Citrus Sinensis ID: 007762


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590
MSSYEVNGVLRGQGFPHFKSLELLDMECTRIALNTSFLQIISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEITQSPSLTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHGPIPPCFDNTTLHESYSNSSSPNKQFEIFFFIQGPQGHPRLATLVMNQHSPAQGHEDLEAQH
cccccccEEcccccccccccccEEEcccccccccccccHHHHcccccccEEEcccccccccccccccHHccccccccEEEccccccEEcccHHccccccccEEEccccccccccccccccccccccEEEccccEEEEEccHHcccccccccEEEccccEEEEEcccccccccccccccEEEccccccccccccccccccccccEEEEEccccEEcccHHHHHcccccccEEccccEEEEEccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEccccEEEEEccHHHHccccccEEEcccccccccccHHHHcccccccEEcccccccccccccccccccccEEEcccccccccccccccccccccEEccccEEEEEccHHHHcccccccEEEccccccccccHHHHHccccccEEccccccccccccHHHHccccccEEEcccccccccccccHHcccHHHHHcccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccHHHccccccEEEEEccccccccccccHHHHHHcccccEEEcccccccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHcccccccEEEEccccccccccHHHHcccccccEEEEccccccccccccccHHccccccEEEEEccccccccccHHHHcccccccEEEEccccccccccHHHHHccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHHHHHHcccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccEEEEcccccccccccHHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccHHHHHHHccccccccccccccHHHHccccccccccccccccccccccccccc
mssyevngvlrgqgfphfkslellDMECTRIALNTSFLQIISEsmpslkylslsdstlgtnsskildrglCSLVHLQELYIynndlrgslpwcmaNMTSLRILYVSsnqltgsisssplvhltsieelhlsnnhfqipisleplfnhsrlkVFWAKNNEinaeitqspsltapnfqlsrlslssgygdgvifpkflyhqhdleyvdlshmkmngefptwllenntnleSLFLVndslagpfrlpihshkrlrlldisnnnfrghipveigdvlpgLFSLNISmnaldgsipssfgnmkFLQLLDVtnnqltgeipehlavGCVNLEYLALsnnsleghmfsrnfnltnlkwlqlegnhfvgeipqslskCFVLEglflnnnslsgmiprWLGNLTRLQhimmpknhlegpipvefcqldwlqildisdnnisgslpscfhplsiehVHLSKnmlhgqlkrgtffnyHSLVTLDLsynrlngsisdWVDGLSQLSHLILghnnlegevpVQLCklnqlqlldlsnnnlhgpippcfdnttlhesysnssspnkqFEIFFfiqgpqghprLATLVmnqhspaqghedleaqh
mssyevngvlrgqgfphFKSLELLDMECTRIALNTSFLQIISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEitqspsltapNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHGPIPPCFDNTTLHESYSNSSSPNKQFEIFFFIQGPQGHPRLATLVMNQHSPaqghedleaqh
MSSYEVNGVLRGQGFPHFKSLELLDMECTRIALNTSFLQIISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEITQSPSLTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVqlcklnqlqlldlsnnnlHGPIPPCFDNTTLHESYSNSSSPNKQFEIFFFIQGPQGHPRLATLVMNQHSPAQGHEDLEAQH
******NGVLRGQGFPHFKSLELLDMECTRIALNTSFLQIISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEITQ***LTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHGPIPPCFDNTTL************QFEIFFFIQGPQG***L*********************
MSSYEVNGVLRGQGFPHFKSLELLDMECTRIALNTSFLQIISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEITQSPSLTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHGPIPPCFDNTTLHESYSNSSSPNKQFEIFFFIQGPQGHPRLATL******************
MSSYEVNGVLRGQGFPHFKSLELLDMECTRIALNTSFLQIISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEITQSPSLTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHGPIPPCFDNTTLH********PNKQFEIFFFIQGPQGHPRLATLVMNQHSPAQGHEDLEAQH
****EVNGVLRGQGFPHFKSLELLDMECTRIALNTSFLQIISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEITQSPSLTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHGPIPPCFDNTTLHESYSNSSSPNKQFEIFFFIQGPQGHPRLATLVMN***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSYEVNGVLRGQGFPHFKSLELLDMECTRIALNTSFLQIISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEITQSPSLTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHGPIPPCFDNTTLHESYSNSSSPNKQFEIFFFIQGPQGHPRLATLVMNQHSPAQGHEDLEAQH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query590 2.2.26 [Sep-21-2011]
Q9FL28 1173 LRR receptor-like serine/ no no 0.776 0.390 0.324 7e-46
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.772 0.364 0.323 1e-45
C0LGS2 1136 Probable LRR receptor-lik no no 0.728 0.378 0.342 2e-45
Q9M0G7 1013 Leucine-rich repeat recep no no 0.732 0.426 0.322 3e-45
C0LGP4 1010 Probable LRR receptor-lik no no 0.772 0.451 0.322 2e-44
C0LGQ5 1249 LRR receptor-like serine/ no no 0.754 0.356 0.336 2e-43
Q9FZ59 1088 Leucine-rich repeat recep no no 0.755 0.409 0.320 3e-43
Q9LHP4 1141 Receptor-like protein kin no no 0.8 0.413 0.312 1e-42
Q9LYN8 1192 Leucine-rich repeat recep no no 0.716 0.354 0.316 9e-42
Q42371 976 LRR receptor-like serine/ no no 0.759 0.459 0.336 4e-41
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function desciption
 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 165/509 (32%), Positives = 245/509 (48%), Gaps = 51/509 (10%)

Query: 69  GLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEEL 128
           G CS   L +L +Y+N L G +P  + N+  L+ L +  N+LT SI SS L  LT +  L
Sbjct: 261 GNCS--SLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSS-LFRLTQLTHL 317

Query: 129 HLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEITQSPS----LTAPNFQLSRLS--L 182
            LS NH   PIS E  F  S L+V    +N    E  QS +    LT      + +S  L
Sbjct: 318 GLSENHLVGPISEEIGFLES-LEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGEL 376

Query: 183 SSGYG-----------DGVI---FPKFLYHQHDLEYVDLSHMKMNGEFPTWL-------- 220
            +  G           D ++    P  + +   L+ +DLSH +M GE P           
Sbjct: 377 PADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFI 436

Query: 221 --------------LENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIP 266
                         + N +NLE+L + +++L G  +  I   ++LR+L +S N+  G IP
Sbjct: 437 SIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIP 496

Query: 267 VEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLE 326
            EIG+ L  L  L +  N   G IP    N+  LQ L + +N L G IPE +      L 
Sbjct: 497 REIGN-LKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEM-FDMKLLS 554

Query: 327 YLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGM 386
            L LSNN   G + +    L +L +L L+GN F G IP SL    +L    +++N L+G 
Sbjct: 555 VLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGT 614

Query: 387 IP-RWLGNLTRLQ-HIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLS- 443
           IP   L +L  +Q ++    N L G IP E  +L+ +Q +D+S+N  SGS+P        
Sbjct: 615 IPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKN 674

Query: 444 IEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNL 503
           +  +  S+N L G +    F     +++L+LS N  +G I      ++ L  L L  NNL
Sbjct: 675 VFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNL 734

Query: 504 EGEVPVQLCKLNQLQLLDLSNNNLHGPIP 532
            GE+P  L  L+ L+ L L++NNL G +P
Sbjct: 735 TGEIPESLANLSTLKHLKLASNNLKGHVP 763




Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Flagellin-binding to the receptor is the first step to initiate the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6), resulting in enhanced resistance against pathogens. Binding to the effector AvrPto1 from Pseudomonas syringae blocks the downstream plant immune response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query590
255581263 912 serine-threonine protein kinase, plant-t 0.871 0.563 0.529 1e-139
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.9 0.362 0.445 1e-110
224123984 1016 predicted protein [Populus trichocarpa] 0.893 0.518 0.450 1e-105
224073436 1014 predicted protein [Populus trichocarpa] 0.889 0.517 0.441 1e-104
224134891 953 predicted protein [Populus trichocarpa] 0.888 0.549 0.443 1e-104
224142481 781 predicted protein [Populus trichocarpa] 0.847 0.640 0.466 1e-102
224102049577 predicted protein [Populus trichocarpa] 0.776 0.793 0.474 3e-98
224098008 1097 predicted protein [Populus trichocarpa] 0.896 0.482 0.431 3e-98
224073382 1309 predicted protein [Populus trichocarpa] 0.791 0.356 0.458 2e-96
224073422 969 predicted protein [Populus trichocarpa] 0.849 0.517 0.437 3e-94
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  502 bits (1293), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 278/525 (52%), Positives = 363/525 (69%), Gaps = 11/525 (2%)

Query: 10  LRGQGFPHFKSLELLDMECTRIALNTSFLQIISESMPSLKYLSLSDSTLGTNSSKILDRG 69
           ++ Q  P+F++LE L ++  +I L  SFLQ +   M SLK LSLS   L      +  +G
Sbjct: 168 IQAQDLPNFENLEELYLD--KIELENSFLQTVG-VMTSLKVLSLSGCGLTGALPNV--QG 222

Query: 70  LCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEELH 129
           LC L+HL+ L + +N+  G LPWC++N+TSL++L +SSNQ  G IS+SPL  L S+ +L 
Sbjct: 223 LCELIHLRVLDVSSNEFHGILPWCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLD 282

Query: 130 LSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEITQSPSLTAPNFQLSRLSLSSGYGDG 189
           +SNNHFQ+P SL P FNHS LK    +NN I  E       +AP FQL  + + SGYG  
Sbjct: 283 VSNNHFQVPFSLGPFFNHSNLKHIRGQNNAIYLEAELH---SAPRFQLISI-IFSGYGIC 338

Query: 190 VIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLVNDSLAGPFRLPIHSHK 249
             FP FLYHQ++L++VDLSH+ + GEFP WLL NNT LE L LVN+SL+G  +LP+H H 
Sbjct: 339 GTFPNFLYHQNNLQFVDLSHLSLKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHV 398

Query: 250 RLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQ 309
            L  LDISNN+   HIP+EIG  LP L  LN+S N  DGSIPSSFGNM  L++LD++NNQ
Sbjct: 399 NLLALDISNNHVHDHIPLEIGTFLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQ 458

Query: 310 LTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSK 369
           L+G IPEHLA GC +L  L LSNNSL+G MFS+ FNLTNL WL+L+ NHF G IP+SLSK
Sbjct: 459 LSGSIPEHLATGCFSLNTLILSNNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSK 518

Query: 370 CFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDN 429
              L  + L++N LSGMIP W+GNL+ LQ++++  N L+GPIPVEFCQL +L++LD+++N
Sbjct: 519 S-ALSIMDLSDNHLSGMIPGWIGNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANN 577

Query: 430 NISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDG 489
           ++SG LPSC  P SI HVHLS+NM+ G      F   H LVTLDLS NR+ G I   + G
Sbjct: 578 SVSGILPSCLSPSSIIHVHLSQNMIEGPWTNA-FSGSHFLVTLDLSSNRITGRIPTLIGG 636

Query: 490 LSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHGPIPPC 534
           ++ L  L L  N  +GE+P Q+C L QL L+ L++NNL G IP C
Sbjct: 637 INALRILNLKSNRFDGEIPAQICGLYQLSLIVLADNNLSGSIPSC 681




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102049|ref|XP_002334215.1| predicted protein [Populus trichocarpa] gi|222870030|gb|EEF07161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098008|ref|XP_002334579.1| predicted protein [Populus trichocarpa] gi|222873205|gb|EEF10336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073382|ref|XP_002304087.1| predicted protein [Populus trichocarpa] gi|222841519|gb|EEE79066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073422|ref|XP_002304093.1| predicted protein [Populus trichocarpa] gi|222841525|gb|EEE79072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query590
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.884 0.481 0.372 6.2e-78
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.854 0.504 0.357 6.5e-74
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.891 0.545 0.349 2.3e-71
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.901 0.597 0.329 1.2e-67
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.798 0.518 0.363 1.8e-65
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.861 0.520 0.337 7.8e-63
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.866 0.546 0.324 1.9e-56
TAIR|locus:2139885 1013 AT4G28650 [Arabidopsis thalian 0.752 0.438 0.346 3.7e-47
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.755 0.392 0.318 2.8e-46
TAIR|locus:2047525 980 AT2G24130 [Arabidopsis thalian 0.718 0.432 0.339 3.9e-46
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 784 (281.0 bits), Expect = 6.2e-78, P = 6.2e-78
 Identities = 201/540 (37%), Positives = 292/540 (54%)

Query:    47 SLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSLRILYVS 106
             SL+ L    + L       L  G+C L+ L+EL + +N L  SLP+C+ N+T LR L +S
Sbjct:   333 SLQVLDFKRNQLSLTHEGYL--GICRLMKLRELDLSSNALT-SLPYCLGNLTHLRTLDLS 389

Query:   107 SNQLTGSISSSPLVHLTSI-EELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEINAEIT 165
             +NQL G++SS  +  L S+ E L L +N+F        L N +RL VF   ++++     
Sbjct:   390 NNQLNGNLSSF-VSGLPSVLEYLSLLDNNFDGSFLFNSLVNQTRLTVF-KLSSKVGVIQV 447

Query:   166 QSPSLTAPNFQLSRLSLSS-GYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENN 224
             Q+ S  AP FQL  L LS+   G  ++   FL HQ DL +VDLSH K+ G FPTWL++NN
Sbjct:   448 QTESSWAPLFQLKMLYLSNCSLGSTML--GFLVHQRDLCFVDLSHNKLTGTFPTWLVKNN 505

Query:   225 TNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMN 284
             T L+++ L  +SL    +LPI  H  L++LDIS+N     I  +IG V P L  +N S N
Sbjct:   506 TRLQTILLSGNSLT-KLQLPILVHG-LQVLDISSNMIYDSIQEDIGMVFPNLRFMNFSSN 563

Query:   285 ALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNF 344
                G+IPSS G MK LQ+LD+++N L G++P     GC +L  L LSNN L+G +FS++ 
Sbjct:   564 HFQGTIPSSIGEMKSLQVLDMSSNGLYGQLPIMFLSGCYSLRVLKLSNNQLQGKIFSKHA 623

Query:   345 NLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPK 404
             NLT L  L L+GN+F G + + L K   L  L +++N  SGM+P W+G ++RL ++ M  
Sbjct:   624 NLTGLVGLFLDGNNFTGSLEEGLLKSKNLTLLDISDNRFSGMLPLWIGRISRLSYLYMSG 683

Query:   405 NHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFF 464
             N L+GP P    Q  W++++DIS N+ SGS+P   +  S+  + L  N   G L  G  F
Sbjct:   684 NQLKGPFPF-LRQSPWVEVMDISHNSFSGSIPRNVNFPSLRELRLQNNEFTG-LVPGNLF 741

Query:   465 NYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVXXXXXXXXXXXXXXX 524
                 L  LDL  N  +G I + +D  S+L  L+L +N+ +  +P                
Sbjct:   742 KAAGLEVLDLRNNNFSGKILNTIDQTSKLRILLLRNNSFQTYIPGKICQLSEVGLLDLSH 801

Query:   525 XXXHGPIPPCFDNTTLH-ESYSNSSSPNKQFEIFF--FIQGPQ--GHPRLATLVMNQHSP 579
                 GPIP CF   +   E    + S    F+  +  F+   Q   H  L   V N + P
Sbjct:   802 NQFRGPIPSCFSKMSFGAEQNDRTMSLVADFDFSYITFLPHCQYGSHLNLDDGVRNGYQP 861


GO:0005575 "cellular_component" evidence=ND
GO:0007165 "signal transduction" evidence=IC
GO:0006457 "protein folding" evidence=RCA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139885 AT4G28650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047525 AT2G24130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00181071
annotation not avaliable (645 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-51
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-47
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-34
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  189 bits (482), Expect = 3e-51
 Identities = 165/497 (33%), Positives = 262/497 (52%), Gaps = 24/497 (4%)

Query: 41  ISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPWCMANMTSL 100
           I  +  SL+YL+LS++    N +  + RG  S+ +L+ L + NN L G +P  + + +SL
Sbjct: 113 IFTTSSSLRYLNLSNN----NFTGSIPRG--SIPNLETLDLSNNMLSGEIPNDIGSFSSL 166

Query: 101 RILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHF--QIPISLEPLFNHSRLKVFWAKNN 158
           ++L +  N L G I +S L +LTS+E L L++N    QIP  L  + +   LK  +   N
Sbjct: 167 KVLDLGGNVLVGKIPNS-LTNLTSLEFLTLASNQLVGQIPRELGQMKS---LKWIYLGYN 222

Query: 159 EINAEI-TQSPSLTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFP 217
            ++ EI  +   LT+    L+ L L      G I P  L +  +L+Y+ L   K++G  P
Sbjct: 223 NLSGEIPYEIGGLTS----LNHLDLVYNNLTGPI-PSSLGNLKNLQYLFLYQNKLSGPIP 277

Query: 218 TWLLENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLF 277
             +  +   L SL L ++SL+G     +   + L +L + +NNF G IPV +   LP L 
Sbjct: 278 PSIF-SLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTS-LPRLQ 335

Query: 278 SLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEG 337
            L +  N   G IP + G    L +LD++ N LTGEIPE L     NL  L L +NSLEG
Sbjct: 336 VLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLC-SSGNLFKLILFSNSLEG 394

Query: 338 HMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRL 397
            +        +L+ ++L+ N F GE+P   +K  ++  L ++NN+L G I     ++  L
Sbjct: 395 EIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSL 454

Query: 398 QHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLS-IEHVHLSKNMLHG 456
           Q + + +N   G +P +      L+ LD+S N  SG++P     LS +  + LS+N L G
Sbjct: 455 QMLSLARNKFFGGLP-DSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSG 513

Query: 457 QLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQ 516
           ++      +   LV+LDLS+N+L+G I      +  LS L L  N L GE+P  L  +  
Sbjct: 514 EIPD-ELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVES 572

Query: 517 LQLLDLSNNNLHGPIPP 533
           L  +++S+N+LHG +P 
Sbjct: 573 LVQVNISHNHLHGSLPS 589


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 590
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
PLN03150623 hypothetical protein; Provisional 99.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.99
PLN03150623 hypothetical protein; Provisional 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.78
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.72
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.71
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.58
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.54
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.35
KOG4341483 consensus F-box protein containing LRR [General fu 98.28
KOG4341483 consensus F-box protein containing LRR [General fu 98.27
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.26
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.17
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.17
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.16
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.12
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.09
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.88
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.88
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.84
PRK15386 426 type III secretion protein GogB; Provisional 97.82
PRK15386 426 type III secretion protein GogB; Provisional 97.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.67
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.52
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.49
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.26
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.16
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.15
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.03
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.97
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.65
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.72
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.53
KOG4308478 consensus LRR-containing protein [Function unknown 92.66
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.58
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.96
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.96
smart0037026 LRR Leucine-rich repeats, outliers. 89.96
KOG4308478 consensus LRR-containing protein [Function unknown 89.63
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.55
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.85
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.07
smart0037026 LRR Leucine-rich repeats, outliers. 87.07
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.77
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.45
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.4e-57  Score=510.76  Aligned_cols=529  Identities=30%  Similarity=0.417  Sum_probs=321.3

Q ss_pred             CCCccccccCCCCCCCCCCCCeEeCcCCcCccccccchHhhhcCCCCcEEecCCCCCCCCCCCCCcccccCCCCCcEEEe
Q 007762            2 SSYEVNGVLRGQGFPHFKSLELLDMECTRIALNTSFLQIISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYI   81 (590)
Q Consensus         2 ~~~~~~~~i~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~~l~~l~~L~~L~L   81 (590)
                      ++|++.|.+| .+|..+++|++|++++|  .+.+.+|..++..+++|++|++++|.+++   .++.   ..+++|++|+|
T Consensus        77 ~~~~i~~~~~-~~~~~l~~L~~L~Ls~n--~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~---~~p~---~~l~~L~~L~L  147 (968)
T PLN00113         77 SGKNISGKIS-SAIFRLPYIQTINLSNN--QLSGPIPDDIFTTSSSLRYLNLSNNNFTG---SIPR---GSIPNLETLDL  147 (968)
T ss_pred             cCCCccccCC-hHHhCCCCCCEEECCCC--ccCCcCChHHhccCCCCCEEECcCCcccc---ccCc---cccCCCCEEEC
Confidence            3555566555 45666666666666666  44555565555456666666666666544   3332   33555666666


Q ss_pred             ecccccccCCccccCCCCCcEEEccccccccccCCCCccCCCCCcEEECcCCccccccCccccccCCCccEEEccCCccc
Q 007762           82 YNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFNHSRLKVFWAKNNEIN  161 (590)
Q Consensus        82 ~~n~i~~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~~l~~l~~L~~L~ls~n~~~~~~~~~~l~~l~~L~~l~l~~~~~~  161 (590)
                      ++|.+.+..|..++++++|++|++++|.+.+.+|. .+.++++|++|++++|.+.+..+ ..+..+++|+.|++++|.+ 
T Consensus       148 s~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~-~~~~l~~L~~L~L~~n~l~~~~p-~~l~~l~~L~~L~L~~n~l-  224 (968)
T PLN00113        148 SNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPN-SLTNLTSLEFLTLASNQLVGQIP-RELGQMKSLKWIYLGYNNL-  224 (968)
T ss_pred             cCCcccccCChHHhcCCCCCEEECccCcccccCCh-hhhhCcCCCeeeccCCCCcCcCC-hHHcCcCCccEEECcCCcc-
Confidence            66666555566666666666666666665545554 45566666666666665554333 3455555666665555544 


Q ss_pred             ccccCCCCCCCCCcccceEeccCCCCCCCcCChhccCCCcccEEEcCCCcCccccchHHhhcCCCCcEEEccCCCCCCCC
Q 007762          162 AEITQSPSLTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFLVNDSLAGPF  241 (590)
Q Consensus       162 ~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~ls~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~  241 (590)
                                                 .+.+|..+..+++|++|++++|.+.+.+|..+ .++++|+.|++++|.+.+..
T Consensus       225 ---------------------------~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~L~~n~l~~~~  276 (968)
T PLN00113        225 ---------------------------SGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL-GNLKNLQYLFLYQNKLSGPI  276 (968)
T ss_pred             ---------------------------CCcCChhHhcCCCCCEEECcCceeccccChhH-hCCCCCCEEECcCCeeeccC
Confidence                                       44455556666666666666666655555553 56666666666666666655


Q ss_pred             cCCCCCCCcccEEEccCCcCCCCCchhhhhcCCCCcEEEccCceecccCCcccCCCCCCcEEEccCcccccccchhhhcC
Q 007762          242 RLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVG  321 (590)
Q Consensus       242 ~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~  321 (590)
                      +..+..+++|+.|++++|.+.+.+|..+.. +++|+.|++++|.+++..|..+..+++|+.|++++|.+.+.+|..+. .
T Consensus       277 p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~-l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~-~  354 (968)
T PLN00113        277 PPSIFSLQKLISLDLSDNSLSGEIPELVIQ-LQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLG-K  354 (968)
T ss_pred             chhHhhccCcCEEECcCCeeccCCChhHcC-CCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHh-C
Confidence            555666666666666666666555555544 56666666666666666666666666666666666666655555443 3


Q ss_pred             CCCCcEEEccCCcCCCccCccccCccccCceeccCccccccCCccccCCCCCCEEEccCCcccccCccccCCCCCccEEE
Q 007762          322 CVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIM  401 (590)
Q Consensus       322 ~~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~  401 (590)
                      +++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+++..|..+..++.|+.|+
T Consensus       355 ~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~  434 (968)
T PLN00113        355 HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLD  434 (968)
T ss_pred             CCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEE
Confidence            56666666666666665666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             CCCCcCcCCCCcccCCCCCCcEEEcccCcCCCCCCCCCCCCcccEEECcCccCCCCCCccccccCCCCcEEEcCCCcCCC
Q 007762          402 MPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNG  481 (590)
Q Consensus       402 L~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~ls~n~l~~  481 (590)
                      +++|.+.+.++..+..+++|+.|++++|.+.+..|..+...+|+.|++++|.+.+.++.. +.++++|+.|++++|.+.+
T Consensus       435 Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~-~~~l~~L~~L~Ls~N~l~~  513 (968)
T PLN00113        435 ISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRK-LGSLSELMQLKLSENKLSG  513 (968)
T ss_pred             CcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChh-hhhhhccCEEECcCCccee
Confidence            666666666666566666666666666666666666555566666666666665555544 5566666666666666666


Q ss_pred             CccccccccCCCCEEECcCCcccCCCcccccCCCCCCEEECcCCccCCCCccccccCCccccc----cCCCCCCCccce-
Q 007762          482 SISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHGPIPPCFDNTTLHESY----SNSSSPNKQFEI-  556 (590)
Q Consensus       482 ~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~~~~~----~~~~~~~~~~~~-  556 (590)
                      .+|..+..+++|++|++++|++++.+|..+..+++|+.|++++|++++.+|..+..++.+...    |...+.+|.... 
T Consensus       514 ~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~  593 (968)
T PLN00113        514 EIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAF  593 (968)
T ss_pred             eCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchh
Confidence            666666666666666666666666666666666666666666666666666666555433322    333332332211 


Q ss_pred             -eccccCCCCCCCCCccc
Q 007762          557 -FFFIQGPQGHPRLATLV  573 (590)
Q Consensus       557 -~~~~~~~~~np~~~~~~  573 (590)
                       .+...++.|||.+|+..
T Consensus       594 ~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        594 LAINASAVAGNIDLCGGD  611 (968)
T ss_pred             cccChhhhcCCccccCCc
Confidence             12345678999999754



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-35
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-35
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-12
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-07
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 4e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 6e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 9e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 1e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 3e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 147 bits (371), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 158/544 (29%), Positives = 245/544 (45%), Gaps = 71/544 (13%) Query: 17 HFKSLELLDMECTRIALNTSFLQIISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHL 76 SLE+LD+ I+ ++S+ LK+L++S G S +D C V+L Sbjct: 146 KLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAIS----GNKISGDVDVSRC--VNL 199 Query: 77 QELYIYNNDLRGSLPWCMANMTSLRILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHFQ 136 + L + +N+ +P+ + + ++L+ L +S N+L+G S + + T ++ L++S+N F Sbjct: 200 EFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFV 257 Query: 137 IPISLEPLFNHSRLKVFWAKNNEINAEITQSPSLTAPNFQLSRLSLSSGYGDGVIFPKF- 195 PI PL L+ N+ EI L+ L+ L LS + G + P F Sbjct: 258 GPIPPLPL---KSLQYLSLAENKFTGEIPDF--LSGACDTLTGLDLSGNHFYGAVPPFFG 312 Query: 196 -----------------------LYHQHDLEYVDLSHMKMNGEFPTWLLENNTNLESLFL 232 L L+ +DLS + +GE P L + +L +L L Sbjct: 313 SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 372 Query: 233 VNDSLAGPF--RLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSI 290 +++ +GP L + L+ L + NN F G IP + + L SL++S N L G+I Sbjct: 373 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC-SELVSLHLSFNYLSGTI 431 Query: 291 PSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLK 350 PSS G++ L+ L + N L GEIP+ L LE L L N L G + S N TNL Sbjct: 432 PSSLGSLSKLRDLKLWLNMLEGEIPQELMY-VKTLETLILDFNDLTGEIPSGLSNCTNLN 490 Query: 351 WLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGP 410 W+ L N GEIP+ + + L L L+NNS SG IP LG+ L + + N G Sbjct: 491 WISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGT 550 Query: 411 IPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIE-HVHLSKNMLHGQLKRG-------- 461 IP + Q I+ N I+G ++ H + N+L Q R Sbjct: 551 IPAAM----FKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLST 606 Query: 462 -----------------TFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLE 504 TF N S++ LD+SYN L+G I + + L L LGHN++ Sbjct: 607 RNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDIS 666 Query: 505 GEVP 508 G +P Sbjct: 667 GSIP 670
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-109
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-105
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-91
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-66
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-57
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-65
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-61
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-58
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-52
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-44
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-62
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-54
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-34
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-32
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-60
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-34
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-30
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-59
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-50
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-45
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-55
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-28
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-54
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-43
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-53
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-52
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-51
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-41
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-33
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-27
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-44
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-43
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-29
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-35
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-27
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-21
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-16
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-26
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-21
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-24
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-23
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-23
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-20
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-18
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-10
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 7e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  343 bits (882), Expect = e-109
 Identities = 144/513 (28%), Positives = 230/513 (44%), Gaps = 24/513 (4%)

Query: 44  SMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLPW--CMANMTSLR 101
           S+  L+ L LS+S +  + S     G      L  L +  N L G +     + + + L+
Sbjct: 75  SLTGLESLFLSNSHINGSVS-----GFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLK 129

Query: 102 ILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHF--QIPISLEPLFNHSRLKVFWAKNNE 159
            L VSSN L      S  + L S+E L LS N       +          LK      N+
Sbjct: 130 FLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNK 189

Query: 160 INAEITQSPSLTAPNFQLSRLSLSSGYGDGVIFPKFLYHQHDLEYVDLSHMKMNGEFPTW 219
           I+ ++  S         L  L +SS      I P FL     L+++D+S  K++G+F   
Sbjct: 190 ISGDVDVS-RCV----NLEFLDVSSNNFSTGI-P-FLGDCSALQHLDISGNKLSGDFSRA 242

Query: 220 LLENNTNLESLFLVNDSLAGPFRLPIHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSL 279
           +    T L+ L + ++   GP  +P    K L+ L ++ N F G IP  +      L  L
Sbjct: 243 IS-TCTELKLLNISSNQFVGP--IPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGL 299

Query: 280 NISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHM 339
           ++S N   G++P  FG+   L+ L +++N  +GE+P    +    L+ L LS N   G +
Sbjct: 300 DLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGEL 359

Query: 340 FSRNFNLT-NLKWLQLEGNHFVGEIPQSLSKCF--VLEGLFLNNNSLSGMIPRWLGNLTR 396
                NL+ +L  L L  N+F G I  +L +     L+ L+L NN  +G IP  L N + 
Sbjct: 360 PESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSE 419

Query: 397 LQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPL-SIEHVHLSKNMLH 455
           L  + +  N+L G IP     L  L+ L +  N + G +P     + ++E + L  N L 
Sbjct: 420 LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLT 479

Query: 456 GQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLN 515
           G++      N  +L  + LS NRL G I  W+  L  L+ L L +N+  G +P +L    
Sbjct: 480 GEIPS-GLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCR 538

Query: 516 QLQLLDLSNNNLHGPIPPCFDNTTLHESYSNSS 548
            L  LDL+ N  +G IP      +   + +  +
Sbjct: 539 SLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIA 571


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query590
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.66
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.62
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.46
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.31
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.28
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.26
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.15
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.03
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.69
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.47
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.25
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.59
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.01
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.35
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.7e-64  Score=552.34  Aligned_cols=557  Identities=31%  Similarity=0.413  Sum_probs=386.5

Q ss_pred             CCCCCCCCCeEeCcCCcCccccccch--HhhhcCCCCcEEecCCCCCCCCCCCCCcccccCCCCCcEEEeecccccccCC
Q 007762           14 GFPHFKSLELLDMECTRIALNTSFLQ--IISESMPSLKYLSLSDSTLGTNSSKILDRGLCSLVHLQELYIYNNDLRGSLP   91 (590)
Q Consensus        14 ~~~~~~~L~~L~l~~~~~~~~~~~~~--~~~~~l~~L~~L~L~~~~~~~~~~~~~~~~l~~l~~L~~L~L~~n~i~~~~~   91 (590)
                      .|+++++|++|++++|  .+.+.+|.  .+. .+++|++|++++|.+.+   .++...+.++++|++|++++|.+++..+
T Consensus        95 ~~~~l~~L~~L~Ls~n--~l~~~~~~~~~l~-~l~~L~~L~Ls~n~l~~---~~~~~~~~~l~~L~~L~Ls~n~l~~~~~  168 (768)
T 3rgz_A           95 GFKCSASLTSLDLSRN--SLSGPVTTLTSLG-SCSGLKFLNVSSNTLDF---PGKVSGGLKLNSLEVLDLSANSISGANV  168 (768)
T ss_dssp             CCCCCTTCCEEECCSS--EEEEEGGGGGGGG-GCTTCCEEECCSSEEEC---CSSCCSCCCCTTCSEEECCSSCCEEETH
T ss_pred             hhccCCCCCEEECCCC--cCCCcCCChHHHh-CCCCCCEEECcCCccCC---cCCHHHhccCCCCCEEECCCCccCCcCC
Confidence            5666666666666666  55555555  555 66666666666666544   3333333555556666665555554444


Q ss_pred             cc---ccC----------------------CCCCcEEEccccccccccCCCCccCCCCCcEEECcCCccccccCcccccc
Q 007762           92 WC---MAN----------------------MTSLRILYVSSNQLTGSISSSPLVHLTSIEELHLSNNHFQIPISLEPLFN  146 (590)
Q Consensus        92 ~~---~~~----------------------l~~L~~L~ls~n~l~~~~~~~~l~~l~~L~~L~ls~n~~~~~~~~~~l~~  146 (590)
                      ..   +.+                      +++|++|++++|.+++.++.  +.++++|++|++++|.+.+.++ ..+..
T Consensus       169 ~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--l~~l~~L~~L~Ls~n~l~~~~~-~~l~~  245 (768)
T 3rgz_A          169 VGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF--LGDCSALQHLDISGNKLSGDFS-RAIST  245 (768)
T ss_dssp             HHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB--CTTCCSCCEEECCSSCCCSCHH-HHTTT
T ss_pred             hhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc--cccCCCCCEEECcCCcCCCccc-HHHhc
Confidence            33   344                      44445555555544433332  4555555555555555543222 34455


Q ss_pred             CCCccEEEccCCcccccccCCCCCCCCCcccceEeccCCCCCCCcCChhccCC-CcccEEEcCCCcCccccchHHhhcCC
Q 007762          147 HSRLKVFWAKNNEINAEITQSPSLTAPNFQLSRLSLSSGYGDGVIFPKFLYHQ-HDLEYVDLSHMKMNGEFPTWLLENNT  225 (590)
Q Consensus       147 l~~L~~l~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~-~~L~~L~ls~~~~~~~~~~~~~~~l~  225 (590)
                      +++|+.|++++|.+.+.....     ...+|++|++ ..+.+.+.+|..+... ++|++|++++|.+.+.+|..+ ..++
T Consensus       246 l~~L~~L~Ls~n~l~~~~~~~-----~l~~L~~L~L-~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~-~~l~  318 (768)
T 3rgz_A          246 CTELKLLNISSNQFVGPIPPL-----PLKSLQYLSL-AENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFF-GSCS  318 (768)
T ss_dssp             CSSCCEEECCSSCCEESCCCC-----CCTTCCEEEC-CSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGG-GGCT
T ss_pred             CCCCCEEECCCCcccCccCcc-----ccCCCCEEEC-cCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHH-hcCC
Confidence            555555555555554332221     2336777777 5666666666666553 777777777777776666664 6777


Q ss_pred             CCcEEEccCCCCCCCCcCC-CCCCCcccEEEccCCcCCCCCchhhhhcCCCCcEEEccCceecccCCcccCC--CCCCcE
Q 007762          226 NLESLFLVNDSLAGPFRLP-IHSHKRLRLLDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGN--MKFLQL  302 (590)
Q Consensus       226 ~L~~L~l~~~~~~~~~~~~-~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~L~~n~~~~~~~~~l~~--l~~L~~  302 (590)
                      +|+.|++++|.+.+.++.. +..+++|++|++++|.+++.+|..+....++|++|++++|.+++.+|..+..  +++|++
T Consensus       319 ~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~  398 (768)
T 3rgz_A          319 LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQE  398 (768)
T ss_dssp             TCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCE
T ss_pred             CccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccE
Confidence            7777777777776555543 6677777777777777776777776663347777777777777766666665  677888


Q ss_pred             EEccCcccccccchhhhcCCCCCcEEEccCCcCCCccCccccCccccCceeccCccccccCCccccCCCCCCEEEccCCc
Q 007762          303 LDVTNNQLTGEIPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNS  382 (590)
Q Consensus       303 L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~  382 (590)
                      |++++|.+.+.+|..+. .+++|+.|++++|.+.+..|..+..+++|++|++++|.+.+..|..+..+++|+.|++++|.
T Consensus       399 L~L~~n~l~~~~p~~l~-~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~  477 (768)
T 3rgz_A          399 LYLQNNGFTGKIPPTLS-NCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND  477 (768)
T ss_dssp             EECCSSEEEEECCGGGG-GCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC
T ss_pred             EECCCCccccccCHHHh-cCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCc
Confidence            88888887766666654 47888888888888877777778888888888888888887788888888888888888888


Q ss_pred             ccccCccccCCCCCccEEECCCCcCcCCCCcccCCCCCCcEEEcccCcCCCCCCCCCC-CCcccEEECcCccCCCCCCcc
Q 007762          383 LSGMIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFH-PLSIEHVHLSKNMLHGQLKRG  461 (590)
Q Consensus       383 ~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~-~~~L~~L~l~~n~~~~~~~~~  461 (590)
                      +++.+|..+..+++|+.|++++|++.+.+|..+..+++|++|++++|.+++.+|..+. +++|+.|++++|.+.+.+|..
T Consensus       478 l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~  557 (768)
T 3rgz_A          478 LTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAA  557 (768)
T ss_dssp             CCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGG
T ss_pred             ccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChH
Confidence            8877888888888888888888888878888888888888888888888777776554 678888888888877666643


Q ss_pred             c---------------------------------------------------------------------cccCCCCcEE
Q 007762          462 T---------------------------------------------------------------------FFNYHSLVTL  472 (590)
Q Consensus       462 ~---------------------------------------------------------------------~~~~~~L~~L  472 (590)
                      .                                                                     +..+++|+.|
T Consensus       558 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~L  637 (768)
T 3rgz_A          558 MFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFL  637 (768)
T ss_dssp             GGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEE
T ss_pred             HhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEE
Confidence            2                                                                     3345778999


Q ss_pred             EcCCCcCCCCccccccccCCCCEEECcCCcccCCCcccccCCCCCCEEECcCCccCCCCccccccCCccc----cccCCC
Q 007762          473 DLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHGPIPPCFDNTTLHE----SYSNSS  548 (590)
Q Consensus       473 ~ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~~~----~~~~~~  548 (590)
                      |+++|++++.+|..++.+++|++|+|++|++++.+|..+..+++|+.||+++|+++|.+|..+..++.++    ++|..+
T Consensus       638 dLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~  717 (768)
T 3rgz_A          638 DMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLS  717 (768)
T ss_dssp             ECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEE
T ss_pred             ECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCccc
Confidence            9999999999999999999999999999999999999999999999999999999999999998887444    445555


Q ss_pred             CCCCccce--eccccCCCCCCCCCcccccCCCCCCCCcccc
Q 007762          549 SPNKQFEI--FFFIQGPQGHPRLATLVMNQHSPAQGHEDLE  587 (590)
Q Consensus       549 ~~~~~~~~--~~~~~~~~~np~~~~~~~~~~~~~~~~~~~~  587 (590)
                      |++|....  .+...+|.|||.+||..+...+...+.+..+
T Consensus       718 g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~  758 (768)
T 3rgz_A          718 GPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAH  758 (768)
T ss_dssp             EECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC------
T ss_pred             ccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCC
Confidence            55554322  2345678999999998877544444444443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 590
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-19
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 85.6 bits (210), Expect = 4e-19
 Identities = 47/276 (17%), Positives = 82/276 (29%), Gaps = 8/276 (2%)

Query: 254 LDISNNNFRGHIPVEIGDVLPGLFSLNISMNALDGSIPSSFGNMKFLQLLDVTNNQLTGE 313
                   +  +PV I         + +  N +     +SF   + L +L + +N L   
Sbjct: 16  TSCPQQGLQ-AVPVGIP---AASQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARI 71

Query: 314 IPEHLAVGCVNLEYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVL 373
                    +  +     N  L     +    L  L  L L+        P        L
Sbjct: 72  DAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAAL 131

Query: 374 EGLFLNNNSLSGMIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISG 433
           + L+L +N+L  +      +L  L H+ +  N +       F  L  L  L +  N ++ 
Sbjct: 132 QYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAH 191

Query: 434 SLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSISDWVDGLSQL 493
             P  F  L               L         +L  L L+ N             + L
Sbjct: 192 VHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWVCDC-RARPLWAWL 250

Query: 494 SHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNNLHG 529
                  + +   +P +   L    L  L+ N+L G
Sbjct: 251 QKFRGSSSEVPCSLPQR---LAGRDLKRLAANDLQG 283


>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query590
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.38
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.12
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.22
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.0
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.97
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.7
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.49
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.24
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.95  E-value=1.2e-27  Score=232.05  Aligned_cols=257  Identities=30%  Similarity=0.433  Sum_probs=176.7

Q ss_pred             CcccEEEccCCcCCC--CCchhhhhcCCCCcEEEccC-ceecccCCcccCCCCCCcEEEccCcccccccchhhhcCCCCC
Q 007762          249 KRLRLLDISNNNFRG--HIPVEIGDVLPGLFSLNISM-NALDGSIPSSFGNMKFLQLLDVTNNQLTGEIPEHLAVGCVNL  325 (590)
Q Consensus       249 ~~L~~L~l~~n~l~~--~~~~~~~~~~~~L~~L~L~~-n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~L  325 (590)
                      .+++.|+++++.+.+  .+|..+.. +++|++|++++ |.+++.+|..++++++|++|++++|++.+..+.. +..+..|
T Consensus        50 ~~v~~L~L~~~~l~g~~~lp~~l~~-L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~-~~~~~~L  127 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPYPIPSSLAN-LPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDF-LSQIKTL  127 (313)
T ss_dssp             CCEEEEEEECCCCSSCEECCGGGGG-CTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGG-GGGCTTC
T ss_pred             EEEEEEECCCCCCCCCCCCChHHhc-Cccccccccccccccccccccccccccccchhhhcccccccccccc-ccchhhh
Confidence            357777777777765  35666665 77777777765 5666677777777777777777777776433333 3346677


Q ss_pred             cEEEccCCcCCCccCccccCccccCceeccCccccccCCccccCCCCC-CEEEccCCcccccCccccCCCCCccEEECCC
Q 007762          326 EYLALSNNSLEGHMFSRNFNLTNLKWLQLEGNHFVGEIPQSLSKCFVL-EGLFLNNNSLSGMIPRWLGNLTRLQHIMMPK  404 (590)
Q Consensus       326 ~~L~l~~n~i~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L-~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~  404 (590)
                      +.++++.|.+.+..|..+..+++++.+++++|.+.+.+|..+..+..+ +.+++++|++++..+..+..+..+ .+++.+
T Consensus       128 ~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~  206 (313)
T d1ogqa_         128 VTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSR  206 (313)
T ss_dssp             CEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCS
T ss_pred             cccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-cccccc
Confidence            777777776666666666666777777777776666666666555554 666666666666666555554433 466666


Q ss_pred             CcCcCCCCcccCCCCCCcEEEcccCcCCCCCCCCCCCCcccEEECcCccCCCCCCccccccCCCCcEEEcCCCcCCCCcc
Q 007762          405 NHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSIEHVHLSKNMLHGQLKRGTFFNYHSLVTLDLSYNRLNGSIS  484 (590)
Q Consensus       405 n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~~  484 (590)
                      +...+.+|..+..+++++.+++++|.+.                       +.++ . +..+++|+.|++++|++++.+|
T Consensus       207 ~~~~~~~~~~~~~~~~l~~l~~~~~~l~-----------------------~~~~-~-~~~~~~L~~L~Ls~N~l~g~iP  261 (313)
T d1ogqa_         207 NMLEGDASVLFGSDKNTQKIHLAKNSLA-----------------------FDLG-K-VGLSKNLNGLDLRNNRIYGTLP  261 (313)
T ss_dssp             SEEEECCGGGCCTTSCCSEEECCSSEEC-----------------------CBGG-G-CCCCTTCCEEECCSSCCEECCC
T ss_pred             cccccccccccccccccccccccccccc-----------------------cccc-c-cccccccccccCccCeecccCC
Confidence            6666666666666666666666666554                       3333 2 5566788899999999988888


Q ss_pred             ccccccCCCCEEECcCCcccCCCcccccCCCCCCEEECcCCc-cCCC-Cccc
Q 007762          485 DWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNN-LHGP-IPPC  534 (590)
Q Consensus       485 ~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~-l~~~-~p~~  534 (590)
                      .+|+++++|++|+|++|+++|.+|+ +.++++|+.+++++|+ +.|. +|.|
T Consensus       262 ~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~plp~c  312 (313)
T d1ogqa_         262 QGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGSPLPAC  312 (313)
T ss_dssp             GGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEESTTSSCC
T ss_pred             hHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCCCCCCC
Confidence            8898999999999999999888874 5778888889999887 4543 4543



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure