Citrus Sinensis ID: 007787

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------59

MTLAYQNLERILKETNYLVRESEKVICTFIMSNIQQNGDQGCSKELCDALVGLESKFTDIKQQLHQVQPRYNIDFSLWMGELKIMCLLHLQRDNMMSLQDDAMVELLDQLIEGPLQLSVVAIIDSFILIVHAWVSFDTDPGTMLDNILKYVMPQSAFREILYKDFEKRKTALHDYLKNKRYLIVLYDVFTNDVWDYLGEALPDHQNGSRVLVILFDDEIFNLCILENEDMINLDSVPATPLRATYQERPLVCLYYGSESLAENMKLTWLIRKRSPLFSIAQLPQRLKLCCLYLSACREGFEISTRQLNQLWIAEGFIPETARKLLNLGTIVLEEYPAGINLLLLLKYLKLNIPYLKHLPASLCNLLNLYTIDMPSSYVRCTPDSIGKMHELRHLNFRTITLPAHPGKFCTSLENLNFISVLHPSSCTRDILGRLPSEFELLESLKLVNELKIPSQLSSIVLPEYQFPPSLIELSLANTELRDDPMPKPKKLLHLQVLKLKKNSFIGRKLICRFGCFPSLKEWIVEFEAIPKLESLIINPCAHLKRLPEDLWRVKSLTKLELWWPRFELRERLRKFENRELFLWNVIRMG

cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEcccccEEcccEEccccHHHHHHHHHHccccccEEEEEEEcccccEEEEEEccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHccccccccEEEEEcccHHHHHcccccccccccccccccccHHHHcccccHHHHHHHccccccccHHHHHHHHccccccccccccHHHHHHcccccccccccccccccEEHHHHccccccccccccccccEEccccHHHHHccccccEEEEEEccccccccEEEEEEcEEEEEcccccEEEcccccccccEEEEEEEEcccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEEcccccccEEEEcccccccccEEcccccccccccEEEEccccccccccHHccccccccEEEEEcccHHHHHHHHcccccccccccEEEcc

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccccccEEEEccHHHHHHHHHHHcccHHHEEEEEEEcEEEEEEEEEEccccHHHHHHHHHHHHcccHHHHHHHHHcHHHHHHHHHHHHHHccEEEEEccHHHHHHHHHHcccccccccccEEEEEEcHHHHHHHHHHEHHHccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccccccccccccccEEEEEEEcccccccccccccEEHEEEHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHcHHccccccccHHHHHHHHHHEEcccccccEEccHHHHHHHHHHHEEccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcHHHHHHHHHcccccccccccccHcccccccEEEEEEccccccccHHHHHHcHccHEEEEEEccccccEEEEcccccccHHEEEEEccccHHHcEEEEcccHHHHHcccHHHHHHHHHEEEEcccHHHHHHHHHHcccccEEEEEEEEcc

MTLAYQNLERILKETNYLVRESEKVICTFIMSniqqngdqgCSKELCDALVGLESKFTDIKQQLhqvqprynidFSLWMGELKIMCLLHLQRDNMMSLQDDAMVELLDQLIEGPLQLSVVAIIDSFILIVHAWvsfdtdpgtmlDNILKYVMPQSAFREILYKDFEKRKTALHDYLKNKRYLIVLYDVFTNDVWDYLgealpdhqngsrVLVILFDDEIFNLCilenedminldsvpatplratyqerplvclyygseslaeNMKLTWLIrkrsplfsiaqLPQRLKLCCLYLSACREGFEISTRQLNQLWIAEGFIPETARKLLNLGTIVLEEYPAGINLLLLLKYLKLNIPYLKHLPASLCNLLnlytidmpssyvrctpdsigkmhelRHLNfrtitlpahpgkfctslenlnfisvlhpssctrdilgrlpSEFELLESLKLVnelkipsqlssivlpeyqfppsliELSLantelrddpmpkpkkLLHLQVLKLKKNSFIGRKLIcrfgcfpslKEWIVEFEaipklesliinpcahlkrlpedlwrVKSLTKLELWWPRFELRERLRKFENRELFLWNVIRMG

MTLAYQNLERILKETNYLVRESEKVICTFIMSNIQQNGDQGCSKELCDALVGLESKFTDIKQQLHQVQPRYNIDFSLWMGELKIMCLLHLQRDNMMSLQDDAMVELLDQLIEGPLQLSVVAIIDSFILIVHAWVSFDTDPGTMLDNILKYVMPQSAFREILYKDFEKRKTALHDYLKNKRYLIVLYDVFTNDVWDYLGEALPDHQNGSRVLVILFDDEIFNLCILENEDMINLDSVPATPLRATYQERPLVCLYYGSESLAENMKLTWLIRKRSPLFSIAQLPQRLKLCCLYLSACREGFEISTRQLNQLWIAEGFIPETARKLLNLGTIVLEEYPAGinlllllkylklnipylKHLPASLCNLLNLYTIDMPSSYVRCTPDSIGKMHELRHLNFRTITLPAHPGKFCTSLENLNFISVLHPSSCTRDILGRLPSEFELLESLKLVNELKIPSQLSSIVLPEYQFPPSLIELSLANTELRDDPMPkpkkllhlqvlklkkNSFIGRKLICRFGCFPSLKEWIVEFEAIPKLESLIINPCAHLKRLPEDLWRVKSLTKLELWWPrfelrerlrkfenrelflWNVIRMG

****YQNLERILKETNYLVRESEKVICTFIMSNIQQNGDQGCSKELCDALVGLESKFTDIKQQLHQVQPRYNIDFSLWMGELKIMCLLHLQRDNMMSLQDDAMVELLDQLIEGPLQLSVVAIIDSFILIVHAWVSFDTDPGTMLDNILKYVMPQSAFREILYKDFEKRKTALHDYLKNKRYLIVLYDVFTNDVWDYLGEALPDHQNGSRVLVILFDDEIFNLCILENEDMINLDSVPATPLRATYQERPLVCLYYGSESLAENMKLTWLIRKRSPLFSIAQLPQRLKLCCLYLSACREGFEISTRQLNQLWIAEGFIPETARKLLNLGTIVLEEYPAGINLLLLLKYLKLNIPYLKHLPASLCNLLNLYTIDMPSSYVRCTPDSIGKMHELRHLNFRTITLPAHPGKFCTSLENLNFISVLHPSSCTRDILGRLPSEFELLESLKLVNELKIPSQLSSIVLPEYQFPPSLIELSLA*************KLLHLQVLKLKKNSFIGRKLICRFGCFPSLKEWIVEFEAIPKLESLIINPCAHLKRLPEDLWRVKSLTKLELWWPRFELRERLRKFENRELFLWNVI***

**LAYQNLERILKETNYLVRESEKVICTFI******************ALVGLESKFTDIKQQ******************************NMMSLQDDAMVELLDQLIEGPLQLSVVAIIDSFILIVHAWVSFDTDPGTMLDNILKY*****************RKTALHDYLKNKRYLIVLYDVFTNDVWDYLGEALPDHQNGSRVLVILFDDEIFNLCILENEDMINLDSVPATPLRATYQERPLVCLYYGSESLAEN**LTWLIRKRSPLFSIAQLPQRLKLCCLYLSACREGFEISTRQLNQLWIAEGFIPETARKLLNLGTIVLEEYPAGINLLLLLKYLKLNIPYLKHLPASLCNLLNLYTIDMPSSYVRCTPDSIGKMHELRHLNFRT*******************ISVLHPSSCTRDILGRLPSEFELLESLKLVNELKIPSQLSSIVLPEYQFPPSLIELSLANTELRDDPMPKPKKLLHLQVLKLKKNSFIGRKLICRFGCFPSLKEWIVEFEAIPKLESLIINPCAHLKRLPEDLWRVKSLTKLELWWPRF*************LFLWNVIRMG

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		589	2.2.26 [Sep-21-2011]
Q9FJB5		901	Disease resistance RPP8-l	yes	no	0.485	0.317	0.274	2e-20
Q8W474		907	Probable disease resistan	no	no	0.365	0.237	0.312	1e-19
Q8W4J9		908	Disease resistance protei	no	no	0.378	0.245	0.306	1e-17
Q9FJK8		908	Probable disease resistan	no	no	0.376	0.244	0.312	3e-17
Q9XIF0		906	Putative disease resistan	no	no	0.383	0.249	0.295	4e-16
P0C8S1		906	Probable disease resistan	no	no	0.448	0.291	0.277	4e-15
P59584		910	Disease resistance protei	no	no	0.380	0.246	0.268	1e-14
Q8W3K3		910	Putative disease resistan	no	no	0.376	0.243	0.284	4e-14
P0DI18		1049	Probable disease resistan	no	no	0.354	0.199	0.274	9e-12
P0DI17		1049	Probable disease resistan	no	no	0.354	0.199	0.274	9e-12

>sp\|Q9FJB5\|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1	Back alignment and function desciption

 Score =  101 bits (251), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 101/368 (27%), Positives = 165/368 (44%), Gaps = 82/368 (22%)

Query: 279 IAQLPQRLKLCCLYLSACRE--GFEISTRQL------NQLWI--AEGFIPETARKLLNLG 328
           IAQ P R +   ++        G +   R L        LWI  A  F      ++L+L 
Sbjct: 517 IAQSPSRSRRLTVHSGKAFHILGHKKKVRSLLVLGLKEDLWIQSASRFQSLPLLRVLDLS 576

Query: 329 TIVLE--EYPAGINLLLLLKYLKLNIPYLKHLPASLCNL-----LNLY-TIDMPSSYVRC 380
           ++  E  + P+ I  L+ L++L L+   + HLP+++ NL     LNL+  I +P      
Sbjct: 577 SVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVH---- 632

Query: 381 TPDSIGKMHELRHLNFRTITLPAHPGK-------------FCTSLEN-----------LN 416
            P+ + +M ELR+L   ++ L  H                +C S ++           L 
Sbjct: 633 VPNVLKEMLELRYL---SLPLDMHDKTKLELGDLVNLEYLWCFSTQHSSVTDLLRMTKLR 689

Query: 417 FISVLHPSSCTRDILGRLPSEFELLESLKLV---------------------NELKIPSQ 455
           F  V     CT + L     +F  LE+L  +                      +L +   
Sbjct: 690 FFGVSFSERCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVH 749

Query: 456 LSSIVLPEYQFPPSLIELSLANTELRDDPMPKPKKLLHLQVLKLKKNSFIGRKLICRFGC 515
           LS I   ++Q PP +  + L    + +DPMP  +KLLHL+ ++L++ +FIGR+++C  G 
Sbjct: 750 LSKIP-DQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGG 808

Query: 516 FPSLK-----------EWIVEFEAIPKLESLIINPCAHLKRLPEDLWRVKSLTKLELWWP 564
           FP L+           EWIVE  ++P L  LII+ C  L+ LP+ L  V SL +L++   
Sbjct: 809 FPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEGM 868

Query: 565 RFELRERL 572
           + E +E+L
Sbjct: 869 KREWKEKL 876

Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q8W474\|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4	Back alignment and function description

>sp\|Q8W4J9\|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2	Back alignment and function description

>sp\|Q9FJK8\|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1	Back alignment and function description

>sp\|Q9XIF0\|DRL13_ARATH Putative disease resistance protein At1g59780 OS=Arabidopsis thaliana GN=At1g59780 PE=2 SV=1	Back alignment and function description

>sp\|P0C8S1\|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1	Back alignment and function description

>sp\|P59584\|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1	Back alignment and function description

>sp\|Q8W3K3\|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1	Back alignment and function description

>sp\|P0DI18\|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1	Back alignment and function description

>sp\|P0DI17\|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		589
359489796		795	PREDICTED: disease susceptibility protei	0.724	0.537	0.259	4e-19
15238507		901	disease resistance RPP8-like protein 3 [	0.485	0.317	0.274	1e-18
297837557		900	predicted protein [Arabidopsis lyrata su	0.405	0.265	0.304	2e-18
15217954		907	CC-NBS-LRR class disease resistance prot	0.365	0.237	0.312	6e-18
297734140		965	unnamed protein product [Vitis vinifera]	0.422	0.258	0.289	9e-18
32364518		902	resistance protein Sorb5 [Arabidopsis th	0.378	0.247	0.313	1e-17
32364507		908	resistance protein Hod3 [Arabidopsis tha	0.378	0.245	0.313	1e-17
359491404		922	PREDICTED: probable disease resistance R	0.431	0.275	0.297	4e-17
255577203		1064	conserved hypothetical protein [Ricinus	0.402	0.222	0.299	5e-17
297745212		706	unnamed protein product [Vitis vinifera]	0.521	0.434	0.274	7e-17

>gi\|359489796\|ref\|XP_003633980.1\| PREDICTED: disease susceptibility protein LOV1-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  102 bits (255), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 143/552 (25%), Positives = 225/552 (40%), Gaps = 125/552 (22%)

Query: 157 FREILYKDFEKRKTALHD----YLKNKRYLIVLYDVFTNDVWDYLGEALPDHQNGSRVLV 212
           F  +  K+ E R++ L +    YLK K+YL+V+ DV++++VW  L   LP+ ++GS+VL+
Sbjct: 244 FMSLSEKEKEMRESELGEKLCEYLKEKKYLVVMDDVWSSEVWSRLRSHLPEAKDGSKVLI 303

Query: 213 ILFDDEI----------FNLCILENEDMINL--------DSVPATPLR----------AT 244
              + EI          + L ++ +++   L         S P T +R          A 
Sbjct: 304 TTRNKEIALHATSQAFIYELRLMNDDESWQLFLKKTFQGTSTPHTLIRELEEPGKKIVAK 363

Query: 245 YQERPLVCLYYGSE-SLAENMKLTW--------LIRKRSP-------LFSIAQLPQRLKL 288
            +  PL  +  G   S  E  K +W            + P         S   LP  LK 
Sbjct: 364 CKGLPLAVVVLGGLLSTKEKTKPSWEKVLASIEWYLDQGPESCMGILALSYNDLPYYLKS 423

Query: 289 CCLYLSACREGFEISTRQLNQLWIAEGFIPETARKLL--------------NLGTIVLEE 334
           C LY     E  EI   +L +LW+AEGFI    ++ L              +L  +    
Sbjct: 424 CFLYCGIFPEDSEIKASKLIRLWLAEGFIQRRGKETLEDIAEDYMHELIHRSLIQVAERR 483

Query: 335 YPAGI------NLLLLLKYLKLN----IPYLKHL-----------PASLC--------NL 365
              G+      +LL  L  L+         L+HL             S C         L
Sbjct: 484 VDGGVESCRMHDLLRDLAVLEAKDAKFFEQLRHLICWNCKISGQSKTSKCVNGYLGVEQL 543

Query: 366 LNLYTIDMPSSYVRCTPDSIGKMHELRHLNFRTITLPAHPGKFCTSLENLNFISVLHPSS 425
            NL T+ +         D +GK+ +LR L    +  P     F  S+  L  +  L    
Sbjct: 544 TNLQTLALQGGSW-LEGDGLGKLTQLRKLVLGGLLTPYLKKGFFESITKLTALQTL-ALG 601

Query: 426 CTRDILGRLPSEFELLESLKLVNELK------IPSQLSSIV-----------LPE-YQF- 466
             +    RL +    LE  K V E K      +P    + +           LPE ++F 
Sbjct: 602 IEKYSKKRLLNHLVGLERQKNVIEEKTLFPGLVPFSCHAYLDVVNLIGKFEKLPEQFEFY 661

Query: 467 PPSLIELSLANTELRDDPMPKPKKLLHLQVLKLKKNSFIGRKLICRFGCF---------- 516
           PP+L++L L + ELRDDPM   +KL  L+ L+L  ++++G+K+IC  G F          
Sbjct: 662 PPNLLKLGLWDCELRDDPMMILEKLPSLRKLELGSDAYVGKKMICSSGGFLQLESLILIG 721

Query: 517 -PSLKEWIVEFEAIPKLESLIINPCAHLKRLPEDLWRVKSLTKLELWWPRFELRERLRKF 575
              L+E  VE  A+  L++L I  C  +K+LP  L ++ +L KL L    +   E + + 
Sbjct: 722 LNKLEELTVEEGAMSSLKTLEIWSCGKMKKLPHGLLQLTNLEKLSLRGSSY--HESIEEI 779

Query: 576 ENRELFLWNVIR 587
           E      W+ +R
Sbjct: 780 EKAGGEDWDKLR 791

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|15238507|ref|NP_198395.1| disease resistance RPP8-like protein 3 [Arabidopsis thaliana] gi|29839623|sp|Q9FJB5.1|RP8L3_ARATH RecName: Full=Disease resistance RPP8-like protein 3 gi|9758146|dbj|BAB08703.1| disease resistance protein [Arabidopsis thaliana] gi|110742305|dbj|BAE99077.1| disease resistance protein [Arabidopsis thaliana] gi|332006585|gb|AED93968.1| disease resistance RPP8-like protein 3 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297837557\|ref\|XP_002886660.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297332501\|gb\|EFH62919.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi|15217954|ref|NP_176135.1| CC-NBS-LRR class disease resistance protein [Arabidopsis thaliana] gi|374095512|sp|Q8W474.4|DRL7_ARATH RecName: Full=Probable disease resistance protein At1g58390 gi|12321042|gb|AAG50638.1|AC082643_2 disease resistance protein, putative [Arabidopsis thaliana] gi|18181933|dbj|BAB83871.1| disease resistance protein [Arabidopsis thaliana] gi|332195423|gb|AEE33544.1| CC-NBS-LRR class disease resistance protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297734140\|emb\|CBI15387.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|32364518\|gb\|AAP80287.1\| resistance protein Sorb5 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|32364507\|gb\|AAP80281.1\| resistance protein Hod3 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|359491404\|ref\|XP_002274414.2\| PREDICTED: probable disease resistance RPP8-like protein 2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255577203\|ref\|XP_002529484.1\| conserved hypothetical protein [Ricinus communis] gi\|223531042\|gb\|EEF32894.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|297745212\|emb\|CBI40292.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		589
TAIR\|locus:2169523		901	AT5G35450 [Arabidopsis thalian	0.237	0.155	0.320	1.4e-17
TAIR\|locus:2025916		906	AT1G59780 "AT1G59780" [Arabido	0.344	0.224	0.278	1.9e-15
TAIR\|locus:2152536		908	AT5G48620 [Arabidopsis thalian	0.244	0.158	0.320	2.6e-15
TAIR\|locus:2176486		908	RPP8 "RECOGNITION OF PERONOSPO	0.314	0.203	0.301	3.7e-14
TAIR\|locus:504956184		1017	AT1G58807 "AT1G58807" [Arabido	0.322	0.186	0.279	3e-11
TAIR\|locus:2827038		1017	AT1G59124 "AT1G59124" [Arabido	0.322	0.186	0.279	3e-11
TAIR\|locus:2037639		907	AT1G58390 "AT1G58390" [Arabido	0.314	0.203	0.274	1.2e-10
TAIR\|locus:504956182		1049	AT1G58848 [Arabidopsis thalian	0.325	0.183	0.277	1.4e-10
TAIR\|locus:2826978		1049	AT1G59218 [Arabidopsis thalian	0.325	0.183	0.277	1.4e-10
TAIR\|locus:2037623		899	AT1G58410 [Arabidopsis thalian	0.235	0.154	0.3	9.2e-09

TAIR\|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 165 (63.1 bits), Expect = 1.4e-17, Sum P(4) = 1.4e-17
 Identities = 52/162 (32%), Positives = 76/162 (46%)

Query:   412 LENLNFISVLHPSSCTRDILGRLPSEFELLESLKL-VNELKIPSQLSSIVLPEYQFPPSL 470
             LE L+FI      +   D +G    +F  L+ L L V+  KIP Q        +Q PP +
Sbjct:   714 LETLSFI--YSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIPDQ--------HQLPPHI 763

Query:   471 IELSLANTELRDDPMPXXXXXXXXXXXXXXXNSFIGRKLICRFGCFPSLK---------- 520
               + L    + +DPMP                +FIGR+++C  G FP L+          
Sbjct:   764 AHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFPQLRALQISEQSEL 823

Query:   521 -EWIVEFEAIPKLESLIINPCAHLKRLPEDLWRVKSLTKLEL 561
              EWIVE  ++P L  LII+ C  L+ LP+ L  V SL +L++
Sbjct:   824 EEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKI 865

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

GO:0005886 "plasma membrane" evidence=IDA

TAIR\|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		589
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	2e-11

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score = 64.7 bits (158), Expect = 2e-11
 Identities = 59/236 (25%), Positives = 89/236 (37%), Gaps = 50/236 (21%)

Query: 130 VHAW--VSFDTDPGTMLDNILKYVMPQSAFREILYKDFEKRKTALHDYLKNKRYLIVLYD 187
             AW  VS       +  +IL+ +    +  + + K+  +    + + L  KR+L+VL D
Sbjct: 51  SVAWVVVSKTYTEFRLQKDILQELGLDDS--DWVEKNESELAVKIKEALLRKRFLLVLDD 108

Query: 188 VFTNDVWDYLGEALPDHQNGSRVLVILFDDEI----------FNLCILENED-------- 229
           V+  + WD +G   PD +NGSRV+V    + +            +  LE E+        
Sbjct: 109 VWEKNDWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNK 168

Query: 230 --MINLDSVPATP-----LRATYQERPLVCLYYGS-----------ESLAENMKLTWLIR 271
                L   P        +    +  PL     G            E + E   L   + 
Sbjct: 169 VFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQ--LNNELA 226

Query: 272 KRSPL--------FSIAQLPQRLKLCCLYLSACREGFEISTRQLNQLWIAEGFIPE 319
            R  L         S   LP  LK C LYL+   E + I   QL +LWIAEGF+  
Sbjct: 227 GRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIP 282

Length = 285

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		589
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.97
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.83
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.82
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.82
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.72
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.69
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.68
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.67
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.64
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.61
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.59
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.57
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.53
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.51
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.48
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.47
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.43
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.37
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.24
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.23
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.17
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.16
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.03
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.0
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.89
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.88
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.82
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.76
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.69
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.65
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.64
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.6
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.6
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.39
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.37
PLN03150		623	hypothetical protein; Provisional	98.34
PLN03150		623	hypothetical protein; Provisional	98.31
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.29
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.29
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.27
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.21
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.14
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.03
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.02
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.89
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.86
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.66
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.58
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.52
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.48
PRK15386		426	type III secretion protein GogB; Provisional	97.44
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.39
PRK15386		426	type III secretion protein GogB; Provisional	97.3
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.12
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.04
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.04
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.03
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.98
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.83
KOG4341		483	consensus F-box protein containing LRR [General fu	96.42
KOG4341		483	consensus F-box protein containing LRR [General fu	96.39
PRK00411		394	cdc6 cell division control protein 6; Reviewed	96.37
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	96.26
PRK04841		903	transcriptional regulator MalT; Provisional	96.21
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.86
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.77
PF05729		166	NACHT: NACHT domain	95.53
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.36
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.28
KOG1947		482	consensus Leucine rich repeat proteins, some prote	94.86
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.69
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	94.57
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	94.47
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.7
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.64
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	93.32
KOG0473		326	consensus Leucine-rich repeat protein [Function un	91.99
PRK05564		313	DNA polymerase III subunit delta'; Validated	91.38
PF13173		128	AAA_14: AAA domain	91.2
smart00370		26	LRR Leucine-rich repeats, outliers.	90.51
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	90.51
PRK06893		229	DNA replication initiation factor; Validated	90.21
PTZ00112		1164	origin recognition complex 1 protein; Provisional	88.84
smart00370		26	LRR Leucine-rich repeats, outliers.	88.36
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	88.36
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	87.14
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	86.72
PRK13342		413	recombination factor protein RarA; Reviewed	86.71
KOG1947		482	consensus Leucine rich repeat proteins, some prote	86.33
KOG2543		438	consensus Origin recognition complex, subunit 5 [R	85.08
KOG0473		326	consensus Leucine-rich repeat protein [Function un	84.45
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	84.19
KOG3864		221	consensus Uncharacterized conserved protein [Funct	83.44
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	82.86

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=3.1e-57  Score=504.86  Aligned_cols=531  Identities=25%  Similarity=0.345  Sum_probs=364.8

Q ss_pred             ccchHHHHHHHHHHHHHHhhhhhHHhHhhhccccccccccc------cc--ccchhhhhHHHHHHHHHHHHHh---hccc
Q 007787            2 TLAYQNLERILKETNYLVRESEKVICTFIMSNIQQNGDQGC------SK--ELCDALVGLESKFTDIKQQLHQ---VQPR   70 (589)
Q Consensus         2 ~~~~~~v~~Wl~~l~~~ayd~ed~ld~~~~~~~~~~~~~~~------~~--~~~~~r~~~~~~i~~i~~~l~~---~~~~   70 (589)
                      +...+.+..|.+.+++++|++||.++.|..+....+.....      .+  ++...+++.+..+..+.+++..   ..+.
T Consensus        51 ~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~  130 (889)
T KOG4658|consen   51 RDDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVES  130 (889)
T ss_pred             cchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHH
Confidence            34557788999999999999999999999877654321111      11  1112455555555555555544   2233


Q ss_pred             cccccC----CC-CCccccc-cccCCCCCCccccchhhHHHHHHHHHcCCCCceEEEEEE--------------------
Q 007787           71 YNIDFS----LW-MGELKIM-CLLHLQRDNMMSLQDDAMVELLDQLIEGPLQLSVVAIID--------------------  124 (589)
Q Consensus        71 ~~~~~~----~~-~~~~~~r-~~~~~~~~~~vGr~~~~~~~i~~~L~~~~~~~~vi~IvG--------------------  124 (589)
                      ++....    .. ..+...+ +.+...+.. ||.++. ++++++.|++++.  .++||+|                    
T Consensus       131 l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~-VG~e~~-~~kl~~~L~~d~~--~iv~i~GMGGvGKTTL~~qi~N~~~~v  206 (889)
T KOG4658|consen  131 LGSKGVFEVVGESLDPREKVETRPIQSESD-VGLETM-LEKLWNRLMEDDV--GIVGIYGMGGVGKTTLARQIFNKFDEV  206 (889)
T ss_pred             hccccceecccccccchhhcccCCCCcccc-ccHHHH-HHHHHHHhccCCC--CEEEEECCCcccHHHHHHHHhcccchh
Confidence            332221    11 1111122 444444555 999999 9999999998874  8999999                    


Q ss_pred             --eeCCceEEEEEE--eCCHHHHHHHHHHHhCCCCccccccccCHHHHHHHHHHHcCCceEEEEEecCCChhhHHHHhhh
Q 007787          125 --SFILIVHAWVSF--DTDPGTMLDNILKYVMPQSAFREILYKDFEKRKTALHDYLKNKRYLIVLYDVFTNDVWDYLGEA  200 (589)
Q Consensus       125 --~F~~~~~~wv~v--~~~~~~i~~~il~~l~~~~~~~~~~~~~~~~~~~~l~~~L~~kr~LlVLDDvw~~~~w~~l~~~  200 (589)
                        +||  .+|||+|  +|+..+|+++|+..++....  .++..+.++++..|.+.|++|||+|||||||+..+|+.++.+
T Consensus       207 ~~~Fd--~~iWV~VSk~f~~~~iq~~Il~~l~~~~~--~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~  282 (889)
T KOG4658|consen  207 GNHFD--GVIWVVVSKEFTTRKIQQTILERLGLLDE--EWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVP  282 (889)
T ss_pred             cccCc--eEEEEEEcccccHHhHHHHHHHHhccCCc--ccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCC
Confidence              899  9999999  99999999999999887332  023444579999999999999999999999999999999999


Q ss_pred             cCCCCCCcEEEEecccCcE----------EecCCCChHHHHHhhccccCCCCCC---------------CCCCchhhhcc
Q 007787          201 LPDHQNGSRVLVILFDDEI----------FNLCILENEDMINLDSVPATPLRAT---------------YQERPLVCLYY  255 (589)
Q Consensus       201 l~~~~~gs~IivTTR~~~v----------~~l~~L~~~~~~~Lf~~~a~~~~~~---------------c~glPlai~~~  255 (589)
                      +|...+||||++|||++.|          +++.+|+++|||+||+++||.....               |+|+|||++++
T Consensus       283 ~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~vi  362 (889)
T KOG4658|consen  283 FPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVL  362 (889)
T ss_pred             CCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHH
Confidence            9999999999999999999          9999999999999999999987321               99999999999


Q ss_pred             cc-----------hhHhhccchhhhhcc------CC---Cc-eecCCCCcchhhHhhhccccCCCeeechhhHHHHHHhh
Q 007787          256 GS-----------ESLAENMKLTWLIRK------RS---PL-FSIAQLPQRLKLCCLYLSACREGFEISTRQLNQLWIAE  314 (589)
Q Consensus       256 g~-----------~~~~~~~~~~~~~~~------~~---~l-lsy~~L~~~lk~cfl~~~~fp~~~~~~~~~L~~l~~~~  314 (589)
                      |+           +++.+.  ..+.+..      +.   ++ +||++||.++|.||+|||+||+||.|..+.|+.+|+|+
T Consensus       363 G~~ma~K~t~~eW~~~~~~--l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaE  440 (889)
T KOG4658|consen  363 GGLLACKKTVQEWRRALNV--LKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAE  440 (889)
T ss_pred             HHHhcCCCcHHHHHHHHcc--ccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhc
Confidence            99           334444  3333221      11   22 99999998899999999999999999999999999999


Q ss_pred             CCCcc-----Ccc-------------------------------------------------------------------
Q 007787          315 GFIPE-----TAR-------------------------------------------------------------------  322 (589)
Q Consensus       315 ~~i~~-----~le-------------------------------------------------------------------  322 (589)
                      ||+..     +++                                                                   
T Consensus       441 Gfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~  520 (889)
T KOG4658|consen  441 GFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVK  520 (889)
T ss_pred             cCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCcccccccc
Confidence            99961     211                                                                   


Q ss_pred             ---------------------------cEEEEcCCC--CccCCc-ccCCCCCCCEEEeecC-CccccchhhcCCCCccEE
Q 007787          323 ---------------------------KLLNLGTIV--LEEYPA-GINLLLLLKYLKLNIP-YLKHLPASLCNLLNLYTI  371 (589)
Q Consensus       323 ---------------------------r~L~L~~n~--l~~~p~-~~~~l~~Lr~L~L~~~-~i~~lp~~i~~L~~L~~L  371 (589)
                                                 +.|-+.+|.  +..++. .|..+++||+|||++| .+.++|.+|+.|-+|++|
T Consensus       521 ~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL  600 (889)
T KOG4658|consen  521 SWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYL  600 (889)
T ss_pred             chhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcc
Confidence                                       334445553  333333 2556888888888866 466888888888888888


Q ss_pred             EecCCccccccccccccccCceeeec----CcccCCcccccCCCCcccccccccC--CCCchhhhhcCcc----------
Q 007787          372 DMPSSYVRCTPDSIGKMHELRHLNFR----TITLPAHPGKFCTSLENLNFISVLH--PSSCTRDILGRLP----------  435 (589)
Q Consensus       372 ~L~~~~l~~lp~~~~~L~~L~~L~l~----~~~lp~~i~~~l~~L~~L~l~~~~~--~~~~~~~~l~~L~----------  435 (589)
                      +++++.+..+|.++.+|.+|.+|++.    ...+|.... .|++|++|.+.....  ......+ +..|.          
T Consensus       601 ~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~-~L~~Lr~L~l~~s~~~~~~~~l~e-l~~Le~L~~ls~~~~  678 (889)
T KOG4658|consen  601 DLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILL-ELQSLRVLRLPRSALSNDKLLLKE-LENLEHLENLSITIS  678 (889)
T ss_pred             cccCCCccccchHHHHHHhhheeccccccccccccchhh-hcccccEEEeeccccccchhhHHh-hhcccchhhheeecc
Confidence            88888888888888888888888887    122233333 577777777655431  2223333 32110          


Q ss_pred             -----------------------------------cCCCCCCeEEEeeCCCCC-------C--------CCcee-----c
Q 007787          436 -----------------------------------SEFELLESLKLVNELKIP-------S--------QLSSI-----V  460 (589)
Q Consensus       436 -----------------------------------~~l~~L~~L~l~~~~~lp-------~--------~L~~L-----~  460 (589)
                                                         ..+.+|+.|.+...+...       .        ++.++     .
T Consensus       679 s~~~~e~l~~~~~L~~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~  758 (889)
T KOG4658|consen  679 SVLLLEDLLGMTRLRSLLQSLSIEGCSKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCH  758 (889)
T ss_pred             hhHhHhhhhhhHHHHHHhHhhhhcccccceeecccccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccc
Confidence                                               234455555555422100       0        00000     1


Q ss_pred             CCC----CCCCCCccEEEEEeecCCCCCCCCcccccccceeEEecCcccCceeeEecCCCCCCCccccCcccccccceee
Q 007787          461 LPE----YQFPPSLIELSLANTELRDDPMPKPKKLLHLQVLKLKKNSFIGRKLICRFGCFPSLKEWIVEFEAIPKLESLI  536 (589)
Q Consensus       461 lp~----~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~~~f~~L~~l~~~~~~l~~L~~L~  536 (589)
                      .|.    ....++|+.|.+..|.....+++....+..+..+.+..+.+.+..+..+.++|+++-..|..   +++|+.+.
T Consensus       759 ~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l~---~~~l~~~~  835 (889)
T KOG4658|consen  759 MLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALLELKELILPFNKLEGLRMLCSLGGLPQLYWLPLS---FLKLEELI  835 (889)
T ss_pred             cccccchhhccCcccEEEEecccccccCCCHHHHhhhcccEEecccccccceeeecCCCCceeEecccC---ccchhhee
Confidence            111    23556777777777776666666666666666666656666665545556666666444433   23366666


Q ss_pred             EeecCCCCCCc
Q 007787          537 INPCAHLKRLP  547 (589)
Q Consensus       537 L~~n~~l~~lp  547 (589)
                      +..||.++.+|
T Consensus       836 ve~~p~l~~~P  846 (889)
T KOG4658|consen  836 VEECPKLGKLP  846 (889)
T ss_pred             hhcCcccccCc
Confidence            66666555444

>PLN03210 Resistant to P	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		589
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-10
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	6e-08
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	6e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-04
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	7e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 79.5 bits (195), Expect = 1e-15
 Identities = 92/585 (15%), Positives = 180/585 (30%), Gaps = 166/585 (28%)

Query: 3   LAYQNLERILKETN----------YLVRESEKVICTFIMSNIQQNGDQGCS--KELCDAL 50
           L+ + ++ I+   +           L+ + E+++  F+   ++ N     S  K      
Sbjct: 46  LSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQP 105

Query: 51  VGLESKFTDIKQQLH---QVQPRYNIDFSLWMGELKIMCLLHLQRDNMMSLQDDAMVELL 107
             +   + + + +L+   QV  +YN+         ++   L L R  ++ L+    V   
Sbjct: 106 SMMTRMYIEQRDRLYNDNQVFAKYNVS--------RLQPYLKL-RQALLELRPAKNV--- 153

Query: 108 DQLIEGP-------LQLSVV---AIIDSFILIVHAWVSF--DTDPGT---MLDNILKYVM 152
             LI+G        + L V     +       +  W++      P T   ML  +L  + 
Sbjct: 154 --LIDGVLGSGKTWVALDVCLSYKVQCKMDFKIF-WLNLKNCNSPETVLEMLQKLLYQID 210

Query: 153 PQSAFR----EILYKDFEKRKTALHDYLKNKRY---LIVLYDVFTNDVWDYLGEALPDHQ 205
           P    R      +       +  L   LK+K Y   L+VL +V     W+          
Sbjct: 211 PNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFN------- 263

Query: 206 NGSRVLVILFDDEIFNLCILENEDMINLDSVPAT---------------------PLRAT 244
              ++L+     ++ +         I+LD    T                     P    
Sbjct: 264 LSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVL 323

Query: 245 YQERPLVCLYYGSESLAENMKLTW------LIRKRSPLF--SIAQL-PQRLKLCCLYLSA 295
               P        ES+  +   TW         K + +   S+  L P   +     LS 
Sbjct: 324 -TTNPRRLSIIA-ESI-RDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSV 380

Query: 296 CREGFEISTRQLNQLWIA------EGFIPETARKLLNLGTIVLEEYPA----GINLLLLL 345
                 I T  L+ +W           + +  +  L      +E+ P      I  + L 
Sbjct: 381 FPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSL------VEKQPKESTISIPSIYLE 434

Query: 346 KYLKLNIPYLKHLPASLCNLLNLYTIDMPSSYVRCTPDSIGK---MHELRHLN------- 395
             +KL   Y  H      ++++ Y I          P  + +    H   HL        
Sbjct: 435 LKVKLENEYALHR-----SIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPER 489

Query: 396 ---FRTITLPAHPGKFCTSLENLNFI--------SVLHPSSCTRDILGRLP--------- 435
              FR + L            +  F+        +  + S    + L +L          
Sbjct: 490 MTLFRMVFL------------DFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDN 537

Query: 436 -SEFELLESLKLVNELK--IPSQLSSIVLPEYQFPPSLIELSLAN 477
             ++E     +LVN +   +P    +++  +Y     L+ ++L  
Sbjct: 538 DPKYE-----RLVNAILDFLPKIEENLICSKYT---DLLRIALMA 574

PyMOL of 1vt4

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		589
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.96
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.93
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.9
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.89
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.88
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.88
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.88
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.87
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.87
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.86
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.86
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.85
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.85
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.85
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.85
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.85
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.85
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.85
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.84
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.83
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.83
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.83
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.83
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.83
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.83
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.82
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.82
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.82
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.82
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.81
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.81
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.81
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.81
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.81
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.81
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.8
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.8
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.8
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.8
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.8
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.8
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.79
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.79
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.79
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.79
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.79
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.79
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.79
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.79
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.78
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.78
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.78
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.78
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.78
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.78
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.78
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.77
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.76
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.76
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.76
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.76
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.76
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.75
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.75
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.75
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.73
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.73
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.73
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.73
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.72
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.72
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.71
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.71
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.71
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.71
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.69
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.69
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.69
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.66
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.65
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.65
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.65
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.65
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.65
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.64
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.64
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.63
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.63
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.61
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.61
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.6
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.6
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.59
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.59
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.58
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.57
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.54
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.54
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.54
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.53
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.51
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.5
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.49
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.48
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.48
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.48
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.48
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.48
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.48
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.48
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.46
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.46
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.45
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.45
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.44
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.43
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.42
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.42
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.4
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.4
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.39
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.27
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.24
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.23
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.22
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.22
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.21
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.2
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.18
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.15
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.14
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.14
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.13
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.11
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.11
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.09
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.01
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.99
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.96
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.96
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.94
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.92
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.9
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.86
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.85
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.79
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.63
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.5
3qfl_A		115	MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-	98.42
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.37
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.35
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.32
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.3
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.0
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.73
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	97.67
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.61
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.61
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.6
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	97.57
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.37
2fna_A		357	Conserved hypothetical protein; structural genomic	97.22
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.13
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.08
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	97.04
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	96.89
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	96.88
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	96.61
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	96.56
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	96.4
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	96.3
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	96.25
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.95
2chg_A		226	Replication factor C small subunit; DNA-binding pr	95.55
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	94.98
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.1
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	94.06
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	91.58
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	91.02
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	90.22
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	88.17

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

Probab=99.96  E-value=1.4e-29  Score=276.20  Aligned_cols=210  Identities=15%  Similarity=0.160  Sum_probs=165.7

Q ss_pred             cccchhhHHHHHHHHHcC-CCCceEEEEEE-----------------------eeCCceEEEEEE-e---CCHHHHHHHH
Q 007787           96 MSLQDDAMVELLDQLIEG-PLQLSVVAIID-----------------------SFILIVHAWVSF-D---TDPGTMLDNI  147 (589)
Q Consensus        96 vGr~~~~~~~i~~~L~~~-~~~~~vi~IvG-----------------------~F~~~~~~wv~v-~---~~~~~i~~~i  147 (589)
                      |||+++ +++|+++|..+ +..++||+|||                       +|+  .++||+| .   +++.+++++|
T Consensus       131 ~GR~~~-~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~--~~~wv~vs~~~~~~~~~~~~~i  207 (549)
T 2a5y_B          131 YIREYH-VDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYD--SIVWLKDSGTAPKSTFDLFTDI  207 (549)
T ss_dssp             CCCHHH-HHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBS--EEEEEECCCCSTTHHHHHHHHH
T ss_pred             CCchHH-HHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCC--cEEEEEECCCCCCCHHHHHHHH
Confidence            799999 99999999765 45689999999                       599  9999999 3   4899999999


Q ss_pred             HHHhCCCCc---cccccccCHHHHHHHHHHHcCCc-eEEEEEecCCChhhHHHHhhhcCCCCCCcEEEEecccCcE----
Q 007787          148 LKYVMPQSA---FREILYKDFEKRKTALHDYLKNK-RYLIVLYDVFTNDVWDYLGEALPDHQNGSRVLVILFDDEI----  219 (589)
Q Consensus       148 l~~l~~~~~---~~~~~~~~~~~~~~~l~~~L~~k-r~LlVLDDvw~~~~w~~l~~~l~~~~~gs~IivTTR~~~v----  219 (589)
                      +.++.....   .+..+..+.+.++..+++.|++| ||||||||||+.+.+ .+..     .+||+||||||++.|    
T Consensus       208 l~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~~~-----~~gs~ilvTTR~~~v~~~~  281 (549)
T 2a5y_B          208 LLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-RWAQ-----ELRLRCLVTTRDVEISNAA  281 (549)
T ss_dssp             HHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-HHHH-----HTTCEEEEEESBGGGGGGC
T ss_pred             HHHHhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-cccc-----cCCCEEEEEcCCHHHHHHc
Confidence            999987531   11133456778899999999996 999999999998754 2211     169999999999666    


Q ss_pred             ------EecCCCChHHHHHhhccccCCCCC-C------------CCCCchhhhcccc---hhHh---hccc-hhhhhccC
Q 007787          220 ------FNLCILENEDMINLDSVPATPLRA-T------------YQERPLVCLYYGS---ESLA---ENMK-LTWLIRKR  273 (589)
Q Consensus       220 ------~~l~~L~~~~~~~Lf~~~a~~~~~-~------------c~glPlai~~~g~---~~~~---~~~~-~~~~~~~~  273 (589)
                            |++++|++++||+||.++||+... .            |+|+|||++++|+   ..-|   +.+. ..+.....
T Consensus       282 ~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~w~~~~~l~~~l~~~~~~  361 (549)
T 2a5y_B          282 SQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLV  361 (549)
T ss_dssp             CSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSS
T ss_pred             CCCCeEEECCCCCHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHhCCChHHHHHHHHHhccchHHHHHHhHHHhhcccHH
Confidence                  899999999999999999998764 2            9999999999998   1111   2200 12222222


Q ss_pred             C---Cc-eecCCCCcchhhHhh-----------hccccCCCeeechhhHHHHHHhh--CCCc
Q 007787          274 S---PL-FSIAQLPQRLKLCCL-----------YLSACREGFEISTRQLNQLWIAE--GFIP  318 (589)
Q Consensus       274 ~---~l-lsy~~L~~~lk~cfl-----------~~~~fp~~~~~~~~~L~~l~~~~--~~i~  318 (589)
                      .   .+ +||++||.++|.||+           |||+||+++.+.    +.+|+++  ||+.
T Consensus       362 ~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~  419 (549)
T 2a5y_B          362 GVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDIC  419 (549)
T ss_dssp             TTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC---
T ss_pred             HHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceec
Confidence            2   22 999999999999999           999999999888    8999999  8886

PyMOL of 2a5y

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		589
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.94
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.83
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.78
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.76
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.75
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.71
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.69
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.67
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.65
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.64
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.6
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.59
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.57
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.53
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.51
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.51
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.51
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.5
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.49
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.37
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.32
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.26
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.21
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.2
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.2
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.14
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.1
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.09
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.09
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.93
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.89
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.83
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.74
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.68
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.67
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.57
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.42
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.37
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.24
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.56
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.29
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.03
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.01
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	92.94
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	85.02

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.94  E-value=7.1e-28  Score=236.62  Aligned_cols=193  Identities=14%  Similarity=0.124  Sum_probs=147.0

Q ss_pred             CCCCCccccchhhHHHHHHHHHc-CCCCceEEEEEE-----------------------eeCCceEEEEEE--eCCHHHH
Q 007787           90 LQRDNMMSLQDDAMVELLDQLIE-GPLQLSVVAIID-----------------------SFILIVHAWVSF--DTDPGTM  143 (589)
Q Consensus        90 ~~~~~~vGr~~~~~~~i~~~L~~-~~~~~~vi~IvG-----------------------~F~~~~~~wv~v--~~~~~~i  143 (589)
                      ..++.+|||+.+ +++|+++|.. .+.+.++|+|+|                       +|+  +++||+|  .++...+
T Consensus        17 p~~~~~~gR~~~-~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~--~~~Wv~vs~~~~~~~l   93 (277)
T d2a5yb3          17 PKQMTCYIREYH-VDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYD--SIVWLKDSGTAPKSTF   93 (277)
T ss_dssp             BCCCCSCCCHHH-HHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBS--EEEEEECCCCSTTHHH
T ss_pred             CCCCceeCcHHH-HHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCc--eEEEEEecCCCCHHHH
Confidence            356779999999 9999999975 445689999999                       689  9999999  7777776


Q ss_pred             HHHHHHHh---CCCC--cccc-ccccCHHHHHHHHHHHcCCceEEEEEecCCChhhHHHHhhhcCCCCCCcEEEEecccC
Q 007787          144 LDNILKYV---MPQS--AFRE-ILYKDFEKRKTALHDYLKNKRYLIVLYDVFTNDVWDYLGEALPDHQNGSRVLVILFDD  217 (589)
Q Consensus       144 ~~~il~~l---~~~~--~~~~-~~~~~~~~~~~~l~~~L~~kr~LlVLDDvw~~~~w~~l~~~l~~~~~gs~IivTTR~~  217 (589)
                      ...+...+   ....  ..+. ....+.......+.+.+.+||+|+||||||+.+.|+.+..      .|||||||||++
T Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~  167 (277)
T d2a5yb3          94 DLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDV  167 (277)
T ss_dssp             HHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBG
T ss_pred             HHHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhcc------cCceEEEEeehH
Confidence            66554433   2211  1111 2223344556678899999999999999999998886643      489999999998


Q ss_pred             cE----------EecCCCChHHHHHhhccccCCCCCC-------------CCCCchhhhcccc------hhHhhccchhh
Q 007787          218 EI----------FNLCILENEDMINLDSVPATPLRAT-------------YQERPLVCLYYGS------ESLAENMKLTW  268 (589)
Q Consensus       218 ~v----------~~l~~L~~~~~~~Lf~~~a~~~~~~-------------c~glPlai~~~g~------~~~~~~~~~~~  268 (589)
                      .|          |++++|+++|||+||++++|.....             |+|+|||++++|+      ...+.+  ..+
T Consensus       168 ~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~--~~~  245 (277)
T d2a5yb3         168 EISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQ--LNN  245 (277)
T ss_dssp             GGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHH--HHH
T ss_pred             HHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccCchhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHH--HHH
Confidence            77          8999999999999999999976543             9999999999999      123333  333


Q ss_pred             hhcc------CCCc-eecCCCCcchhhHhhhc
Q 007787          269 LIRK------RSPL-FSIAQLPQRLKLCCLYL  293 (589)
Q Consensus       269 ~~~~------~~~l-lsy~~L~~~lk~cfl~~  293 (589)
                      .+++      ..++ +||++||+++|.||-++
T Consensus       246 ~L~~~~~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         246 KLESRGLVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             HHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             HHhcCcHHHHHHHHHHHHhcccHHHHHHHHhC
Confidence            3332      1223 99999999999999763

PyMOL of d2a5yb3

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure