Citrus Sinensis ID: 007918

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-----

MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRESDLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVRRSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDDSVRLLAVEGCAALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPLLGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHITPQVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQSIDHVMMSS

ccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccc

ccccccccHHHHHHHHHcccccHHHHHHHHHcHHHHHHHccHHHHHHcHHHHHHHcccccHHHHHHHHHHHccccHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHccHHHHHHHcHHHHHHHHccccHHHHHHHHHcHHHHHHHHcHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHcHHHHHHHHcccccccccHHHHHHHHHHHHHHHcc

mamvdeplyPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELipflsenndddDEVLLAMAEELGVFipyvggvehahvllppletlctveetCVRDKAVESLCRIGsqmresdlvdwYIPLVKRLAAGEWFTARVSACGLfhiaypsapdILKTELRSIYTQLcqddmpmvRRSAASNLgkfaatvepahlkTDIMSIFEDLTQDDSVRLLAVEGCAAlgkllepqdcvahILPVIVNFSQDKSWRVRYMVANQLYELCeavgpeptrmdlvPAYVRLLRDNEAEVRIAAAGKVTKFCRILNPELAIQHILPCvkelssdssQHVRSALASVIMGmapllgkdatIEQLLPIFLSLlkdefpdvRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLAsqlgvgffddKLGALCMQWLQDKVYSIRDAAANNLKRLAEefgpewamqhitpqvleminnphyLYRMTILRAISLLapvmgseitcsrllpvvinaskdrvpniKFNVAKVLQSLIpivdqsmvekTIRPClveltedpdvdvRFFATQAIQSIDHVMMSS

MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIaralgeertrkelipflsennddDDEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCrigsqmresdlvdWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVRRSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDDSVRLLAVEGCAALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYELCeavgpeptrMDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPLLGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHITPQVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVINASKDRVPNIKFNVAKVLQSlipivdqsmvEKTIRPCLVEltedpdvdvRFFATQAiqsidhvmmss

******PLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLS*****DDEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRESDLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVRRSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDDSVRLLAVEGCAALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRILNPELAIQHILPCVKEL******HVRSALASVIMGMAPLLGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHITPQVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQSID******

*A***EPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRESDLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVRRSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDDSVRLLAVEGCAALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPLLGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHITPQVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQSIDHVMM**

MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRESDLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVRRSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDDSVRLLAVEGCAALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRILNPELAIQHILPCVKE**********SALASVIMGMAPLLGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHITPQVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQSIDHVMMSS

*****EPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRESDLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVRRSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDDSVRLLAVEGCAALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPLLGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHITPQVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQSIDHVMMS*

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		585	2.2.26 [Sep-21-2011]
Q38950		587	Serine/threonine-protein	yes	no	1.0	0.996	0.935	0.0
Q38951		587	Serine/threonine-protein	no	no	1.0	0.996	0.911	0.0
Q38845		588	Serine/threonine-protein	no	no	0.989	0.984	0.874	0.0
P36875		395	Protein phosphatase PP2A	N/A	no	0.670	0.992	0.888	0.0
Q32PI5		589	Serine/threonine-protein	yes	no	0.976	0.969	0.589	0.0
P30153		589	Serine/threonine-protein	yes	no	0.976	0.969	0.589	0.0
P54612		589	Serine/threonine-protein	yes	no	0.976	0.969	0.589	0.0
Q76MZ3		589	Serine/threonine-protein	yes	no	0.976	0.969	0.589	0.0
P54613		602	Serine/threonine-protein	no	no	0.976	0.948	0.578	0.0
Q4QQT4		601	Serine/threonine-protein	no	no	0.976	0.950	0.578	0.0

>sp\|Q38950\|2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana GN=PP2AA2 PE=1 SV=2	Back alignment and function desciption

 Score = 1129 bits (2919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/587 (93%), Positives = 574/587 (97%), Gaps = 2/587 (0%)

Query: 1   MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD 60
           M+M+DEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct: 1   MSMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD 60

Query: 61  DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES 120
           DEVLLAMAEELGVFIPYVGGVE+AHVLLPPLETL TVEETCVR+KAVESLCR+GSQMRES
Sbjct: 61  DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMRES 120

Query: 121 DLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVR 180
           DLVD +I LVKRLAAGEWFTARVSACG+FHIAYPSAPD+LKTELRS+YTQLCQDDMPMVR
Sbjct: 121 DLVDHFISLVKRLAAGEWFTARVSACGVFHIAYPSAPDMLKTELRSLYTQLCQDDMPMVR 180

Query: 181 RSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDD--SVRLLAVEGCAALGKLLEPQDCVA 238
           R+AA+NLGKFAATVE AHLKTD+MS+FEDLTQDD  SVRLLAVEGCAALGKLLEPQDCV 
Sbjct: 181 RAAATNLGKFAATVESAHLKTDVMSMFEDLTQDDQDSVRLLAVEGCAALGKLLEPQDCVQ 240

Query: 239 HILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAA 298
           HILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTR +LVPAYVRLLRDNEAEVRIAA
Sbjct: 241 HILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAA 300

Query: 299 AGKVTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPLLGKDATIEQLL 358
           AGKVTKFCRILNPE+AIQHILPCVKELSSDSSQHVRSALASVIMGMAP+LGKDATIE LL
Sbjct: 301 AGKVTKFCRILNPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLL 360

Query: 359 PIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEY 418
           PIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEY
Sbjct: 361 PIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEY 420

Query: 419 IPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHITPQV 478
           IPLLASQLGVGFFDDKLGALCMQWLQDKV+SIRDAAANNLKRLAEEFGPEWAMQHI PQV
Sbjct: 421 IPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANNLKRLAEEFGPEWAMQHIVPQV 480

Query: 479 LEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVINASKDRVPNIKFNVAKVLQS 538
           LEM+NNPHYLYRMTILRA+SLLAPVMGSEITCS+LLPVV+ ASKDRVPNIKFNVAKVLQS
Sbjct: 481 LEMVNNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVMTASKDRVPNIKFNVAKVLQS 540

Query: 539 LIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQSIDHVMMSS 585
           LIPIVDQS+VEKTIRP LVEL+EDPDVDVRFFA QA+QSID+VMMSS
Sbjct: 541 LIPIVDQSVVEKTIRPGLVELSEDPDVDVRFFANQALQSIDNVMMSS 587

The A subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. Involved during developmental process such as seedling and floral developments. Seems to act as a negative regulator of PP2A catalytic activity.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q38951\|2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana GN=PP2AA3 PE=1 SV=2	Back alignment and function description

>sp\|Q38845\|2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana GN=PP2AA1 PE=1 SV=1	Back alignment and function description

>sp\|P36875\|2AAA_PEA Protein phosphatase PP2A regulatory subunit A (Fragment) OS=Pisum sativum PE=2 SV=1	Back alignment and function description

>sp\|Q32PI5\|2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus GN=PPP2R1A PE=1 SV=1	Back alignment and function description

>sp\|P30153\|2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens GN=PPP2R1A PE=1 SV=4	Back alignment and function description

>sp\|P54612\|2AAA_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Sus scrofa GN=PPP2R1A PE=2 SV=2	Back alignment and function description

>sp\|Q76MZ3\|2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus GN=Ppp2r1a PE=1 SV=3	Back alignment and function description

>sp\|P54613\|2AAB_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (Fragment) OS=Sus scrofa GN=PPP2R1B PE=2 SV=1	Back alignment and function description

>sp\|Q4QQT4\|2AAB_RAT Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Rattus norvegicus GN=Ppp2r1b PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		585
255576493		587	serine/threonine protein phosphatase 2a	1.0	0.996	0.959	0.0
449434642		587	PREDICTED: serine/threonine-protein phos	1.0	0.996	0.952	0.0
353259711		587	serine/threonine protein phosphatase 2a	1.0	0.996	0.948	0.0
224101693		586	predicted protein [Populus trichocarpa]	0.998	0.996	0.943	0.0
15230896		587	protein phosphatase 2A subunit A2 [Arabi	1.0	0.996	0.935	0.0
224108518		587	predicted protein [Populus trichocarpa]	1.0	0.996	0.935	0.0
297818092		587	hypothetical protein ARALYDRAFT_904748 [	1.0	0.996	0.933	0.0
683502		587	protein phosphatase 2A 65 kDa regulatory	1.0	0.996	0.933	0.0
225455902		587	PREDICTED: serine/threonine-protein phos	1.0	0.996	0.933	0.0
297734191		642	unnamed protein product [Vitis vinifera]	1.0	0.911	0.933	0.0

>gi\|255576493\|ref\|XP_002529138.1\| serine/threonine protein phosphatase 2a regulatory subunit A, putative [Ricinus communis] gi\|223531417\|gb\|EEF33251.1\| serine/threonine protein phosphatase 2a regulatory subunit A, putative [Ricinus communis]	Back alignment and taxonomy information

 Score = 1150 bits (2975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/587 (95%), Positives = 575/587 (97%), Gaps = 2/587 (0%)

Query: 1   MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD 60
           M+ VDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct: 1   MSTVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD 60

Query: 61  DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES 120
           DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES
Sbjct: 61  DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES 120

Query: 121 DLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVR 180
           DLVDW+IPLVKRLAAGEWFTARVSACGLFHIAYPSAPD+LK ELRSIY+QLCQDDMPMVR
Sbjct: 121 DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDVLKAELRSIYSQLCQDDMPMVR 180

Query: 181 RSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDD--SVRLLAVEGCAALGKLLEPQDCVA 238
           RSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDD  SVRLLAVEGCAALGKLLEPQDCVA
Sbjct: 181 RSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDDQDSVRLLAVEGCAALGKLLEPQDCVA 240

Query: 239 HILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAA 298
           HILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTR DLVPAYVRLLRDNEAEVRIAA
Sbjct: 241 HILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAA 300

Query: 299 AGKVTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPLLGKDATIEQLL 358
           AGKVTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAP+LGKDATIEQLL
Sbjct: 301 AGKVTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLL 360

Query: 359 PIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEY 418
           PIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEY
Sbjct: 361 PIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEY 420

Query: 419 IPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHITPQV 478
           IPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAM+HI PQV
Sbjct: 421 IPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMRHIIPQV 480

Query: 479 LEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVINASKDRVPNIKFNVAKVLQS 538
           LEM+ NPHYLYRMTILRAISLLAPVMGSEITCS+LLPVV  ASKDRVPNIKFNVAKVLQS
Sbjct: 481 LEMVTNPHYLYRMTILRAISLLAPVMGSEITCSKLLPVVATASKDRVPNIKFNVAKVLQS 540

Query: 539 LIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQSIDHVMMSS 585
           LI IVDQS+VEKTIRPCL EL+EDPDVDVRFFA QA+QSID+VMMSS
Sbjct: 541 LISIVDQSVVEKTIRPCLAELSEDPDVDVRFFANQALQSIDNVMMSS 587

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449434642\|ref\|XP_004135105.1\| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform-like [Cucumis sativus] gi\|449493464\|ref\|XP_004159301.1\| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|353259711\|gb\|AEQ75494.1\| serine/threonine protein phosphatase 2a regulatory subunit A [Rosa multiflora]	Back alignment and taxonomy information

>gi\|224101693\|ref\|XP_002312385.1\| predicted protein [Populus trichocarpa] gi\|222852205\|gb\|EEE89752.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi|15230896|ref|NP_189208.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana] gi|83287930|sp|Q38950.2|2AAB_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform; Short=AtA beta; Short=PP2A, subunit A, beta isoform gi|7939566|dbj|BAA95767.1| protein phosphotase 2a 65kd regulatory subunit [Arabidopsis thaliana] gi|27311765|gb|AAO00848.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis thaliana] gi|30725386|gb|AAP37715.1| At3g25800 [Arabidopsis thaliana] gi|332643548|gb|AEE77069.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|224108518\|ref\|XP_002314877.1\| predicted protein [Populus trichocarpa] gi\|118484366\|gb\|ABK94060.1\| unknown [Populus trichocarpa] gi\|222863917\|gb\|EEF01048.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297818092\|ref\|XP_002876929.1\| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. lyrata] gi\|297322767\|gb\|EFH53188.1\| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|683502\|emb\|CAA57528.1\| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|225455902\|ref\|XP_002276180.1\| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297734191\|emb\|CBI15438.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		585
TAIR\|locus:2085994		587	PP2AA2 "protein phosphatase 2A	1.0	0.996	0.935	1.8e-291
TAIR\|locus:2205354		587	PP2AA3 "AT1G13320" [Arabidopsi	1.0	0.996	0.911	6.1e-284
TAIR\|locus:2031165		588	RCN1 "AT1G25490" [Arabidopsis	0.989	0.984	0.874	5.6e-274
UNIPROTKB\|A5D973		589	PPP2R1A "Alpha isoform of regu	0.976	0.969	0.589	9.6e-176
UNIPROTKB\|Q32PI5		589	PPP2R1A "Serine/threonine-prot	0.976	0.969	0.589	9.6e-176
UNIPROTKB\|P30153		589	PPP2R1A "Serine/threonine-prot	0.976	0.969	0.589	1.6e-175
UNIPROTKB\|F1PX75		589	PPP2R1A "Uncharacterized prote	0.976	0.969	0.589	2e-175
UNIPROTKB\|P54612		589	PPP2R1A "Serine/threonine-prot	0.976	0.969	0.589	2e-175
MGI\|MGI:1926334		589	Ppp2r1a "protein phosphatase 2	0.976	0.969	0.589	2e-175
RGD\|620907		589	Ppp2r1a "protein phosphatase 2	0.976	0.969	0.589	2e-175

TAIR\|locus:2085994 PP2AA2 "protein phosphatase 2A subunit A2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2799 (990.4 bits), Expect = 1.8e-291, P = 1.8e-291
 Identities = 549/587 (93%), Positives = 574/587 (97%)

Query:     1 MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD 60
             M+M+DEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct:     1 MSMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD 60

Query:    61 DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES 120
             DEVLLAMAEELGVFIPYVGGVE+AHVLLPPLETL TVEETCVR+KAVESLCR+GSQMRES
Sbjct:    61 DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMRES 120

Query:   121 DLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVR 180
             DLVD +I LVKRLAAGEWFTARVSACG+FHIAYPSAPD+LKTELRS+YTQLCQDDMPMVR
Sbjct:   121 DLVDHFISLVKRLAAGEWFTARVSACGVFHIAYPSAPDMLKTELRSLYTQLCQDDMPMVR 180

Query:   181 RSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDD--SVRLLAVEGCAALGKLLEPQDCVA 238
             R+AA+NLGKFAATVE AHLKTD+MS+FEDLTQDD  SVRLLAVEGCAALGKLLEPQDCV 
Sbjct:   181 RAAATNLGKFAATVESAHLKTDVMSMFEDLTQDDQDSVRLLAVEGCAALGKLLEPQDCVQ 240

Query:   239 HILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAA 298
             HILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTR +LVPAYVRLLRDNEAEVRIAA
Sbjct:   241 HILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAA 300

Query:   299 AGKVTKFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPLLGKDATIEQLL 358
             AGKVTKFCRILNPE+AIQHILPCVKELSSDSSQHVRSALASVIMGMAP+LGKDATIE LL
Sbjct:   301 AGKVTKFCRILNPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLL 360

Query:   359 PIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEY 418
             PIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEY
Sbjct:   361 PIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEY 420

Query:   419 IPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQHITPQV 478
             IPLLASQLGVGFFDDKLGALCMQWLQDKV+SIRDAAANNLKRLAEEFGPEWAMQHI PQV
Sbjct:   421 IPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANNLKRLAEEFGPEWAMQHIVPQV 480

Query:   479 LEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVINASKDRVPNIKFNVAKVLQS 538
             LEM+NNPHYLYRMTILRA+SLLAPVMGSEITCS+LLPVV+ ASKDRVPNIKFNVAKVLQS
Sbjct:   481 LEMVNNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVMTASKDRVPNIKFNVAKVLQS 540

Query:   539 LIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQSIDHVMMSS 585
             LIPIVDQS+VEKTIRP LVEL+EDPDVDVRFFA QA+QSID+VMMSS
Sbjct:   541 LIPIVDQSVVEKTIRPGLVELSEDPDVDVRFFANQALQSIDNVMMSS 587

GO:0046686 "response to cadmium ion" evidence=IEP

GO:0005886 "plasma membrane" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0000902 "cell morphogenesis" evidence=RCA

GO:0016049 "cell growth" evidence=RCA

GO:0048193 "Golgi vesicle transport" evidence=RCA

GO:0008601 "protein phosphatase type 2A regulator activity" evidence=ISS

GO:0042325 "regulation of phosphorylation" evidence=ISS

TAIR\|locus:2205354 PP2AA3 "AT1G13320" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031165 RCN1 "AT1G25490" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|A5D973 PPP2R1A "Alpha isoform of regulatory subunit A, protein phosphatase 2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q32PI5 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|P30153 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PX75 PPP2R1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P54612 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

MGI\|MGI:1926334 Ppp2r1a "protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|620907 Ppp2r1a "protein phosphatase 2, regulatory subunit A, alpha" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P36179	2AAA_DROME	No assigned EC number	0.5749	0.9675	0.9576	yes	no
Q54QR9	2AAA_DICDI	No assigned EC number	0.5674	0.9709	0.9726	yes	no
P36875	2AAA_PEA	No assigned EC number	0.8886	0.6700	0.9924	N/A	no
Q32PI5	2AAA_BOVIN	No assigned EC number	0.5892	0.9760	0.9694	yes	no
Q38950	2AAB_ARATH	No assigned EC number	0.9352	1.0	0.9965	yes	no
Q38845	2AAA_ARATH	No assigned EC number	0.8743	0.9897	0.9846	no	no
P30153	2AAA_HUMAN	No assigned EC number	0.5892	0.9760	0.9694	yes	no
P31383	2AAA_YEAST	No assigned EC number	0.4496	0.9726	0.8960	yes	no
P54612	2AAA_PIG	No assigned EC number	0.5892	0.9760	0.9694	yes	no
Q09543	2AAA_CAEEL	No assigned EC number	0.4965	0.9811	0.9728	yes	no
Q38951	2AAG_ARATH	No assigned EC number	0.9114	1.0	0.9965	no	no
Q76MZ3	2AAA_MOUSE	No assigned EC number	0.5892	0.9760	0.9694	yes	no
Q9UT08	2AAA_SCHPO	No assigned EC number	0.5086	0.9777	0.9694	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pm.C_LG_VIII0497	hypothetical protein (587 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		585
COG1413		335	COG1413, COG1413, FOG: HEAT repeat [Energy product	1e-04
cd00020		120	cd00020, ARM, Armadillo/beta-catenin-like repeats	6e-04
COG1413		335	COG1413, COG1413, FOG: HEAT repeat [Energy product	0.004

>gnl\|CDD\|224331 COG1413, COG1413, FOG: HEAT repeat [Energy production and conversion]	Back alignment and domain information

 Score = 44.5 bits (105), Expect = 1e-04
 Identities = 58/263 (22%), Positives = 90/263 (34%), Gaps = 41/263 (15%)

Query: 43  ERTRKELIPFLSENNDDDDEVL-LAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETC 101
                E    L +  +D+D ++ L+ A  LG       G E A   +P L  L + E+  
Sbjct: 38  LELAPEAADELLKLLEDEDLLVRLSAAVALGEL-----GSEEA---VPLLRELLSDEDPR 89

Query: 102 VRDKAVESLCRIGSQMRESDLVDWYIPLVKRLAA-GEWFTARVSACGLFHI----AYPSA 156
           VRD A ++L  +G             PLV+ L           +A  L  +    A    
Sbjct: 90  VRDAAADALGELGDPEA-------VPPLVELLENDENEGVRAAAARALGKLGDERALDPL 142

Query: 157 PDILKTELRSIYTQLCQDDMPMVRRSAASNLGKFAATVEPAHLKTDIMSIFEDLTQDDSV 216
            + L+ E            +  VR +AA  LG+         L   +        +D  V
Sbjct: 143 LEALQDEDSGSAAAALDAALLDVRAAAAEALGELGDPEAIPLLIELLED------EDADV 196

Query: 217 RLLAVEGCAALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTR 276
           R  A     ALG+L            ++V    D+S  VR            A+G     
Sbjct: 197 RRAAAS---ALGQLGSE---NVEAADLLVKALSDESLEVR-------KAALLALGEIGDE 243

Query: 277 MDLVPAYVRLLRDNEAEVRIAAA 299
            + V A  + L D +  + + AA
Sbjct: 244 -EAVDALAKALEDEDVILALLAA 265

Length = 335

>gnl\|CDD\|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats	Back alignment and domain information

>gnl\|CDD\|224331 COG1413, COG1413, FOG: HEAT repeat [Energy production and conversion]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		585
KOG0211		759	consensus Protein phosphatase 2A regulatory subuni	100.0
KOG0211		759	consensus Protein phosphatase 2A regulatory subuni	100.0
KOG2171		1075	consensus Karyopherin (importin) beta 3 [Nuclear s	100.0
KOG2171		1075	consensus Karyopherin (importin) beta 3 [Nuclear s	99.98
KOG2023		885	consensus Nuclear transport receptor Karyopherin-b	99.97
KOG0213		1172	consensus Splicing factor 3b, subunit 1 [RNA proce	99.97
KOG2023		885	consensus Nuclear transport receptor Karyopherin-b	99.96
KOG1241		859	consensus Karyopherin (importin) beta 1 [Nuclear s	99.95
COG5181		975	HSH155 U2 snRNP spliceosome subunit [RNA processin	99.95
KOG0213		1172	consensus Splicing factor 3b, subunit 1 [RNA proce	99.95
KOG1241		859	consensus Karyopherin (importin) beta 1 [Nuclear s	99.94
KOG1824		1233	consensus TATA-binding protein-interacting protein	99.94
COG5181		975	HSH155 U2 snRNP spliceosome subunit [RNA processin	99.92
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	99.91
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	99.91
KOG1242		569	consensus Protein containing adaptin N-terminal re	99.88
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	99.88
KOG1242		569	consensus Protein containing adaptin N-terminal re	99.87
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	99.87
KOG1824		1233	consensus TATA-binding protein-interacting protein	99.86
PRK09687		280	putative lyase; Provisional	99.85
COG5215		858	KAP95 Karyopherin (importin) beta [Intracellular t	99.84
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	99.84
COG5215		858	KAP95 Karyopherin (importin) beta [Intracellular t	99.83
PRK09687		280	putative lyase; Provisional	99.83
KOG0212		675	consensus Uncharacterized conserved protein [Funct	99.82
PTZ00429		746	beta-adaptin; Provisional	99.8
KOG0915		1702	consensus Uncharacterized conserved protein [Funct	99.8
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	99.79
PTZ00429		746	beta-adaptin; Provisional	99.76
KOG0915		1702	consensus Uncharacterized conserved protein [Funct	99.75
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.74
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.73
KOG0212		675	consensus Uncharacterized conserved protein [Funct	99.71
KOG1060		968	consensus Vesicle coat complex AP-3, beta subunit	99.65
KOG0166		514	consensus Karyopherin (importin) alpha [Intracellu	99.63
KOG0166		514	consensus Karyopherin (importin) alpha [Intracellu	99.61
KOG4224		550	consensus Armadillo repeat protein VAC8 required f	99.58
KOG1943		1133	consensus Beta-tubulin folding cofactor D [Posttra	99.51
PF10508		503	Proteasom_PSMB: Proteasome non-ATPase 26S subunit;	99.48
KOG1943		1133	consensus Beta-tubulin folding cofactor D [Posttra	99.45
KOG4224		550	consensus Armadillo repeat protein VAC8 required f	99.44
PF10508		503	Proteasom_PSMB: Proteasome non-ATPase 26S subunit;	99.4
COG5240		898	SEC21 Vesicle coat complex COPI, gamma subunit [In	99.35
KOG1248		1176	consensus Uncharacterized conserved protein [Funct	99.34
KOG1061		734	consensus Vesicle coat complex AP-1/AP-2/AP-4, bet	99.34
COG5240		898	SEC21 Vesicle coat complex COPI, gamma subunit [In	99.32
KOG1062		866	consensus Vesicle coat complex AP-1, gamma subunit	99.32
KOG1060		968	consensus Vesicle coat complex AP-3, beta subunit	99.31
KOG2259		823	consensus Uncharacterized conserved protein [Funct	99.31
PF12348		228	CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi	99.31
KOG1020		1692	consensus Sister chromatid cohesion protein SCC2/N	99.25
KOG1061		734	consensus Vesicle coat complex AP-1/AP-2/AP-4, bet	99.24
COG5064		526	SRP1 Karyopherin (importin) alpha [Intracellular t	99.24
COG1413		335	FOG: HEAT repeat [Energy production and conversion	99.23
KOG1062		866	consensus Vesicle coat complex AP-1, gamma subunit	99.23
KOG1059		877	consensus Vesicle coat complex AP-3, delta subunit	99.23
COG5064		526	SRP1 Karyopherin (importin) alpha [Intracellular t	99.22
KOG1991		1010	consensus Nuclear transport receptor RANBP7/RANBP8	99.22
COG1413		335	FOG: HEAT repeat [Energy production and conversion	99.22
KOG1243		690	consensus Protein kinase [General function predict	99.22
KOG2259		823	consensus Uncharacterized conserved protein [Funct	99.21
KOG1248		1176	consensus Uncharacterized conserved protein [Funct	99.2
KOG1020		1692	consensus Sister chromatid cohesion protein SCC2/N	99.2
KOG2274		1005	consensus Predicted importin 9 [Intracellular traf	99.18
TIGR02270		410	conserved hypothetical protein. Members are found	99.18
KOG1059		877	consensus Vesicle coat complex AP-3, delta subunit	99.11
PF12348		228	CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi	99.11
TIGR02270		410	conserved hypothetical protein. Members are found	99.09
KOG1992		960	consensus Nuclear export receptor CSE1/CAS (import	99.08
KOG1243		690	consensus Protein kinase [General function predict	99.04
KOG1078		865	consensus Vesicle coat complex COPI, gamma subunit	99.03
COG5096		757	Vesicle coat complex, various subunits [Intracellu	99.02
KOG1078		865	consensus Vesicle coat complex COPI, gamma subunit	98.98
KOG1820		815	consensus Microtubule-associated protein [Cytoskel	98.93
KOG1058		948	consensus Vesicle coat complex COPI, beta subunit	98.91
KOG2137		700	consensus Protein kinase [Signal transduction mech	98.91
KOG1077		938	consensus Vesicle coat complex AP-2, alpha subunit	98.86
KOG2062		929	consensus 26S proteasome regulatory complex, subun	98.85
KOG1077		938	consensus Vesicle coat complex AP-2, alpha subunit	98.84
COG5096		757	Vesicle coat complex, various subunits [Intracellu	98.82
KOG4535		728	consensus HEAT and armadillo repeat-containing pro	98.81
KOG0414		1251	consensus Chromosome condensation complex Condensi	98.8
KOG4535		728	consensus HEAT and armadillo repeat-containing pro	98.8
KOG1058		948	consensus Vesicle coat complex COPI, beta subunit	98.79
KOG1820		815	consensus Microtubule-associated protein [Cytoskel	98.78
PF12460		415	MMS19_C: RNAPII transcription regulator C-terminal	98.77
PF12460		415	MMS19_C: RNAPII transcription regulator C-terminal	98.76
KOG1991		1010	consensus Nuclear transport receptor RANBP7/RANBP8	98.73
PF12755		97	Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region	98.71
KOG2032		533	consensus Uncharacterized conserved protein [Funct	98.71
PF05804		708	KAP: Kinesin-associated protein (KAP)	98.67
PF12755		97	Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region	98.63
KOG2137		700	consensus Protein kinase [Signal transduction mech	98.53
PF13646		88	HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I	98.51
PF04826		254	Arm_2: Armadillo-like; InterPro: IPR006911 This en	98.49
PF04826		254	Arm_2: Armadillo-like; InterPro: IPR006911 This en	98.47
PF12717		178	Cnd1: non-SMC mitotic condensation complex subunit	98.47
KOG4653		982	consensus Uncharacterized conserved protein [Funct	98.47
KOG0567		289	consensus HEAT repeat-containing protein [General	98.46
KOG1293		678	consensus Proteins containing armadillo/beta-caten	98.44
KOG4413		524	consensus 26S proteasome regulatory complex, subun	98.43
PF13646		88	HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I	98.41
PF12717		178	Cnd1: non-SMC mitotic condensation complex subunit	98.41
KOG2062		929	consensus 26S proteasome regulatory complex, subun	98.4
KOG1992		960	consensus Nuclear export receptor CSE1/CAS (import	98.37
PF05804		708	KAP: Kinesin-associated protein (KAP)	98.37
PF05918		556	API5: Apoptosis inhibitory protein 5 (API5); Inter	98.36
KOG1293		678	consensus Proteins containing armadillo/beta-caten	98.36
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	98.34
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	98.34
KOG0567		289	consensus HEAT repeat-containing protein [General	98.31
PF05918		556	API5: Apoptosis inhibitory protein 5 (API5); Inter	98.29
PF13001		501	Ecm29: Proteasome stabiliser; InterPro: IPR024372	98.28
KOG2274		1005	consensus Predicted importin 9 [Intracellular traf	98.26
KOG4413		524	consensus 26S proteasome regulatory complex, subun	98.26
KOG2025		892	consensus Chromosome condensation complex Condensi	98.21
COG5218		885	YCG1 Chromosome condensation complex Condensin, su	98.14
PF05004		309	IFRD: Interferon-related developmental regulator (	98.14
PF05004		309	IFRD: Interferon-related developmental regulator (	98.13
KOG0413		1529	consensus Uncharacterized conserved protein relate	98.12
KOG0168		1051	consensus Putative ubiquitin fusion degradation pr	98.08
COG5098		1128	Chromosome condensation complex Condensin, subunit	98.07
KOG0168		1051	consensus Putative ubiquitin fusion degradation pr	98.05
KOG2032		533	consensus Uncharacterized conserved protein [Funct	98.04
KOG2025		892	consensus Chromosome condensation complex Condensi	98.01
PF13001		501	Ecm29: Proteasome stabiliser; InterPro: IPR024372	98.0
KOG2956		516	consensus CLIP-associating protein [General functi	97.99
KOG2956		516	consensus CLIP-associating protein [General functi	97.98
PF13513		55	HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O	97.97
PF13513		55	HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O	97.94
KOG1525		1266	consensus Sister chromatid cohesion complex Cohesi	97.92
KOG4653		982	consensus Uncharacterized conserved protein [Funct	97.91
KOG1967		1030	consensus DNA repair/transcription protein Mms19 [	97.87
PF14500		262	MMS19_N: Dos2-interacting transcription regulator	97.82
KOG0413		1529	consensus Uncharacterized conserved protein relate	97.79
KOG1949		1005	consensus Uncharacterized conserved protein [Funct	97.77
KOG1525		1266	consensus Sister chromatid cohesion complex Cohesi	97.75
KOG1967		1030	consensus DNA repair/transcription protein Mms19 [	97.73
KOG1851		1710	consensus Uncharacterized conserved protein [Funct	97.71
PF14500		262	MMS19_N: Dos2-interacting transcription regulator	97.67
KOG1949		1005	consensus Uncharacterized conserved protein [Funct	97.65
PF02985		31	HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re	97.64
COG5116		926	RPN2 26S proteasome regulatory complex component [	97.64
PF02985		31	HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re	97.62
PLN03076		1780	ARF guanine nucleotide exchange factor (ARF-GEF);	97.6
PF08506		370	Cse1: Cse1; InterPro: IPR013713 The exchange of ma	97.56
KOG2933		334	consensus Uncharacterized conserved protein [Funct	97.53
KOG2933		334	consensus Uncharacterized conserved protein [Funct	97.52
PF01347		618	Vitellogenin_N: Lipoprotein amino terminal region;	97.52
COG5116		926	RPN2 26S proteasome regulatory complex component [	97.51
COG5218		885	YCG1 Chromosome condensation complex Condensin, su	97.44
PF01347		618	Vitellogenin_N: Lipoprotein amino terminal region;	97.39
PF12719		298	Cnd3: Nuclear condensing complex subunits, C-term	97.38
PF12719		298	Cnd3: Nuclear condensing complex subunits, C-term	97.35
PLN03076		1780	ARF guanine nucleotide exchange factor (ARF-GEF);	97.35
smart00638		574	LPD_N Lipoprotein N-terminal Domain.	97.28
KOG2021		980	consensus Nuclear mRNA export factor receptor LOS1	97.28
KOG1822		2067	consensus Uncharacterized conserved protein [Funct	97.2
KOG1822		2067	consensus Uncharacterized conserved protein [Funct	97.19
PF08506		370	Cse1: Cse1; InterPro: IPR013713 The exchange of ma	97.19
smart00638		574	LPD_N Lipoprotein N-terminal Domain.	97.16
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	97.1
KOG0414		1251	consensus Chromosome condensation complex Condensi	97.04
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	97.03
KOG0891		2341	consensus DNA-dependent protein kinase [Replicatio	97.0
KOG1993		978	consensus Nuclear transport receptor KAP120 (impor	96.99
KOG2160		342	consensus Armadillo/beta-catenin-like repeat-conta	96.92
KOG2973		353	consensus Uncharacterized conserved protein [Funct	96.91
KOG2011		1048	consensus Sister chromatid cohesion complex Cohesi	96.86
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	96.72
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	96.69
PF04118		307	Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do	96.58
PF13251		182	DUF4042: Domain of unknown function (DUF4042)	96.56
PF13251		182	DUF4042: Domain of unknown function (DUF4042)	96.54
PF11864		464	DUF3384: Domain of unknown function (DUF3384); Int	96.53
KOG2213		460	consensus Apoptosis inhibitor 5/fibroblast growth	96.49
PF12530		234	DUF3730: Protein of unknown function (DUF3730) ; I	96.45
PF10363		92	DUF2435: Protein of unknown function (DUF2435)	96.36
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	96.24
cd00256		429	VATPase_H VATPase_H, regulatory vacuolar ATP synth	96.24
PF10363		92	DUF2435: Protein of unknown function (DUF2435)	96.16
PF11864		464	DUF3384: Domain of unknown function (DUF3384); Int	96.12
KOG2021		980	consensus Nuclear mRNA export factor receptor LOS1	96.04
PF14664		371	RICTOR_N: Rapamycin-insensitive companion of mTOR,	96.03
cd00256		429	VATPase_H VATPase_H, regulatory vacuolar ATP synth	95.97
PF11865		160	DUF3385: Domain of unknown function (DUF3385); Int	95.89
PF12530		234	DUF3730: Protein of unknown function (DUF3730) ; I	95.89
KOG0891		2341	consensus DNA-dependent protein kinase [Replicatio	95.87
PF01603		409	B56: Protein phosphatase 2A regulatory B subunit (	95.85
PF03224		312	V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004	95.77
cd08050		343	TAF6 TATA Binding Protein (TBP) Associated Factor	95.76
KOG2011		1048	consensus Sister chromatid cohesion complex Cohesi	95.74
PF12054		441	DUF3535: Domain of unknown function (DUF3535); Int	95.64
PF12074		339	DUF3554: Domain of unknown function (DUF3554); Int	95.64
PF08569		335	Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro	95.57
KOG2549		576	consensus Transcription initiation factor TFIID, s	95.5
PF11865		160	DUF3385: Domain of unknown function (DUF3385); Int	95.49
PF04118		307	Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do	95.48
COG5656		970	SXM1 Importin, protein involved in nuclear import	95.4
PF08161		198	NUC173: NUC173 domain; InterPro: IPR012978 This is	95.3
PF01603		409	B56: Protein phosphatase 2A regulatory B subunit (	95.27
PF08161		198	NUC173: NUC173 domain; InterPro: IPR012978 This is	95.27
PF10274		183	ParcG: Parkin co-regulated protein; InterPro: IPR0	95.27
PF10274		183	ParcG: Parkin co-regulated protein; InterPro: IPR0	95.09
PF05536		543	Neurochondrin: Neurochondrin	95.04
KOG2213		460	consensus Apoptosis inhibitor 5/fibroblast growth	95.02
COG5234		993	CIN1 Beta-tubulin folding cofactor D [Posttranslat	94.97
PF08167		165	RIX1: rRNA processing/ribosome biogenesis	94.95
KOG1048		717	consensus Neural adherens junction protein Plakoph	94.92
KOG2122		2195	consensus Beta-catenin-binding protein APC, contai	94.77
KOG2549		576	consensus Transcription initiation factor TFIID, s	94.77
KOG2160		342	consensus Armadillo/beta-catenin-like repeat-conta	94.71
PF14664		371	RICTOR_N: Rapamycin-insensitive companion of mTOR,	94.53
KOG2022		982	consensus Nuclear transport receptor LGL2 (importi	94.49
PF10521		282	DUF2454: Protein of unknown function (DUF2454); In	94.38
cd08050		343	TAF6 TATA Binding Protein (TBP) Associated Factor	94.37
PF03378		435	CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I	94.37
PF10521		282	DUF2454: Protein of unknown function (DUF2454); In	94.36
PF12830		187	Nipped-B_C: Sister chromatid cohesion C-terminus	94.34
PF12074		339	DUF3554: Domain of unknown function (DUF3554); Int	94.26
KOG1851		1710	consensus Uncharacterized conserved protein [Funct	94.25
PF11701		157	UNC45-central: Myosin-binding striated muscle asse	94.24
PF14868		559	DUF4487: Domain of unknown function (DUF4487)	94.18
KOG2022		982	consensus Nuclear transport receptor LGL2 (importi	94.1
PF07571		92	DUF1546: Protein of unknown function (DUF1546); In	94.1
PF11701		157	UNC45-central: Myosin-binding striated muscle asse	93.94
KOG2759		442	consensus Vacuolar H+-ATPase V1 sector, subunit H	93.84
KOG1848		1610	consensus Uncharacterized conserved protein [Funct	93.71
KOG4500		604	consensus Rho/Rac GTPase guanine nucleotide exchan	93.69
PF08167		165	RIX1: rRNA processing/ribosome biogenesis	93.64
KOG0803		1312	consensus Predicted E3 ubiquitin ligase [Posttrans	93.64
PF08389		148	Xpo1: Exportin 1-like protein; InterPro: IPR013598	93.62
cd03568		144	VHS_STAM VHS domain family, STAM subfamily; member	93.56
KOG2005		878	consensus 26S proteasome regulatory complex, subun	93.49
KOG0889		3550	consensus Histone acetyltransferase SAGA, TRRAP/TR	93.49
PF03224		312	V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004	93.46
cd03568		144	VHS_STAM VHS domain family, STAM subfamily; member	93.39
COG5095		450	TAF6 Transcription initiation factor TFIID, subuni	93.36
KOG2149		393	consensus Uncharacterized conserved protein [Funct	93.15
COG5656		970	SXM1 Importin, protein involved in nuclear import	93.12
PF12231		372	Rif1_N: Rap1-interacting factor 1 N terminal; Inte	93.12
PF04078		262	Rcd1: Cell differentiation family, Rcd1-like ; Int	93.08
KOG2081		559	consensus Nuclear transport regulator [Intracellul	92.88
KOG1993		978	consensus Nuclear transport receptor KAP120 (impor	92.86
cd03569		142	VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s	92.82
cd03567		139	VHS_GGA VHS domain family, GGA subfamily; GGA (Gol	92.79
KOG2149		393	consensus Uncharacterized conserved protein [Funct	92.64
PF12231		372	Rif1_N: Rap1-interacting factor 1 N terminal; Inte	92.64
KOG2229		616	consensus Protein required for actin cytoskeleton	92.54
PF07571		92	DUF1546: Protein of unknown function (DUF1546); In	92.54
cd03567		139	VHS_GGA VHS domain family, GGA subfamily; GGA (Gol	92.5
PF08713		213	DNA_alkylation: DNA alkylation repair enzyme; Inte	92.48
KOG2081		559	consensus Nuclear transport regulator [Intracellul	92.12
cd03569		142	VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s	92.09
COG5234		993	CIN1 Beta-tubulin folding cofactor D [Posttranslat	92.08
PF12054		441	DUF3535: Domain of unknown function (DUF3535); Int	91.86
KOG1048		717	consensus Neural adherens junction protein Plakoph	91.83
PF11698		119	V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011	91.75
COG5098		1128	Chromosome condensation complex Condensin, subunit	91.65
PF12830		187	Nipped-B_C: Sister chromatid cohesion C-terminus	91.17
PF08623		169	TIP120: TATA-binding protein interacting (TIP20);	90.81
PF00514		41	Arm: Armadillo/beta-catenin-like repeat; InterPro:	90.78
PF00514		41	Arm: Armadillo/beta-catenin-like repeat; InterPro:	90.75
cd03561		133	VHS VHS domain family; The VHS domain is present i	90.72
COG5537		740	IRR1 Cohesin [Cell division and chromosome partiti	90.63
PF12765		42	Cohesin_HEAT: HEAT repeat associated with sister c	90.53
PF11698		119	V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011	90.43
cd03561		133	VHS VHS domain family; The VHS domain is present i	90.42
PF00790		140	VHS: VHS domain; InterPro: IPR002014 The VHS domai	90.37
PF08623		169	TIP120: TATA-binding protein interacting (TIP20);	90.33
KOG0803		1312	consensus Predicted E3 ubiquitin ligase [Posttrans	90.17
smart00288		133	VHS Domain present in VPS-27, Hrs and STAM. Unpubl	90.1
PF00790		140	VHS: VHS domain; InterPro: IPR002014 The VHS domai	89.91
KOG4524		1014	consensus Uncharacterized conserved protein [Funct	89.81
PF08064		107	UME: UME (NUC010) domain; InterPro: IPR012993 This	89.72
PF05536		543	Neurochondrin: Neurochondrin	89.66
PF12765		42	Cohesin_HEAT: HEAT repeat associated with sister c	89.27
COG5537		740	IRR1 Cohesin [Cell division and chromosome partiti	89.22
smart00288		133	VHS Domain present in VPS-27, Hrs and STAM. Unpubl	89.09
KOG0889		3550	consensus Histone acetyltransferase SAGA, TRRAP/TR	89.02
KOG2759		442	consensus Vacuolar H+-ATPase V1 sector, subunit H	88.89
KOG4524		1014	consensus Uncharacterized conserved protein [Funct	88.73
PF08064		107	UME: UME (NUC010) domain; InterPro: IPR012993 This	88.69
PF08713		213	DNA_alkylation: DNA alkylation repair enzyme; Inte	88.28
KOG2122		2195	consensus Beta-catenin-binding protein APC, contai	87.77
cd00197		115	VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil	87.49
PF03378		435	CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I	86.74
cd03565		141	VHS_Tom1 VHS domain family, Tom1 subfamily; The VH	86.73
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	86.5
KOG2973		353	consensus Uncharacterized conserved protein [Funct	86.17
COG5101		1053	CRM1 Importin beta-related nuclear transport recep	85.73
PF11841		160	DUF3361: Domain of unknown function (DUF3361)	85.57
PF08389		148	Xpo1: Exportin 1-like protein; InterPro: IPR013598	85.47
KOG2005		878	consensus 26S proteasome regulatory complex, subun	85.45
cd03572		122	ENTH_epsin_related ENTH domain, Epsin Related fami	84.64
COG5095		450	TAF6 Transcription initiation factor TFIID, subuni	84.54
PF12612		193	TFCD_C: Tubulin folding cofactor D C terminal; Int	84.13
COG5369		743	Uncharacterized conserved protein [Function unknow	83.79
KOG4500		604	consensus Rho/Rac GTPase guanine nucleotide exchan	83.34
PF14225		262	MOR2-PAG1_C: Cell morphogenesis C-terminal	83.31
smart00802		107	UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1.	82.9
KOG1932		1180	consensus TATA binding protein associated factor [	82.65
cd03565		141	VHS_Tom1 VHS domain family, Tom1 subfamily; The VH	82.21
KOG2038		988	consensus CAATT-binding transcription factor/60S r	82.02
PF12397		121	U3snoRNP10: U3 small nucleolar RNA-associated prot	81.85
smart00567		30	EZ_HEAT E-Z type HEAT repeats. Present in subunits	80.52
COG5101		1053	CRM1 Importin beta-related nuclear transport recep	80.35
smart00802		107	UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1.	80.24

>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=4.9e-50  Score=397.35  Aligned_cols=577  Identities=54%  Similarity=0.825  Sum_probs=542.7

Q ss_pred             CCCcccHHHHHHHhcChhHHHHHHHhhhHHHHHHhhChhhhhhhcccccccccCCchHHHHHHHHHHhccccccCCcchH
Q 007918            5 DEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGVEHA   84 (585)
Q Consensus         5 ~~~~~~i~~l~~~l~~~~~~~R~~a~~~l~~~~~~~~~~~~~~~l~~~l~~~~d~~~~vr~~~~~~l~~l~~~~~~~~~~   84 (585)
                      ++++|||..+++.++..|-..|..+.+.+++++..+|.+.++..++|++.+..+++.+|..+.+..+|.+..++|++++.
T Consensus        78 ~~~~~~ia~l~~e~~~~di~~r~~~~~~l~~~a~~~~~~~tr~~lipf~~e~~~~~dev~~~~a~~~~~~~~~v~~~~~~  157 (759)
T KOG0211|consen   78 EDSLYPIAVLIDELSNTDIQLRLNSGRKLSNLALALGVERTRLELIPFLTEAEDDEDEVLLDLAEQLGTFLPDVGGPEYA  157 (759)
T ss_pred             ccccccHHHHhhccCchhhhhhhhhhccccchhhhcccchhhhhhhhHHHHhccchhHHHHHHHHHhcccchhccchhHH
Confidence            34799999999999999999999999999999999999999999999999955999999999999999999999999999


Q ss_pred             HhchHHHhhhhhchhhHHHHHHHHHHHHHHhhcChhhHHhhHHHHHHHhhcCcCccchhhHHhhhHhhcCCCC-hHHHHH
Q 007918           85 HVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRESDLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAP-DILKTE  163 (585)
Q Consensus        85 ~~l~~~l~~l~~~~~~~vr~~a~~~l~~l~~~~~~~~~~~~l~~~l~~l~~~~~~~~r~~a~~~l~~~~~~~~-~~~~~~  163 (585)
                      +.+++.++.+..+++..+|+++++++..++...+.+....++.|++.++..+++...|..+|.+++..+...+ +..+.+
T Consensus       158 ~~ll~~le~l~~~eet~vr~k~ve~l~~v~~~~~~~~~~~~lv~l~~~l~~~d~~~sr~sacglf~~~~~~~~~~~vk~e  237 (759)
T KOG0211|consen  158 HMLLPPLELLATVEETGVREKAVESLLKVAVGLPKEKLREHLVPLLKRLATGDWFQSRLSACGLFGKLYVSLPDDAVKRE  237 (759)
T ss_pred             HHhhHHHHhhhHHHHHHHHHHHHHHHHHHHHhcChHHHHHHHHHHHHHccchhhhhcchhhhhhhHHhccCCChHHHHHH
Confidence            9999999999999999999999999999999999988899999999999999888899999999999999998 568999


Q ss_pred             HHHHHHhhcCCCchHHHHHHHHhHHHHHhhhcccchHHHHHHHHHHhccC--hhHHHHHHHHHHHHhhccCch-hhhhhh
Q 007918          164 LRSIYTQLCQDDMPMVRRSAASNLGKFAATVEPAHLKTDIMSIFEDLTQD--DSVRLLAVEGCAALGKLLEPQ-DCVAHI  240 (585)
Q Consensus       164 l~~~l~~l~~d~~~~vr~~a~~~l~~l~~~~~~~~~~~~l~~~l~~l~~d--~~vr~~a~~~l~~l~~~~~~~-~~~~~~  240 (585)
                      +.+.+.++++|.++.||.++++-++.+++.++.......+.|.+.++..|  +.||..|...+..+.+.+..+ ...+.+
T Consensus       238 lr~~~~~lc~d~~~~Vr~~~a~~l~~~a~~~~~~~~~s~v~~~~~~L~~DdqdsVr~~a~~~~~~l~~l~~~~~d~~~~~  317 (759)
T KOG0211|consen  238 LRPIVQSLCQDDTPMVRRAVASNLGNIAKVLESEIVKSEVLPTLIQLLRDDQDSVREAAVESLVSLLDLLDDDDDVVKSL  317 (759)
T ss_pred             HHHHHHhhccccchhhHHHHHhhhHHHHHHHHHHHHHhhccHHHhhhhhcchhhHHHHHHHHHHHHHHhcCCchhhhhhh
Confidence            99999999999999999999999999999998888889999999999988  779999999999999998877 778889


Q ss_pred             HHHHHHhccCCChHHHHHHHHHHHHHHHHhCCcccccchHHHHHHhccCChHHHHHHHHHHHHHHHHhhC----HHHHHH
Q 007918          241 LPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRILN----PELAIQ  316 (585)
Q Consensus       241 ~~~l~~~~~d~~~~vR~~~~~~l~~l~~~~~~~~~~~~l~~~l~~ll~d~~~~vr~~a~~~l~~l~~~~~----~~~~~~  316 (585)
                      .+.+.+..+|.+|++|..+...+..+...+|.+.....+.+.+..+++|..+++|.+.......++....    .....+
T Consensus       318 ~~~l~~~~~d~~~~v~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~l~~~~~~e~r~a~a~~~~~l~~~l~~~~~~~i~~~  397 (759)
T KOG0211|consen  318 TESLVQAVEDGSWRVSYMVADKFSELSSAVGPSATRTQLVPPVSNLLKDEEWEVRYAIAKKVQKLACYLNASCYPNIPDS  397 (759)
T ss_pred             hHHHHHHhcChhHHHHHHHhhhhhhHHHHhccccCcccchhhHHHHhcchhhhhhHHhhcchHHHhhhcCcccccccchh
Confidence            9999999999999999999999999999999987778899999999999999999999999999988877    334456


Q ss_pred             hhHHHHHHhccCCcHHHHHHHHHHHHhhchhhCHHHHHHhHHHHHHHhhcCCChHHHHHHH---HHhHHhhhhhchhHHh
Q 007918          317 HILPCVKELSSDSSQHVRSALASVIMGMAPLLGKDATIEQLLPIFLSLLKDEFPDVRLNII---SKLDQVNQVIGIDLLS  393 (585)
Q Consensus       317 ~i~~~l~~~~~d~~~~vr~~a~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~---~~l~~l~~~~~~~~~~  393 (585)
                      .++|.+..+..|.+..||.+.+..+..+...+|.+...+.+.|.+...++|..+.||.+..   ..+.......|....+
T Consensus       398 ~ilp~~~~lv~d~~~~vr~a~a~~~~~~~p~~~k~~ti~~llp~~~~~l~de~~~V~lnli~~ls~~~~v~~v~g~~~~s  477 (759)
T KOG0211|consen  398 SILPEVQVLVLDNALHVRSALASVITGLSPILPKERTISELLPLLIGNLKDEDPIVRLNLIDKLSLLEEVNDVIGISTVS  477 (759)
T ss_pred             hhhHHHHHHHhcccchHHHHHhccccccCccCCcCcCccccChhhhhhcchhhHHHHHhhHHHHHHHHhccCcccchhhh
Confidence            7889999999999999999999999999999998888899999999999999999999999   4555555667888888


Q ss_pred             hhHHHHHHHHhcCCChHHHHHHHHHhHHHHHhhChhhHHHHHHHHHHHHccCCchHHHHHHHHHHHHHHHHhCHHHHHhh
Q 007918          394 QSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLKRLAEEFGPEWAMQH  473 (585)
Q Consensus       394 ~~ll~~l~~~~~~~~~~~r~~~~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~~~l~~l~~~~~~~~~~~~  473 (585)
                      +..+|.+..+..|.+|++|.++++.+..++...|..++.+.+.+.+..++.|...++|.+|...+..++..+|.+|....
T Consensus       478 ~slLp~i~el~~d~~wRvr~ail~~ip~la~q~~~~~~~~~~~~l~~~~l~d~v~~Ir~~aa~~l~~l~~~~G~~w~~~~  557 (759)
T KOG0211|consen  478 NSLLPAIVELAEDLLWRVRLAILEYIPQLALQLGVEFFDEKLAELLRTWLPDHVYSIREAAARNLPALVETFGSEWARLE  557 (759)
T ss_pred             hhhhhhhhhhccchhHHHHHHHHHHHHHHHHhhhhHHhhHHHHHHHHhhhhhhHHHHHHHHHHHhHHHHHHhCcchhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998888899


Q ss_pred             hHHHHHhhhcCcchHHHHHHHHHHHHhhhhcChHHHHhcHHHHHHhhcCCCCchHHHHHHHHHHHHHhhhchHHHHhhHH
Q 007918          474 ITPQVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSMVEKTIR  553 (585)
Q Consensus       474 ll~~l~~~l~~~~~~~R~~a~~~l~~l~~~~~~~~~~~~i~~~l~~~l~d~~~~vR~~~~~~l~~l~~~~~~~~~~~~~~  553 (585)
                      ++|.++.+..+++|..|.+.+.++..+++.+|.+.+.+.++|.+..+.+|+.++||.++++.+..+...+..+...+.+.
T Consensus       558 ~i~k~L~~~~q~~y~~R~t~l~si~~la~v~g~ei~~~~Llp~~~~l~~D~vanVR~nvak~L~~i~~~L~~~~~~~~v~  637 (759)
T KOG0211|consen  558 EIPKLLAMDLQDNYLVRMTTLFSIHELAEVLGQEITCEDLLPVFLDLVKDPVANVRINVAKHLPKILKLLDESVRDEEVL  637 (759)
T ss_pred             hhHHHHHHhcCcccchhhHHHHHHHHHHHHhccHHHHHHHhHHHHHhccCCchhhhhhHHHHHHHHHhhcchHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999888889999


Q ss_pred             HHHHHhcCCCCccHHHHHHHHHHHHHHh
Q 007918          554 PCLVELTEDPDVDVRFFATQAIQSIDHV  581 (585)
Q Consensus       554 ~~l~~l~~D~~~~Vr~~a~~al~~l~~~  581 (585)
                      |.+..+..|++.+||+.|..|.+.+.-.
T Consensus       638 pll~~L~~d~~~dvr~~a~~a~~~i~l~  665 (759)
T KOG0211|consen  638 PLLETLSSDQELDVRYRAILAFGSIELS  665 (759)
T ss_pred             HHHHHhccCcccchhHHHHHHHHHHHHH
Confidence            9999999999999999999999987654

>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification]	Back alignment and domain information

>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only]	Back alignment and domain information

>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification]	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only]	Back alignment and domain information

>PRK09687 putative lyase; Provisional	Back alignment and domain information

>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK09687 putative lyase; Provisional	Back alignment and domain information

>KOG0212 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PTZ00429 beta-adaptin; Provisional	Back alignment and domain information

>KOG0915 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>PTZ00429 beta-adaptin; Provisional	Back alignment and domain information

>KOG0915 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG0212 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells	Back alignment and domain information

>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells	Back alignment and domain information

>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1248 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2259 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ]	Back alignment and domain information

>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion]	Back alignment and domain information

>COG1413 FOG: HEAT repeat [Energy production and conversion]	Back alignment and domain information

>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1413 FOG: HEAT repeat [Energy production and conversion]	Back alignment and domain information

>KOG1243 consensus Protein kinase [General function prediction only]	Back alignment and domain information

>KOG2259 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1248 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure]	Back alignment and domain information

>TIGR02270 conserved hypothetical protein	Back alignment and domain information

>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ]	Back alignment and domain information

>TIGR02270 conserved hypothetical protein	Back alignment and domain information

>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1243 consensus Protein kinase [General function prediction only]	Back alignment and domain information

>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1820 consensus Microtubule-associated protein [Cytoskeleton]	Back alignment and domain information

>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2137 consensus Protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1820 consensus Microtubule-associated protein [Cytoskeleton]	Back alignment and domain information

>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins	Back alignment and domain information

>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins	Back alignment and domain information

>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region	Back alignment and domain information

>KOG2032 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region	Back alignment and domain information

>KOG2137 consensus Protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A	Back alignment and domain information

>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function	Back alignment and domain information

>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function	Back alignment and domain information

>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1	Back alignment and domain information

>KOG4653 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0567 consensus HEAT repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only]	Back alignment and domain information

>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A	Back alignment and domain information

>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1	Back alignment and domain information

>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms	Back alignment and domain information

>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only]	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG0567 consensus HEAT repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms	Back alignment and domain information

>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3	Back alignment and domain information

>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure]	Back alignment and domain information

>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning]	Back alignment and domain information

>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 []	Back alignment and domain information

>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 []	Back alignment and domain information

>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown]	Back alignment and domain information

>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2032 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3	Back alignment and domain information

>KOG2956 consensus CLIP-associating protein [General function prediction only]	Back alignment and domain information

>KOG2956 consensus CLIP-associating protein [General function prediction only]	Back alignment and domain information

>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B	Back alignment and domain information

>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B	Back alignment and domain information

>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4653 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription]	Back alignment and domain information

>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II	Back alignment and domain information

>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown]	Back alignment and domain information

>KOG1949 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription]	Back alignment and domain information

>KOG1851 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II	Back alignment and domain information

>KOG1949 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 []	Back alignment and domain information

>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 []	Back alignment and domain information

>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional	Back alignment and domain information

>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane	Back alignment and domain information

>KOG2933 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2933 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 []	Back alignment and domain information

>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning]	Back alignment and domain information

>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 []	Back alignment and domain information

>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain	Back alignment and domain information

>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain	Back alignment and domain information

>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional	Back alignment and domain information

>smart00638 LPD_N Lipoprotein N-terminal Domain	Back alignment and domain information

>KOG2021 consensus Nuclear mRNA export factor receptor LOS1/Exportin-t (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1822 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1822 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane	Back alignment and domain information

>smart00638 LPD_N Lipoprotein N-terminal Domain	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0891 consensus DNA-dependent protein kinase [Replication, recombination and repair]	Back alignment and domain information

>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2973 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2011 consensus Sister chromatid cohesion complex Cohesin, subunit STAG/IRR1/SCC3 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans)	Back alignment and domain information

>PF13251 DUF4042: Domain of unknown function (DUF4042)	Back alignment and domain information

>PF13251 DUF4042: Domain of unknown function (DUF4042)	Back alignment and domain information

>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised	Back alignment and domain information

>KOG2213 consensus Apoptosis inhibitor 5/fibroblast growth factor 2-interacting factor 2, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length	Back alignment and domain information

>PF10363 DUF2435: Protein of unknown function (DUF2435)	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments	Back alignment and domain information

>PF10363 DUF2435: Protein of unknown function (DUF2435)	Back alignment and domain information

>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised	Back alignment and domain information

>KOG2021 consensus Nuclear mRNA export factor receptor LOS1/Exportin-t (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term	Back alignment and domain information

>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments	Back alignment and domain information

>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length	Back alignment and domain information

>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length	Back alignment and domain information

>KOG0891 consensus DNA-dependent protein kinase [Replication, recombination and repair]	Back alignment and domain information

>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism	Back alignment and domain information

>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex	Back alignment and domain information

>KOG2011 consensus Sister chromatid cohesion complex Cohesin, subunit STAG/IRR1/SCC3 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF12054 DUF3535: Domain of unknown function (DUF3535); InterPro: IPR022707 This presumed domain is functionally uncharacterised	Back alignment and domain information

>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised	Back alignment and domain information

>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis	Back alignment and domain information

>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length	Back alignment and domain information

>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans)	Back alignment and domain information

>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF08161 NUC173: NUC173 domain; InterPro: IPR012978 This is the central domain of a novel family of hypothetical nucleolar proteins []	Back alignment and domain information

>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism	Back alignment and domain information

>PF08161 NUC173: NUC173 domain; InterPro: IPR012978 This is the central domain of a novel family of hypothetical nucleolar proteins []	Back alignment and domain information

>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter	Back alignment and domain information

>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter	Back alignment and domain information

>PF05536 Neurochondrin: Neurochondrin	Back alignment and domain information

>KOG2213 consensus Apoptosis inhibitor 5/fibroblast growth factor 2-interacting factor 2, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>COG5234 CIN1 Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones / Cytoskeleton]	Back alignment and domain information

>PF08167 RIX1: rRNA processing/ribosome biogenesis	Back alignment and domain information

>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term	Back alignment and domain information

>KOG2022 consensus Nuclear transport receptor LGL2 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p []	Back alignment and domain information

>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex	Back alignment and domain information

>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous []	Back alignment and domain information

>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p []	Back alignment and domain information

>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus	Back alignment and domain information

>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised	Back alignment and domain information

>KOG1851 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle	Back alignment and domain information

>PF14868 DUF4487: Domain of unknown function (DUF4487)	Back alignment and domain information

>KOG2022 consensus Nuclear transport receptor LGL2 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF07571 DUF1546: Protein of unknown function (DUF1546); InterPro: IPR011442 These proteins are associated with IPR004823 from INTERPRO in transcription initiation factor TFIID subunit 6 (TAF6)	Back alignment and domain information

>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle	Back alignment and domain information

>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion]	Back alignment and domain information

>KOG1848 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms]	Back alignment and domain information

>PF08167 RIX1: rRNA processing/ribosome biogenesis	Back alignment and domain information

>KOG0803 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane	Back alignment and domain information

>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein)	Back alignment and domain information

>KOG2005 consensus 26S proteasome regulatory complex, subunit RPN1/PSMD2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein)	Back alignment and domain information

>COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG2149 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length	Back alignment and domain information

>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms []	Back alignment and domain information

>KOG2081 consensus Nuclear transport regulator [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting)	Back alignment and domain information

>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins	Back alignment and domain information

>KOG2149 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length	Back alignment and domain information

>KOG2229 consensus Protein required for actin cytoskeleton organization and cell cycle progression [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF07571 DUF1546: Protein of unknown function (DUF1546); InterPro: IPR011442 These proteins are associated with IPR004823 from INTERPRO in transcription initiation factor TFIID subunit 6 (TAF6)	Back alignment and domain information

>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins	Back alignment and domain information

>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes	Back alignment and domain information

>KOG2081 consensus Nuclear transport regulator [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting)	Back alignment and domain information

>COG5234 CIN1 Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones / Cytoskeleton]	Back alignment and domain information

>PF12054 DUF3535: Domain of unknown function (DUF3535); InterPro: IPR022707 This presumed domain is functionally uncharacterised	Back alignment and domain information

>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning]	Back alignment and domain information

>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus	Back alignment and domain information

>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription []	Back alignment and domain information

>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless	Back alignment and domain information

>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless	Back alignment and domain information

>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule)	Back alignment and domain information

>COG5537 IRR1 Cohesin [Cell division and chromosome partitioning]	Back alignment and domain information

>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion	Back alignment and domain information

>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule)	Back alignment and domain information

>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM	Back alignment and domain information

>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription []	Back alignment and domain information

>KOG0803 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00288 VHS Domain present in VPS-27, Hrs and STAM	Back alignment and domain information

>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM	Back alignment and domain information

>KOG4524 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 []	Back alignment and domain information

>PF05536 Neurochondrin: Neurochondrin	Back alignment and domain information

>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion	Back alignment and domain information

>COG5537 IRR1 Cohesin [Cell division and chromosome partitioning]	Back alignment and domain information

>smart00288 VHS Domain present in VPS-27, Hrs and STAM	Back alignment and domain information

>KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion]	Back alignment and domain information

>KOG4524 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 []	Back alignment and domain information

>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes	Back alignment and domain information

>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain	Back alignment and domain information

>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous []	Back alignment and domain information

>cd03565 VHS_Tom1 VHS domain family, Tom1 subfamily; The VHS domain is an essential part of Tom1 (Target of myb1 - retroviral oncogene) protein	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2973 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5101 CRM1 Importin beta-related nuclear transport receptor [Nuclear structure / Intracellular trafficking and secretion]	Back alignment and domain information

>PF11841 DUF3361: Domain of unknown function (DUF3361)	Back alignment and domain information

>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane	Back alignment and domain information

>KOG2005 consensus 26S proteasome regulatory complex, subunit RPN1/PSMD2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain	Back alignment and domain information

>COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>PF12612 TFCD_C: Tubulin folding cofactor D C terminal; InterPro: IPR022577 This region is found in eukaryotes, and is typically between 182 and 199 amino acids in length	Back alignment and domain information

>COG5369 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms]	Back alignment and domain information

>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal	Back alignment and domain information

>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1	Back alignment and domain information

>KOG1932 consensus TATA binding protein associated factor [Transcription]	Back alignment and domain information

>cd03565 VHS_Tom1 VHS domain family, Tom1 subfamily; The VHS domain is an essential part of Tom1 (Target of myb1 - retroviral oncogene) protein	Back alignment and domain information

>KOG2038 consensus CAATT-binding transcription factor/60S ribosomal subunit biogenesis protein [Translation, ribosomal structure and biogenesis; Transcription]	Back alignment and domain information

>PF12397 U3snoRNP10: U3 small nucleolar RNA-associated protein 10 ; InterPro: IPR022125 This domain family is found in eukaryotes, and is approximately 120 amino acids in length	Back alignment and domain information

>smart00567 EZ_HEAT E-Z type HEAT repeats	Back alignment and domain information

>COG5101 CRM1 Importin beta-related nuclear transport receptor [Nuclear structure / Intracellular trafficking and secretion]	Back alignment and domain information

>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		585
2ie3_A		589	Structure Of The Protein Phosphatase 2a Core Enzyme		0.0
2ie3_A		589	Structure Of The Protein Phosphatase 2a Core Enzyme		9e-10
1b3u_A		588	Crystal Structure Of Constant Regulatory Domain Of		0.0
1b3u_A		588	Crystal Structure Of Constant Regulatory Domain Of		1e-09
2iae_A		589	Crystal Structure Of A Protein Phosphatase 2a (Pp2a		0.0
3fga_A		588	Structural Basis Of Pp2a And Sgo Interaction Length		0.0
3dw8_A		582	Structure Of A Protein Phosphatase 2a Holoenzyme Wi		0.0
3dw8_A		582	Structure Of A Protein Phosphatase 2a Holoenzyme Wi		1e-09
2pkg_A		580	Structure Of A Complex Between The A Subunit Of Pro		0.0
2pkg_A		580	Structure Of A Complex Between The A Subunit Of Pro		9e-10
2nyl_A		582	Crystal Structure Of Protein Phosphatase 2a (Pp2a)		0.0
2nyl_A		582	Crystal Structure Of Protein Phosphatase 2a (Pp2a)		8e-10
3c5w_A		232	Complex Between Pp2a-Specific Methylesterase Pme-1		9e-64
1ibr_D		462	Complex Of Ran With Importin Beta Length = 462		8e-05
1m5n_S		485	Crystal Structure Of Heat Repeats (1-11) Of Importi		8e-05
2p8q_A		876	Crystal Structure Of Human Importin Beta Bound To T		1e-04
1qgk_A		876	Structure Of Importin Beta Bound To The Ibb Domain		1e-04
2qna_A		762	Crystal Structure Of Human Importin-Beta (127-876)		2e-04
1ukl_A		876	Crystal Structure Of Importin-Beta And Srebp-2 Comp		3e-04
1f59_A		442	Importin-Beta-Fxfg Nucleoporin Complex Length = 442		7e-04

>pdb|2IE3|A Chain A, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 589