
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 1e-06
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 1e-06
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 1e-06
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 1e-06
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 2e-06
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 2e-06
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 2e-06
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 2e-06
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 2e-06
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 3e-06
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 3e-06
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 3e-06
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 3e-06
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 5e-06
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 5e-06
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 5e-06
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 5e-06
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 5e-06
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 6e-06
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 6e-06
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 7e-06
2ywl_A180 Thioredoxin reductase related protein; uncharacter 8e-06
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 8e-06
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 8e-06
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 9e-06
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 1e-05
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 1e-05
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 1e-05
3dme_A369 Conserved exported protein; structural genomics, P 1e-05
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 1e-05
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 2e-05
1ojt_A482 Surface protein; redox-active center, glycolysis, 2e-05
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 2e-05
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 2e-05
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 2e-05
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 2e-05
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 2e-05
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 2e-05
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 3e-05
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 3e-05
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 5e-05
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 5e-05
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 5e-05
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 6e-05
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 6e-05
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 7e-05
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 1e-04
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 1e-04
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 1e-04
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 1e-04
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 1e-04
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 2e-04
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 2e-04
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 2e-04
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 2e-04
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 3e-04
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 3e-04
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 3e-04
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 3e-04
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 5e-04
3r9u_A315 Thioredoxin reductase; structural genomics, center 7e-04
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 7e-04
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 8e-04
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 9e-04
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Length = 584 Back     alignment and structure
 Score =  747 bits (1929), Expect = 0.0
 Identities = 272/509 (53%), Positives = 349/509 (68%), Gaps = 18/509 (3%)

Query: 100 EMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFE 159
            M R +   DVVIVGAGPAGLSAA RLKQL  +   DL VC+VEK A +GAH +SG   +
Sbjct: 28  NMERFAEEADVVIVGAGPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACLD 87

Query: 160 PRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLP----SPFSNRGNYVISLSQLV 215
           PRA  EL P WK++ AP+  PV+ D+F  LT+     +P     P +N GNYV+ L  LV
Sbjct: 88  PRAFEELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYVVRLGHLV 147

Query: 216 RWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGR 275
            W+G +AE LGVE+YPG+AA+EIL+  D  V GI TND+GI KDG+ K  F+RG+EL  +
Sbjct: 148 SWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAK 207

Query: 276 ITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWP 335
           +T+ AEGC G L+++L K F LR     + QTY +G+KE+W IDE K  PG + HT+GWP
Sbjct: 208 VTIFAEGCHGHLAKQLYKKFDLRANC--EPQTYGIGLKELWVIDEKKWKPGRVDHTVGWP 265

Query: 336 LDQKTYGGSFLYHMNDRQ--IALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTV 393
           LD+ TYGGSFLYH+N+ +  +ALG VV L+Y NP+L+P+ EFQ++KHHP+IKP LEGG  
Sbjct: 266 LDRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGGKR 325

Query: 394 VQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVL 453
           + YGAR LNEGG QSIP   FPGG +IGC+ GF+NVPKIKGTHTAMKSG LAAE+ F  L
Sbjct: 326 IAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQL 385

Query: 454 HEDS--------NMEIYWDTLQKSWVWQELQRARNYRPAFE--YGLLPGLAICGLEHYIL 503
             ++        ++  Y D L+ SWVW+EL   RN RP+     G+  G+   G+ ++I 
Sbjct: 386 TSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIF 445

Query: 504 RGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLR 563
           RG  P+TLKH   D +    A+  +PIEYPKPDG +SFD+ +S+  S TNHEHDQPAHL 
Sbjct: 446 RGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLT 505

Query: 564 LRDPKIPELVNLPEYAGPESRYCPARVYE 592
           L+D  +P   NL  Y GPE R+CPA VYE
Sbjct: 506 LKDDSVPVNRNLSIYDGPEQRFCPAGVYE 534
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 662 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Length = 180 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Length = 643 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Length = 310 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Length = 323 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Length = 549 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Length = 602 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Length = 315 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Length = 311 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query592
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 100.0
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 100.0
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 100.0
3atr_A453 Conserved archaeal protein; saturating double bond 99.98
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.97
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.97
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.97
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.96
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.96
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.96
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 99.96
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.96
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.96
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.96
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 99.96
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.96
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 99.96
4hb9_A412 Similarities with probable monooxygenase; flavin, 99.96
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.95
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.95
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 99.94
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 99.94
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 99.93
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.92
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.92
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.91
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.91
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 99.86
2bry_A497 NEDD9 interacting protein with calponin homology a 99.73
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.7
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.66
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.65
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.65
3dme_A369 Conserved exported protein; structural genomics, P 99.62
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.62
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.56
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.56
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.55
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.54
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.52
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.51
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.48
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.47
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.46
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.46
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.44
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.44
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.43
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.43
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.42
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.41
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.41
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.4
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.39
2cul_A232 Glucose-inhibited division protein A-related PROT 99.37
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 99.36
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.34
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.33
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.33
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.33
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 99.31
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.31
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.31
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.3
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 99.3
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.3
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 99.3
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.29
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.28
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.26
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.26
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.26
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.25
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.25
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.25
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.25
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.24
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.21
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.21
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.21
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.2
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.2
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.19
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.19
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.19
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 99.18
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 99.18
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.18
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.18
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.18
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.17
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.16
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.16
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.15
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 99.15
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.14
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.13
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.13
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.12
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.12
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.12
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.11
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.11
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.11
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.1
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.1
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.09
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.08
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.08
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.08
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.06
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.06
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.05
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.05
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.05
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.04
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.03
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.02
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.0
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.99
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.98
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.98
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.98
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.97
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.97
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.97
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.97
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.96
4dna_A463 Probable glutathione reductase; structural genomic 98.96
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.95
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.95
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.94
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.93
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.93
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.93
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.91
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.91
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.9
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.89
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.88
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.88
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.87
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.87
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.85
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.85
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.82
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.78
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.77
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.73
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.73
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.69
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.68
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.67
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.66
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 98.65
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.65
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.64
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.63
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.63
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.61
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.61
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.6
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.6
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.6
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.59
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 98.59
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.58
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.58
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.57
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 98.57
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.56
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.56
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.56
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.55
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.55
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.54
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.54
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.52
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.5
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.49
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.48
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.47
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.47
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.47
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.46
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.44
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.43
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.41
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.41
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.39
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.38
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.37
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.35
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.35
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.34
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.34
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.33
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 98.32
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.32
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.32
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.31
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.3
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.3
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.29
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.28
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.25
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.25
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.25
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 98.25
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.23
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.23
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.22
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.21
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.2
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.19
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.19
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.18
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 98.18
4dna_A463 Probable glutathione reductase; structural genomic 98.18
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.18
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.18
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.17
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.17
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.16
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.15
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.14
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.13
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.13
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.12
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.12
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 98.12
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.1
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.09
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.08
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.07
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 98.07
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.07
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.06
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.05
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 98.04
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.02
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.02
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.01
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 98.01
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.01
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.0
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.98
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.97
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.96
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.94
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.88
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.87
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.87
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.84
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.83
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.8
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.79
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.78
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.78
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.77
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.75
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.75
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.7
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.69
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.68
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.64
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.64
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.61
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.61
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.55
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.49
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.49
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.47
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.47
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.44
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 97.43
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.32
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.26
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.19
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.18
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.11
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.1
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 97.03
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 97.0
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.0
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.96
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 96.95
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 96.85
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 96.72
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.71
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.66
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.6
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.57
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 96.54
4fk1_A304 Putative thioredoxin reductase; structural genomic 96.44
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 96.26
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 96.2
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 95.47
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.63
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.31
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 94.12
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 94.05
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 93.83
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.61
1lss_A140 TRK system potassium uptake protein TRKA homolog; 93.28
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 93.16
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 92.87
1vg0_A650 RAB proteins geranylgeranyltransferase component A 92.46
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 91.38
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 91.16
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 90.58
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 90.17
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 90.01
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 89.75
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 89.71
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 89.62
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 89.55
4g65_A461 TRK system potassium uptake protein TRKA; structur 89.07
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 88.89
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 88.79
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 88.77
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 88.71
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 88.66
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 88.65
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 88.63
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 88.62
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 88.51
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 88.48
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 88.05
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 87.97
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 87.9
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 87.84
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 87.59
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 87.58
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 87.54
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 87.51
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 87.48
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 87.37
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 87.0
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.79
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 86.7
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 86.66
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 86.59
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 86.43
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 86.39
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 86.3
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 86.23
3c85_A183 Putative glutathione-regulated potassium-efflux S 86.18
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 86.15
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 85.91
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 85.67
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 85.66
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 85.55
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 85.46
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 85.13
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 85.05
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 85.05
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 84.98
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 84.95
3qha_A296 Putative oxidoreductase; seattle structural genomi 84.83
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 84.47
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 84.46
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 84.4
3l6d_A306 Putative oxidoreductase; structural genomics, prot 83.97
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 83.91
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 83.57
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 83.46
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 83.24
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 83.15
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 83.04
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 82.94
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 82.85
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 82.81
1vpd_A299 Tartronate semialdehyde reductase; structural geno 82.46
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 82.35
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 82.32
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 82.29
4ezb_A317 Uncharacterized conserved protein; structural geno 81.85
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 81.73
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 81.47
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 81.39
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 81.35
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 81.35
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 81.23
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 81.23
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 81.14
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 81.13
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 81.09
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 81.07
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 80.95
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 80.87
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 80.79
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 80.47
3tl2_A315 Malate dehydrogenase; center for structural genomi 80.43
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 80.24
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 80.23
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 80.23
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 80.22
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 80.2
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 80.08
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
Probab=100.00  E-value=3.1e-81  Score=697.13  Aligned_cols=490  Identities=56%  Similarity=1.009  Sum_probs=438.3

Q ss_pred             cccccccccEEEECCCHHHHHHHHHHHHhhhhcCCCCcEEEEcCCCCCCCcccccCccChHHHHHhhHhhhhcCCCeeee
Q 007716          101 MCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKQEEAPIRVP  180 (592)
Q Consensus       101 ~~~~~~~~DVvIVGaG~aGl~aA~~La~~~~~~~~g~~V~vlEk~~~~g~~~~~g~~i~~~~l~~ll~~~~~~~~~~~~~  180 (592)
                      |+++.|++||||||||||||++|+.|++.+.+.++|++|+||||.+.+|++..+|+++.+++++++++.|...+.++...
T Consensus        29 ~~~~~~~~DVvIVGaG~aGlaaA~~La~~~~~~~~G~~V~vlEk~~~~g~~~~~g~~l~~~~l~~ll~~~~~~g~~~~~~  108 (584)
T 2gmh_A           29 MERFAEEADVVIVGAGPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACLDPRAFEELFPDWKEKGAPLNTP  108 (584)
T ss_dssp             CCCCEEECSEEEECCSHHHHHHHHHHHHHHHHTTCCCCEEEECSSSSTTTTCCCCCEECTHHHHHHCTTHHHHTCCCCEE
T ss_pred             ccccccCCCEEEECcCHHHHHHHHHHHhcccccCCCCcEEEEeCCCCCCCccccccccCHHHHHHHHHHHHhcCCceeee
Confidence            45567889999999999999999999997666667999999999998888888899999999999999998777777665


Q ss_pred             ccCCcEEEeecCCcccCC---C-CCCCCCcEEEcHHHHHHHHHHHHHHcCCEEecCceEEEEEEcCCCcEEEEEeccCcc
Q 007716          181 VSSDKFWFLTKDRAFSLP---S-PFSNRGNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGI  256 (592)
Q Consensus       181 ~~~~~~~~~~~~~~~~~~---~-~~~~~~~~~v~~~~l~~~L~~~a~~~Gv~i~~g~~v~~i~~~~~g~v~~V~~~d~g~  256 (592)
                      +..+.+.++.....+.++   . .+.+.+.|++++..|.++|.+++++.||+|+++++|+++..++++.|++|++.++|+
T Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~r~~l~~~L~~~a~~~Gv~i~~g~~v~~l~~~~~g~V~gV~~~~~g~  188 (584)
T 2gmh_A          109 VTEDRFGILTEKYRIPVPILPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGI  188 (584)
T ss_dssp             CCEEEEEEECSSCEEECCCCTTSTTCCTTCEECCHHHHHHHHHHHHHHTTCEEETTCCEEEEEECTTSSEEEEEECCEEE
T ss_pred             echhheeeeccCCCccccccCccccccCCCEEEeHHHHHHHHHHHHHHcCCEEEcCCEEEEEEEcCCCCEEEEEeCCccc
Confidence            555566666554444443   2 244556899999999999999999999999999999999998777888899998888


Q ss_pred             cCCCCcccccccceEEEcCEEEEecCCCCcchHHHHHHcCCCcccccCcccceeeEEEEEeecCCCCCCCcEEEEeccCC
Q 007716          257 AKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPL  336 (592)
Q Consensus       257 ~~~G~~~~~f~~g~~i~a~~vI~A~G~~s~vr~~l~~~~~l~~~~~~~~~~~~~g~~~~~~i~~~~~~~g~~~~~~~~~~  336 (592)
                      +++|+++.+|++|.+++||+||+|||++|.+++++.+.+++..  ...++.+++|++++|.++.....++.+.|+++||+
T Consensus       189 ~~~G~~~~~~~~g~~i~Ad~VV~AdG~~S~vr~~l~~~~gl~~--~~~p~~~g~g~~~~~~v~~~~~~~~~~~~~~g~~~  266 (584)
T 2gmh_A          189 QKDGAPKTTFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRA--NCEPQTYGIGLKELWVIDEKKWKPGRVDHTVGWPL  266 (584)
T ss_dssp             CTTSCEEEEEECCCEEECSEEEECCCTTCHHHHHHHHHTTTTT--TSCCCCEEEEEEEEEECCGGGCCTTEEEEEEETTS
T ss_pred             cCCCCcccccCCceEEECCEEEEeeCCCchHHHHHHHHhCCCC--CCCchhHHhhhhhheecCcccccCCeEEEEEeccc
Confidence            8999999999999999999999999999999999999998873  45677889999999988776667888899999998


Q ss_pred             CCCCcceEEEEEcC--CCeEEEEEEecccCCCCCCCcHHHHHHhhcCccccccccCCceeeecceeeecCCccccCcccC
Q 007716          337 DQKTYGGSFLYHMN--DRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVF  414 (592)
Q Consensus       337 ~~~~~g~~~~~~~~--~~~~~vg~~~~~~~~~~~~~~~~~~~~~~~~p~i~~~l~~~~~~~~~~~~i~~gg~~~~p~~~~  414 (592)
                      ....+++.|+|+..  ++.++++++...++.++..++.+++++|+.+|.+.+++++++.+.++.+.++.+++..+++|..
T Consensus       267 ~~~~~gg~~~~~~~~~~~~~~vg~~~~~~~~~~~~~~~~~l~~~~~~p~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  346 (584)
T 2gmh_A          267 DRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGGKRIAYGARALNEGGFQSIPKLTF  346 (584)
T ss_dssp             CTTSCEEEEEEECCSSSCEEEEEEEEETTCCCTTCCHHHHHHHHTTSTTTHHHHTTCEEEEEEEEEEECCGGGGCCCCEE
T ss_pred             cCCcCCceEEEEecCCCCeEEEEEEEecCcccccCChHHHHHHHHhChHHHHHhCCCeEEEecceEccCCCcccCCcccc
Confidence            76677889999998  7899999998887766667788899999889999999988888888888888888888899999


Q ss_pred             CCEEEEcCCCcccCCCCccchHHHHHHHHHHHHHHhhhccC-----Cch---HHHHHHHHHHhHHHHHHHHHHcchhhhh
Q 007716          415 PGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHE-----DSN---MEIYWDTLQKSWVWQELQRARNYRPAFE  486 (592)
Q Consensus       415 ~~v~LiGDAA~~~~P~~g~G~~~Am~dg~~aA~~l~~~~~~-----~~~---l~~Y~~~~~~~~~~~~l~~~r~~~~~~~  486 (592)
                      +|++|||||||+++|+.|||+++||+||++||++|.+++..     ..+   |+.|+++++++|+.++++.+|+++++|+
T Consensus       347 ~rv~LvGDAAh~~~P~~GqG~~~Ai~da~~LA~~L~~~~~~g~~~~~~a~~~L~~Ye~~r~~~~v~~~l~~~r~~~~~~~  426 (584)
T 2gmh_A          347 PGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCH  426 (584)
T ss_dssp             TTEEECTTTTCCCBTTTTBCHHHHHHHHHHHHHHHHHHHTCCCCCCSSSSCCCTHHHHHHHTSHHHHHHHHTTTTTGGGG
T ss_pred             CCEEEEcccccccCccccccHHHHHHHHHHHHHHHHHHHHcCCcchhhhhhhHHHHHHHHHHhHHHHHHHHHhChhHHHH
Confidence            99999999999999999999999999999999999987642     233   8999999999999999999999999986


Q ss_pred             -h-cchHHHHHHHHHHHHccCCCCccccCCCCCcccchhhhcCCCCCCCCCCCcccccccccccccCCCCCCCCCCcEEe
Q 007716          487 -Y-GLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRL  564 (592)
Q Consensus       487 -~-g~~~~~~~~~~~~~~~~~~~p~~~~~~~~d~~~~~~~~~~~~~~y~~pd~~l~~d~~~~~~~~~~~h~~~~~~h~~~  564 (592)
                       + |+|++++..+++.|+.+|+.||+++|.++|+..+++++++++|+||||||+||||+++|||+|||+|+|||||||+|
T Consensus       427 ~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~hl~~  506 (584)
T 2gmh_A          427 GILGVYGGMIYTGIFYWIFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTL  506 (584)
T ss_dssp             STTTHHHHHHHHHHHTTTTTTCCSCCCCCCSCGGGCCCCGGGSCCCCCCCCCSSSSCCHHHHHHTTTCBCCSSSCCSEEE
T ss_pred             HhhccHHHHHHHHHHHHHcCCCCCCccCCCCCCchhhhhHHhcCCCCCCCccccccccccchhhhccccccCCCCCeEEE
Confidence             4 99999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCccccCccCccCccccccCCCcCC
Q 007716          565 RDPKIPELVNLPEYAGPESRYCPARVYE  592 (592)
Q Consensus       565 ~~~~~~~~~~~~~~~~~~~~~cp~~vy~  592 (592)
                      +|+++|.+.|++.|.+||+|||||||||
T Consensus       507 ~d~~~~~~~~~~~~~~~c~~~CPa~~~~  534 (584)
T 2gmh_A          507 KDDSVPVNRNLSIYDGPEQRFCPAGVYE  534 (584)
T ss_dssp             SSTTHHHHTHHHHHCCTHHHHCTTCCEE
T ss_pred             cCcccchhhchhhhcchhhhcCChhhEE
Confidence            9999999999999999999999999996
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 592
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 1e-51
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 5e-48
d2gmha299 d.16.1.8 (A:237-335) Electron transfer flavoprotei 7e-42
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 5e-24
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 7e-21
d2gmha3102 d.58.1.6 (A:483-584) Electron transfer flavoprotei 2e-17
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 7e-16
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 8e-13
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 2e-12
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 4e-11
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 1e-09
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 5e-09
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 6e-09
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 7e-09
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 9e-09
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 1e-08
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 1e-08
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 2e-08
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 2e-08
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 3e-08
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 3e-08
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 3e-08
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 3e-08
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 4e-08
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 6e-08
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 7e-08
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 7e-08
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 7e-08
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 9e-08
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 1e-07
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 1e-07
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 2e-07
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 2e-07
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 2e-07
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 2e-07
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 2e-07
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 3e-07
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 3e-07
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 4e-07
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 4e-07
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 4e-07
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 9e-07
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 1e-06
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 1e-06
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 3e-06
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 6e-06
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 6e-06
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 8e-06
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 8e-06
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 1e-05
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 1e-05
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 1e-05
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 2e-05
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 2e-05
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 2e-05
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 2e-05
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 4e-05
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 4e-05
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 6e-05
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 9e-05
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 4e-04
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 4e-04
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 5e-04
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 8e-04
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 0.001
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 0.002
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 0.002
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 0.003
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  179 bits (455), Expect = 1e-51
 Identities = 107/215 (49%), Positives = 140/215 (65%), Gaps = 4/215 (1%)

Query: 100 EMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFE 159
            M R +   DVVIVGAGPAGLSAA RLKQL  +   DL VC+VEK A +GAH +SG   +
Sbjct: 25  NMERFAEEADVVIVGAGPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACLD 84

Query: 160 PRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSP----FSNRGNYVISLSQLV 215
           PRA  EL P WK++ AP+  PV+ D+F  LT+     +P       +N GNYV+ L  LV
Sbjct: 85  PRAFEELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYVVRLGHLV 144

Query: 216 RWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGR 275
            W+G +AE LGVE+YPG+AA+EIL+  D  V GI TND+GI KDG+ K  F+RG+EL  +
Sbjct: 145 SWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAK 204

Query: 276 ITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYAL 310
           +T+ AEGC G L+++L K F LR     Q    ++
Sbjct: 205 VTIFAEGCHGHLAKQLYKKFDLRANCEPQGGFQSI 239
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d2gmha2 d.16.1.8 (A:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 99 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 102 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query592
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 100.0
d2gmha3102 Electron transfer flavoprotein-ubiquinone oxidored 99.89
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.86
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 99.84
d2gmha299 Electron transfer flavoprotein-ubiquinone oxidored 99.8
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.79
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.7
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.68
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.67
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.63
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.62
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.61
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.57
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.56
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.56
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.49
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.45
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.4
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 99.38
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.37
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.35
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.34
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.28
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.27
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.26
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.23
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.2
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.19
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.18
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.17
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.16
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.16
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.14
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.13
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.12
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.11
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.09
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.09
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.08
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.06
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 99.06
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.06
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.05
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.05
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.04
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.03
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.03
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.03
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.02
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.01
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.01
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.0
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.0
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.99
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.98
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.95
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.93
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.92
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.91
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.88
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.86
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.83
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.83
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.81
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.79
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.7
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.64
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.63
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.61
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.58
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.54
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.54
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.54
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.52
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.51
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.49
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.49
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.49
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.46
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.35
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 98.35
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.34
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.31
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.28
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.21
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.2
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.2
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.05
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.02
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.9
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.86
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.86
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.7
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.61
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.55
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.48
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 96.1
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.87
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.63
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.63
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.45
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.23
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.23
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.73
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.21
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.13
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.35
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.13
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.83
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 92.41
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 92.21
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 92.16
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.12
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 91.82
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.55
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.54
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 91.5
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 91.38
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 91.32
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 90.93
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 90.92
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.6
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.26
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 89.97
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.77
d1id1a_153 Rck domain from putative potassium channel Kch {Es 89.52
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 89.15
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 88.95
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 88.75
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 88.74
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 88.55
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 88.46
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 88.13
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 88.08
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 88.06
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 87.97
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 87.91
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 87.89
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 87.85
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 87.41
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 87.13
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 86.9
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 86.2
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 85.92
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 85.87
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 85.24
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 85.2
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 85.18
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 84.68
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 83.96
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 83.96
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 83.85
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 83.39
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 82.72
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 82.59
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 82.57
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 82.27
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 81.28
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 81.16
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 80.69
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=6.4e-52  Score=434.85  Aligned_cols=343  Identities=52%  Similarity=0.930  Sum_probs=304.2

Q ss_pred             cccccccccccEEEECCCHHHHHHHHHHHHhhhhcCCCCcEEEEcCCCCCCCcccccCccChHHHHHhhHhhhhcCCCee
Q 007716           99 SEMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKQEEAPIR  178 (592)
Q Consensus        99 ~~~~~~~~~~DVvIVGaG~aGl~aA~~La~~~~~~~~g~~V~vlEk~~~~g~~~~~g~~i~~~~l~~ll~~~~~~~~~~~  178 (592)
                      ..|+++.++|||||||||||||+||+.|+|+.+..+.|++|+||||+..+|.+.++|+++.++.+++++|+|.....+..
T Consensus        24 ~~m~~~~~e~DViIVGgGPAGlsaA~~LA~l~~~~~~Gl~VlllEK~~~pG~k~~~Ggvl~~~~l~~l~p~~~~~~~~~~  103 (380)
T d2gmha1          24 VNMERFAEEADVVIVGAGPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACLDPRAFEELFPDWKEKGAPLN  103 (380)
T ss_dssp             CCCCCCEEECSEEEECCSHHHHHHHHHHHHHHHHTTCCCCEEEECSSSSTTTTCCCCCEECTHHHHHHCTTHHHHTCCCC
T ss_pred             cCcccccccCCEEEECCCHHHHHHHHHHHhhhhhhcCCCEEEEEcCCCCCCCCccccccccHHHHHHHccchhhhccccc
Confidence            34677889999999999999999999999966666679999999999999999999999999999999999998888888


Q ss_pred             eeccCCcEEEeecCCcccCC----CCCCCCCcEEEcHHHHHHHHHHHHHHcCCEEecCceEEEEEEcCCCcEEEEEeccC
Q 007716          179 VPVSSDKFWFLTKDRAFSLP----SPFSNRGNYVISLSQLVRWLGGKAEELGVEIYPGFAASEILYDADNKVIGIGTNDM  254 (592)
Q Consensus       179 ~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~v~~~~l~~~L~~~a~~~Gv~i~~g~~v~~i~~~~~g~v~~V~~~d~  254 (592)
                      ..+..+.++++.......+.    ..+.+..++++.+..+++|+.+++++.|+++..++.+.++..++++.+.++.+.+.
T Consensus       104 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Ae~~g~~~~~~~~~~~~l~~~~g~~~~~~~~~~  183 (380)
T d2gmha1         104 TPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDV  183 (380)
T ss_dssp             EECCEEEEEEECSSCEEECCCCTTSTTCCTTCEECCHHHHHHHHHHHHHHTTCEEETTCCEEEEEECTTSSEEEEEECCE
T ss_pred             cceecceEEEeeccccccccccCchhcccccceeehhhHHHHHHHHHHhhccceeeeecceeeeeeccCCceeecccccc
Confidence            77777788777765544332    23556679999999999999999999999999999999999998899989999999


Q ss_pred             cccCCCCcccccccceEEEcCEEEEecCCCCcchHHHHHHcCCCcccccCcccceeeEEEEEeecCCCCCCCcEEEEecc
Q 007716          255 GIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGW  334 (592)
Q Consensus       255 g~~~~G~~~~~f~~g~~i~a~~vI~A~G~~s~vr~~l~~~~~l~~~~~~~~~~~~~g~~~~~~i~~~~~~~g~~~~~~~~  334 (592)
                      +.++++..+..+.++....++++|+++|+++.+.++++..+.+..  .                                
T Consensus       184 ~~~~~~~~~~~~~~~~~~~~~~~v~~~G~~G~l~k~li~~~~l~~--~--------------------------------  229 (380)
T d2gmha1         184 GIQKDGAPKTTFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRA--N--------------------------------  229 (380)
T ss_dssp             EECTTSCEEEEEECCCEEECSEEEECCCTTCHHHHHHHHHTTTTT--T--------------------------------
T ss_pred             cccccccccccccccccccccEEEEeeeCCCcchHHHHhhhhhcc--c--------------------------------
Confidence            999999999999999999999999999999999988876554431  0                                


Q ss_pred             CCCCCCcceEEEEEcCCCeEEEEEEecccCCCCCCCcHHHHHHhhcCccccccccCCceeeecceeeecCCccccCcccC
Q 007716          335 PLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVF  414 (592)
Q Consensus       335 ~~~~~~~g~~~~~~~~~~~~~vg~~~~~~~~~~~~~~~~~~~~~~~~p~i~~~l~~~~~~~~~~~~i~~gg~~~~p~~~~  414 (592)
                                                                                       .++.+|++++|++.+
T Consensus       230 -----------------------------------------------------------------~~~~~G~~sip~l~~  244 (380)
T d2gmha1         230 -----------------------------------------------------------------CEPQGGFQSIPKLTF  244 (380)
T ss_dssp             -----------------------------------------------------------------SCCCCGGGGCCCCEE
T ss_pred             -----------------------------------------------------------------ccccccccccccccc
Confidence                                                                             011235566788889


Q ss_pred             CCEEEEcCCCcccCCCCccchHHHHHHHHHHHHHHhhhccCC--------chHHHHHHHHHHhHHHHHHHHHHcchhhhh
Q 007716          415 PGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHED--------SNMEIYWDTLQKSWVWQELQRARNYRPAFE  486 (592)
Q Consensus       415 ~~v~LiGDAA~~~~P~~g~G~~~Am~dg~~aA~~l~~~~~~~--------~~l~~Y~~~~~~~~~~~~l~~~r~~~~~~~  486 (592)
                      +|++||||||+++||++|+|+++||.+|++||+++.+++..+        .-+..|++.++++|+++||+.+||+++.|+
T Consensus       245 ~G~lLVGDAAG~vnP~~g~GI~~Am~SG~lAAeai~~al~~~~~~~~~~~~~~~~y~~~~~~s~~~~eL~~~rn~~~~~~  324 (380)
T d2gmha1         245 PGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCH  324 (380)
T ss_dssp             TTEEECTTTTCCCBTTTTBCHHHHHHHHHHHHHHHHHHHTCCCCCCSSSSCCCTHHHHHHHTSHHHHHHHHTTTTTGGGG
T ss_pred             CCeeEEeccccccchhhcCCeeeeeccHHHHHHHHHHHHHcCCcccchhhhhhhhHHHHHHhhHHHHHHHHhhCCCHHHH
Confidence            999999999999999999999999999999999999998652        236889999999999999999999999996


Q ss_pred             --hcchHHHHHHHHHHHHccCCCCccccCCCCCcccchhhhcCCCCCCCCCCCccc
Q 007716          487 --YGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLS  540 (592)
Q Consensus       487 --~g~~~~~~~~~~~~~~~~~~~p~~~~~~~~d~~~~~~~~~~~~~~y~~pd~~l~  540 (592)
                        +|+|.|+++.++++|+++|+.||||+|.++|+..++++++++||+||||||+||
T Consensus       325 ~~~g~~~g~~~~~~~~~~~~g~~p~tl~~~~~d~~~l~~~~~~~~i~y~~~d~~~~  380 (380)
T d2gmha1         325 GILGVYGGMIYTGIFYWIFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQIS  380 (380)
T ss_dssp             STTTHHHHHHHHHHHTTTTTTCCSCCCCCCSCGGGCCCCGGGSCCCCCCCCCSSSS
T ss_pred             hhchHHHHHHHHHHHHHHhCCCCCccCCCCCCCHHHHHHHHhCCCCCCCCCCCccC
Confidence              699999999999999999999999999999999999999999999999999997
>d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2gmha2 d.16.1.8 (A:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure