Citrus Sinensis ID: 007975

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580---
MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQGKYLAKCFNRMEEAEKNPEGPLRFRGTGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWVSIGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFGRDSSGI
cccccHHHHHHHHHcccccHHHHHHHHHccccccEEEEEccccccccccccccccccccEEEEEcccHHHHHHHHHcccccccEEEEcccccccccccHHHHHccccccccccHHHHHHHHcccccEEEEEEEEEEEEccccEEEEEcccccccccccEEEEcccEEEEEccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHHHHHHcccEEEccccEEEEEccEEEEEEccccccEEEccccEEEcccccccHHHHHHHHHHccccccEEEccccccccccccEEEEccccccccccccccHHHHHHHccccccccccHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEcccccEEEEccccEEEEccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccc
ccccHHHHccHHHcccccHHHHHHHHHHHHcccEEEcccccccccccccccccccccccEEEEEccHHHHHHHHHccccccccEEEEccccEEEEccccccccccEEEccccHHHHHHHHHHccccEEEEEEEEEEEcccccEEEEEEccccccccccEEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcEEEEcccccHHHHHHHHHHHHHHHHHHHcHHHHHccEEEEEEccccHccHHHHHHHHHHHHHHHHcccEEEEcEEEEEEcccEEEEEEcccccEEEEccEEEEEEccccccHHHHHHHHHcccccccEEEEccEEEEcccccEEEEEccccccccccHHHHHHHHHHccccccccEcHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEccEEEEccccEcEcccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MRGYTFYERVSrafhdyssLSKLIVISTVGGGSLIAYseanassdaysvappemgikkKKVVVLGTGwagtsflknlnnpsydvqvisprnyfaftpllpsvtcgtvearsivepvrnivrkknvDICFWEAECFKIDAENKKVYCRSsqntnlngkeefcmDYDYLVIAMGarantfntpgveenCNFLKEVEDAQRIRRNVIESFekaslpnlsdeERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKfsrdgidvkLGSMVVKVTDKEIFTKVrgngetssmpygmvvwstgiaphAIIKDFMKQVGQTNRRAlatdewlrvegsdsiyalgdcatvnqRRVMEDIAAIFSKadkdnsgtlTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQGKYLAKCFNRMeeaeknpegplrfrgtgrhrfqpfryqhlgqfaplggeqtaaqlpwdwvsigrssqWLWYSVYTSKLVSWRTRALVvsdwtrrfifgrdssgi
mrgytfyeRVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEArsivepvrnivrkknvDICFWEAECFKIDAENKKVYCRSsqntnlngkeeFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIEsfekaslpnlsdeeRKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEekfsrdgidvklgsmvvkvtdkeiftkvrgngetssmpYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIfskadkdnsgtltVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQGKYLAKCFNRMEEaeknpegplrfrGTGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWVSIGRSSQWLWYSVYTSKLVSWRTralvvsdwtrrfifgrdssgi
MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQGKYLAKCFNRMEEAEKNPEGPLRFRGTGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWVSIGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFGRDSSGI
***YTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEAN*****YSVA**EMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESF************RKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEF************************GKYLAKCF******************TGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWVSIGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFG******
****T***RVSRAFHDYSSLSKLIVISTVGGGSLIAYS***********************VVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNL*DEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVG*TNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQGKYLAKCFNRMEEAEKN********GTGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWVSIGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFGRDSSGI
MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQGKYLAKCFNRMEEAEKNPEGPLRFRGTGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWVSIGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFGRDSSGI
*RGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANAS***********GIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQGKYLAKCFNRMEEAEKNPEGPLRFRGTGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWVSIGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFGRDSSG*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQGKYLAKCFNRMEEAEKNPEGPLRFRGTGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWVSIGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFGRDSSGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query583 2.2.26 [Sep-21-2011]
Q94BV7582 NAD(P)H dehydrogenase B2, yes no 0.996 0.998 0.767 0.0
F4JJJ3580 NAD(P)H dehydrogenase B3, no no 0.993 0.998 0.751 0.0
Q9SKT7582 NAD(P)H dehydrogenase B4, no no 0.984 0.986 0.685 0.0
Q1JPL4571 NAD(P)H dehydrogenase B1, no no 0.927 0.947 0.645 0.0
P40215560 External NADH-ubiquinone yes no 0.598 0.623 0.460 2e-80
Q07500545 External NADH-ubiquinone no no 0.595 0.636 0.447 2e-74
F2Z699582 External alternative NADH no no 0.610 0.611 0.436 4e-73
Q55CD9451 Probable NADH dehydrogena no no 0.535 0.691 0.457 1e-72
O14121551 Probable NADH-ubiquinone yes no 0.540 0.571 0.404 8e-72
O43090551 Probable NADH-ubiquinone no no 0.620 0.656 0.360 3e-65
>sp|Q94BV7|NDB2_ARATH NAD(P)H dehydrogenase B2, mitochondrial OS=Arabidopsis thaliana GN=NDB2 PE=1 SV=1 Back     alignment and function desciption
 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/584 (76%), Positives = 506/584 (86%), Gaps = 3/584 (0%)

Query: 1   MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKK 60
           MR ++ +ER S+AF D+ SL++++V+ST+ GG LIAYSEANAS  A   A  E G KKKK
Sbjct: 1   MRNFSVFERFSKAFKDHPSLTRILVVSTISGGGLIAYSEANASYGANGGAVVETGTKKKK 60

Query: 61  VVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIV 120
           VV+LGTGWAGTSFLKNLNN  Y+VQ+ISPRNYFAFTPLLPSVTCGTVEARS+VEP+RNI 
Sbjct: 61  VVLLGTGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIG 120

Query: 121 RKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNT 180
           RK NVD  + EAECFKID  +KKVYCRS Q  + NGK+EF +DYDYLVIA GA++NTFN 
Sbjct: 121 RK-NVDTSYLEAECFKIDPASKKVYCRSKQGLSSNGKKEFSVDYDYLVIATGAQSNTFNI 179

Query: 181 PGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAA 240
           PGVEENC+FLKEVEDAQRIR+ VI+SFEKASLP LSDEERKRILHFV+VGGGPTGVEFAA
Sbjct: 180 PGVEENCHFLKEVEDAQRIRKTVIDSFEKASLPELSDEERKRILHFVVVGGGPTGVEFAA 239

Query: 241 ELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSM 300
           ELHDFV EDL  LYP+ K SV+ITLLEAADHIL MFDKRIT FAEEKFSRDGIDVKLGSM
Sbjct: 240 ELHDFVTEDLVSLYPRAKGSVRITLLEAADHILTMFDKRITEFAEEKFSRDGIDVKLGSM 299

Query: 301 VVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWL 360
           V KV +K+I  K +G GE SS+PYGM+VWSTGI    +IKDFMKQ+GQ NRRALATDEWL
Sbjct: 300 VTKVNEKDISAKTKG-GEVSSIPYGMIVWSTGIGTRPVIKDFMKQIGQGNRRALATDEWL 358

Query: 361 RVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQV 420
           RVEG+D+IYALGDCAT+NQR+VMED++AIFSKADKD SGTLT+KEFQE + DIC RYPQV
Sbjct: 359 RVEGTDNIYALGDCATINQRKVMEDVSAIFSKADKDKSGTLTLKEFQEAMDDICVRYPQV 418

Query: 421 ELYLKNKKMGDFGDLLKEAK-GDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQ 479
           ELYLK+K+M    DLLKEA+  DV+++ +EL IEEFK ALS+VDSQ+K LPATAQVAAQQ
Sbjct: 419 ELYLKSKRMRGIADLLKEAETDDVSKNNIELKIEEFKSALSQVDSQVKFLPATAQVAAQQ 478

Query: 480 GKYLAKCFNRMEEAEKNPEGPLRFRGTGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWV 539
           G YLAKCF+RMEE EK+PEGP+R RG GRHRF+PFRY+HLGQFAPLGGEQTAAQLP DWV
Sbjct: 479 GAYLAKCFDRMEECEKSPEGPIRMRGEGRHRFRPFRYRHLGQFAPLGGEQTAAQLPGDWV 538

Query: 540 SIGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFGRDSSGI 583
           SIG SSQWLWYSVY SK VSWRTR LVVSDW RRFIFGRDSS I
Sbjct: 539 SIGHSSQWLWYSVYASKQVSWRTRVLVVSDWMRRFIFGRDSSSI 582
Calcium-dependent NAD(P)H dehydrogenase; more efficient on NADH. Binds calcium ions.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: -EC: .EC: -
>sp|F4JJJ3|NDB3_ARATH NAD(P)H dehydrogenase B3, mitochondrial OS=Arabidopsis thaliana GN=NDB3 PE=2 SV=1 Back     alignment and function description
>sp|Q9SKT7|NDB4_ARATH NAD(P)H dehydrogenase B4, mitochondrial OS=Arabidopsis thaliana GN=NDB4 PE=1 SV=1 Back     alignment and function description
>sp|Q1JPL4|NDB1_ARATH NAD(P)H dehydrogenase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 Back     alignment and function description
>sp|P40215|NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE1 PE=1 SV=1 Back     alignment and function description
>sp|Q07500|NDH2_YEAST External NADH-ubiquinone oxidoreductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE2 PE=1 SV=1 Back     alignment and function description
>sp|F2Z699|NDH2_YARLI External alternative NADH-ubiquinone oxidoreductase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDH2 PE=1 SV=1 Back     alignment and function description
>sp|Q55CD9|NDH_DICDI Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2 Back     alignment and function description
>sp|O14121|NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.07 PE=3 SV=1 Back     alignment and function description
>sp|O43090|NDH2_SCHPO Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.15c PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query583
224078850584 predicted protein [Populus trichocarpa] 1.0 0.998 0.818 0.0
255567411580 NADH dehydrogenase, putative [Ricinus co 0.994 1.0 0.831 0.0
224114085581 predicted protein [Populus trichocarpa] 0.993 0.996 0.811 0.0
449457690584 PREDICTED: NAD(P)H dehydrogenase B3, mit 1.0 0.998 0.785 0.0
449488409584 PREDICTED: NAD(P)H dehydrogenase B3, mit 1.0 0.998 0.784 0.0
147827159618 hypothetical protein VITISV_016566 [Viti 0.948 0.894 0.820 0.0
357475923578 External NADH-ubiquinone oxidoreductase 0.987 0.996 0.753 0.0
297809693583 hypothetical protein ARALYDRAFT_911770 [ 0.998 0.998 0.767 0.0
5732076583 contains similarity to Pfam family PF000 0.998 0.998 0.768 0.0
388505494574 unknown [Lotus japonicus] 0.981 0.996 0.753 0.0
>gi|224078850|ref|XP_002305652.1| predicted protein [Populus trichocarpa] gi|222848616|gb|EEE86163.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/584 (81%), Positives = 532/584 (91%), Gaps = 1/584 (0%)

Query: 1   MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKK 60
           M G + ++R SRAF DY SL+KLIV+ TV GG  +AY++AN+S+ A++VAPP   I+KKK
Sbjct: 1   MNGLSLFKRASRAFDDYPSLAKLIVVCTVSGGGYVAYADANSSNGAHAVAPPVPEIRKKK 60

Query: 61  VVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIV 120
           VVV+GTGWAGTSFLK LNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEP+R+IV
Sbjct: 61  VVVIGTGWAGTSFLKKLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRSIV 120

Query: 121 RKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNT 180
           RKK+V + + EAECFKIDAENKKVYCR + ++++NGKEEF +DYDYLVIAMGAR NTFNT
Sbjct: 121 RKKSVSVSYCEAECFKIDAENKKVYCRPNPDSSMNGKEEFAVDYDYLVIAMGARPNTFNT 180

Query: 181 PGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAA 240
           PGV E+CNFLKEVEDAQRIRR+VI+SFEKASLP LSDEERKRILHFV+VGGGPTGVEFAA
Sbjct: 181 PGVVEHCNFLKEVEDAQRIRRSVIDSFEKASLPTLSDEERKRILHFVVVGGGPTGVEFAA 240

Query: 241 ELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSM 300
           ELHDFV++DL KLYP  KD V+IT+LEAADHILNMFDKRIT FAE+KF RDGIDVKLGSM
Sbjct: 241 ELHDFVNDDLVKLYPAAKDFVQITILEAADHILNMFDKRITDFAEKKFHRDGIDVKLGSM 300

Query: 301 VVKVTDKEIFTKVRGN-GETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEW 359
           VVKV+DKEI TKVRGN GE +++PYGMVVWSTGI  H +I+ FM+Q+GQTNRRALATDEW
Sbjct: 301 VVKVSDKEISTKVRGNGGEITAIPYGMVVWSTGIGTHPVIRSFMQQIGQTNRRALATDEW 360

Query: 360 LRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQ 419
           LRVEG +SIYALGDCAT+NQR+VMEDIAAIF KADKDNSGTLTVKEFQEVI DICERYPQ
Sbjct: 361 LRVEGCNSIYALGDCATINQRKVMEDIAAIFKKADKDNSGTLTVKEFQEVIDDICERYPQ 420

Query: 420 VELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQ 479
           VELYLKNKKM D  DLLK AKGDVA++A+ELNIEEFKKALSEVDSQMKNLPATAQVAAQQ
Sbjct: 421 VELYLKNKKMRDIADLLKMAKGDVAKEAIELNIEEFKKALSEVDSQMKNLPATAQVAAQQ 480

Query: 480 GKYLAKCFNRMEEAEKNPEGPLRFRGTGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWV 539
           G YLA CFNRMEEAEKNPEGP+RFR  GRHRF+PFRY+HLGQFAPLGGEQTAAQLP DWV
Sbjct: 481 GTYLANCFNRMEEAEKNPEGPIRFREEGRHRFRPFRYKHLGQFAPLGGEQTAAQLPGDWV 540

Query: 540 SIGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFGRDSSGI 583
           SIG SSQWLWYSVY SKLVSWRTRALV++DWTRRF+FGRDSS I
Sbjct: 541 SIGHSSQWLWYSVYASKLVSWRTRALVITDWTRRFVFGRDSSRI 584

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255567411|ref|XP_002524685.1| NADH dehydrogenase, putative [Ricinus communis] gi|223536046|gb|EEF37704.1| NADH dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224114085|ref|XP_002316663.1| predicted protein [Populus trichocarpa] gi|222859728|gb|EEE97275.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449457690|ref|XP_004146581.1| PREDICTED: NAD(P)H dehydrogenase B3, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449488409|ref|XP_004158024.1| PREDICTED: NAD(P)H dehydrogenase B3, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147827159|emb|CAN66469.1| hypothetical protein VITISV_016566 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357475923|ref|XP_003608247.1| External NADH-ubiquinone oxidoreductase [Medicago truncatula] gi|87240748|gb|ABD32606.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase; Calcium-binding EF-hand [Medicago truncatula] gi|355509302|gb|AES90444.1| External NADH-ubiquinone oxidoreductase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297809693|ref|XP_002872730.1| hypothetical protein ARALYDRAFT_911770 [Arabidopsis lyrata subsp. lyrata] gi|297318567|gb|EFH48989.1| hypothetical protein ARALYDRAFT_911770 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|5732076|gb|AAD48975.1|AF162444_7 contains similarity to Pfam family PF00070 - Pyridine nucleotide-disulphide oxidoreductase class-I; score=26.1, E=0.0008, N=1 [Arabidopsis thaliana] gi|7267261|emb|CAB81044.1| AT4g05020 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388505494|gb|AFK40813.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query583
TAIR|locus:2119667580 NDB3 "AT4G21490" [Arabidopsis 0.993 0.998 0.751 1.8e-238
TAIR|locus:2051431582 NDB4 "AT2G20800" [Arabidopsis 0.987 0.989 0.685 1.3e-217
TAIR|locus:2123713571 NDB1 "AT4G28220" [Arabidopsis 0.977 0.998 0.630 8.4e-200
SGD|S000004753560 NDE1 "Mitochondrial external N 0.598 0.623 0.460 7.9e-93
UNIPROTKB|G4N8E7587 MGG_06276 "Uncharacterized pro 0.614 0.609 0.423 8.7e-91
CGD|CAL0004762574 NDE1 [Candida albicans (taxid: 0.389 0.395 0.436 2.3e-90
UNIPROTKB|Q5AEC9574 NDE1 "Potential mitochondrial 0.389 0.395 0.436 2.3e-90
UNIPROTKB|G4NIR5689 MGG_04140 "Mitochondrial NADH 0.866 0.732 0.386 8.3e-90
SGD|S000002243545 NDE2 "Mitochondrial external N 0.593 0.634 0.448 2.1e-88
DICTYBASE|DDB_G0295661584 DDB_G0295661 "pyridine nucleot 0.686 0.684 0.390 2.7e-88
TAIR|locus:2119667 NDB3 "AT4G21490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2299 (814.3 bits), Expect = 1.8e-238, P = 1.8e-238
 Identities = 439/584 (75%), Positives = 500/584 (85%)

Query:     1 MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKK 60
             MR + ++ER+S+AFHDY SLSK++V+ST+ GG LI YSEAN S   YS    E   +K+K
Sbjct:     1 MRPFAYFERLSQAFHDYPSLSKILVVSTISGGGLIVYSEANPS---YSNNGVETKTRKRK 57

Query:    61 VVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIV 120
             VV+LGTGWAG SFLK LNN SY+VQVISPRNYFAFTPLLPSVTCGTVEARS+VEP+RNI 
Sbjct:    58 VVLLGTGWAGASFLKTLNNSSYEVQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIA 117

Query:   121 RKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNT 180
             RK+NV++ F EAECFKID  +KKVYCRS Q  N  GK+EF +DYDYLVIA GA++NTFN 
Sbjct:   118 RKQNVEMSFLEAECFKIDPGSKKVYCRSKQGVNSKGKKEFDVDYDYLVIATGAQSNTFNI 177

Query:   181 PGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAA 240
             PGVEENC+FLKEVEDAQRIR  VI+SFEKASLP L+++ERKR+LHFV+VGGGPTGVEFA+
Sbjct:   178 PGVEENCHFLKEVEDAQRIRSTVIDSFEKASLPGLNEQERKRMLHFVVVGGGPTGVEFAS 237

Query:   241 ELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSM 300
             ELHDFV+EDL KLYPK K+ V+ITLLEAADHIL MFDKRIT FAEEKF+RDGIDVKLGSM
Sbjct:   238 ELHDFVNEDLVKLYPKAKNLVQITLLEAADHILTMFDKRITEFAEEKFTRDGIDVKLGSM 297

Query:   301 VVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWL 360
             VVKV DKEI  K +  GE S++PYGM+VWSTGI    +IKDFMKQ+GQ NRRALATDEWL
Sbjct:   298 VVKVNDKEISAKTKA-GEVSTIPYGMIVWSTGIGTRPVIKDFMKQIGQGNRRALATDEWL 356

Query:   361 RVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQV 420
             RVEG D+IYALGDCAT+NQR+VMEDIAAIF KADK+NSGTLT+KEF EV+ DIC+RYPQV
Sbjct:   357 RVEGCDNIYALGDCATINQRKVMEDIAAIFKKADKENSGTLTMKEFHEVMSDICDRYPQV 416

Query:   421 ELYLKNKKMGDFGDLLKEAKGDVAQD-AVELNIEEFKKALSEVDSQMKNLPATAQVAAQQ 479
             ELYLK+K M    DLLK+A+ +   + +VEL+IEE K AL +VDSQ+K LPAT QVAAQQ
Sbjct:   417 ELYLKSKGMHGITDLLKQAQAENGSNKSVELDIEELKSALCQVDSQVKLLPATGQVAAQQ 476

Query:   480 GKYLAKCFNRMEEAEKNPEGPLRFRGTGRHRFQPFRYQHLGQFAPLGGEQTAAQLPWDWV 539
             G YLAKCF+RME  EKNPEGP+R RG GRHRF+PFRY+HLGQFAPLGGEQTAAQLP DWV
Sbjct:   477 GTYLAKCFDRMEVCEKNPEGPIRIRGEGRHRFRPFRYRHLGQFAPLGGEQTAAQLPGDWV 536

Query:   540 SIGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFGRDSSGI 583
             SIG SSQWLWYSVY SK VSWRTR LVVSDW RRFIFGRDSS I
Sbjct:   537 SIGHSSQWLWYSVYASKQVSWRTRVLVVSDWMRRFIFGRDSSRI 580
GO:0003954 "NADH dehydrogenase activity" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2051431 NDB4 "AT2G20800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123713 NDB1 "AT4G28220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000004753 NDE1 "Mitochondrial external NADH dehydrogenase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G4N8E7 MGG_06276 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
CGD|CAL0004762 NDE1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AEC9 NDE1 "Potential mitochondrial nonproton-pumping NADH dehydrogenase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|G4NIR5 MGG_04140 "Mitochondrial NADH dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
SGD|S000002243 NDE2 "Mitochondrial external NADH dehydrogenase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0295661 DDB_G0295661 "pyridine nucleotide-disulphide oxidoreductase, NAD-binding region domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94BV7NDB2_ARATH1, ., 6, ., -, ., -0.76710.99650.9982yesno
F4JJJ3NDB3_ARATH1, ., 6, ., -, ., -0.75170.99310.9982nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.6.5.30.824
3rd Layer1.6.50.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00009744001
SubName- Full=Chromosome undetermined scaffold_247, whole genome shotgun sequence; (583 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00018147001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (616 aa)
   •• • 0.426

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query583
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protei 1e-120
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 9e-93
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 4e-41
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 7e-26
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 4e-25
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 1e-24
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protei 2e-19
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 5e-18
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy p 2e-17
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 4e-15
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 4e-15
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 1e-13
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 1e-13
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 5e-12
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 3e-10
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase 3e-10
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 9e-10
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 3e-09
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 7e-09
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoredu 2e-08
PRK13512438 PRK13512, PRK13512, coenzyme A disulfide reductase 8e-08
TIGR02053463 TIGR02053, MerA, mercuric reductase 1e-07
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 2e-07
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 4e-07
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase f 2e-06
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD( 2e-05
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Va 3e-05
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide 6e-05
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 3e-04
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase 3e-04
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide 8e-04
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 0.001
pfam0003629 pfam00036, efhand, EF hand 0.001
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 0.002
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information 
 Score =  361 bits (929), Expect = e-120
 Identities = 158/363 (43%), Positives = 221/363 (60%), Gaps = 15/363 (4%)

Query: 56  IKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEP 115
           +KK  VVVLGTGWAG  F++NL+   Y++ VISPRN+  FTPLLP  T GT+E RSI EP
Sbjct: 8   LKKPNVVVLGTGWAGAYFVRNLDPKKYNITVISPRNHMLFTPLLPQTTTGTLEFRSICEP 67

Query: 116 VRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARA 175
           VR  + K      +  A  + +D E K+V C     +N      F + YD LV+A GAR 
Sbjct: 68  VRPALAKL--PNRYLRAVVYDVDFEEKRVKCGVVSKSNNANVNTFSVPYDKLVVAHGARP 125

Query: 176 NTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTG 235
           NTFN PGVEE   FLKEV  A+ IR+ +++  E+ASLP  S EERKR+LHFV+VGGGPTG
Sbjct: 126 NTFNIPGVEERAFFLKEVNHARGIRKRIVQCIERASLPTTSVEERKRLLHFVVVGGGPTG 185

Query: 236 VEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDV 295
           VEFAAEL DF  +D+  L P++ +  K+T+LEA   +L  FD+ +  + + +  R G+D+
Sbjct: 186 VEFAAELADFFRDDVRNLNPELVEECKVTVLEAGSEVLGSFDQALRKYGQRRLRRLGVDI 245

Query: 296 KLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALA 355
           +  + V +V DKE+  K   +GE   +P G+VVWSTG+ P  + K    +V +T+R  ++
Sbjct: 246 RTKTAVKEVLDKEVVLK---DGEV--IPTGLVVWSTGVGPGPLTKQL--KVDKTSRGRIS 298

Query: 356 TDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICE 415
            D+ LRV+   +++ALGDCA     R +  +A + S+      G    KEF   +K    
Sbjct: 299 VDDHLRVKPIPNVFALGDCAANE-ERPLPTLAQVASQ-----QGVYLAKEFNNELKGKPM 352

Query: 416 RYP 418
             P
Sbjct: 353 SKP 355

Length = 424
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224171 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236106 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|184103 PRK13512, PRK13512, coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|235779 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 583
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
PRK09564444 coenzyme A disulfide reductase; Reviewed 100.0
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 100.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 100.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PLN02507499 glutathione reductase 100.0
PRK06370463 mercuric reductase; Validated 100.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
PRK06116450 glutathione reductase; Validated 100.0
PRK14694468 putative mercuric reductase; Provisional 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 100.0
PLN02546558 glutathione reductase 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PTZ00058561 glutathione reductase; Provisional 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
PRK07846451 mycothione reductase; Reviewed 100.0
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 100.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK14727479 putative mercuric reductase; Provisional 100.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PTZ00052499 thioredoxin reductase; Provisional 100.0
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 99.98
PTZ00153659 lipoamide dehydrogenase; Provisional 99.98
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.98
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.97
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.97
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.97
PRK12831464 putative oxidoreductase; Provisional 99.97
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 99.97
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.97
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.97
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.97
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.97
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.97
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.97
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.97
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.96
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.96
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.96
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 99.96
PRK12814652 putative NADPH-dependent glutamate synthase small 99.96
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 99.95
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.95
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.95
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.95
PRK13984604 putative oxidoreductase; Provisional 99.94
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.94
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.94
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.93
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.93
PLN02852491 ferredoxin-NADP+ reductase 99.93
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.93
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.92
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.92
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.91
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.9
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.88
PRK065671028 putative bifunctional glutamate synthase subunit b 99.83
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.83
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.78
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.78
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.77
KOG2755334 consensus Oxidoreductase [General function predict 99.75
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.66
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.62
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.59
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.57
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 99.57
PTZ00188506 adrenodoxin reductase; Provisional 99.56
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.55
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.45
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.44
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.27
COG4529474 Uncharacterized protein conserved in bacteria [Fun 98.83
COG2081408 Predicted flavoproteins [General function predicti 98.82
PRK09897534 hypothetical protein; Provisional 98.76
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.72
COG0579429 Predicted dehydrogenase [General function predicti 98.7
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.68
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.64
PLN02463447 lycopene beta cyclase 98.63
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.58
PRK12842574 putative succinate dehydrogenase; Reviewed 98.57
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.56
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.53
PRK13977576 myosin-cross-reactive antigen; Provisional 98.49
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.49
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.48
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.45
PRK10157428 putative oxidoreductase FixC; Provisional 98.45
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.45
PRK06847375 hypothetical protein; Provisional 98.44
PRK10015429 oxidoreductase; Provisional 98.41
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.41
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.4
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.39
PLN02697529 lycopene epsilon cyclase 98.38
PRK11728393 hydroxyglutarate oxidase; Provisional 98.38
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.37
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.36
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.35
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.35
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.34
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.33
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.32
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.32
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.31
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.31
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.31
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.3
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.3
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.29
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.28
PRK07236386 hypothetical protein; Provisional 98.28
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.27
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.27
PRK06184502 hypothetical protein; Provisional 98.27
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.27
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.27
PRK06834488 hypothetical protein; Provisional 98.26
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.26
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.26
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.26
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.26
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.25
PRK06126545 hypothetical protein; Provisional 98.25
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.25
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.24
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.23
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.22
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.21
PRK07233434 hypothetical protein; Provisional 98.21
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.21
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 98.21
PRK06370463 mercuric reductase; Validated 98.2
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.2
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.2
TIGR02053463 MerA mercuric reductase. This model represents the 98.19
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.19
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.18
PRK05257494 malate:quinone oxidoreductase; Validated 98.17
PRK14694468 putative mercuric reductase; Provisional 98.15
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.15
PRK13512438 coenzyme A disulfide reductase; Provisional 98.15
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.14
PRK08163396 salicylate hydroxylase; Provisional 98.13
PRK08244493 hypothetical protein; Provisional 98.13
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.13
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.13
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.12
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.11
PRK09126392 hypothetical protein; Provisional 98.11
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.1
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.1
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.1
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.1
PRK06116450 glutathione reductase; Validated 98.09
PRK07846451 mycothione reductase; Reviewed 98.09
COG2081408 Predicted flavoproteins [General function predicti 98.09
PRK07190487 hypothetical protein; Provisional 98.09
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.08
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.07
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.06
PLN02507499 glutathione reductase 98.05
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.05
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.04
PRK07045388 putative monooxygenase; Reviewed 98.03
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.03
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.03
PRK13748561 putative mercuric reductase; Provisional 98.03
PLN02487569 zeta-carotene desaturase 98.03
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.02
PLN02464627 glycerol-3-phosphate dehydrogenase 98.02
PRK11445351 putative oxidoreductase; Provisional 98.02
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.01
PRK14727479 putative mercuric reductase; Provisional 98.01
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.0
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.0
PLN02612567 phytoene desaturase 97.99
PRK05868372 hypothetical protein; Validated 97.99
PRK06753373 hypothetical protein; Provisional 97.98
PRK08132547 FAD-dependent oxidoreductase; Provisional 97.98
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.98
PRK07588391 hypothetical protein; Provisional 97.97
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.97
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.97
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.97
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.97
PRK08013400 oxidoreductase; Provisional 97.95
TIGR00275400 flavoprotein, HI0933 family. The model when search 97.95
PLN02985514 squalene monooxygenase 97.94
PRK06185407 hypothetical protein; Provisional 97.93
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.93
PRK08401466 L-aspartate oxidase; Provisional 97.93
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.93
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.92
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.92
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.91
PRK06475400 salicylate hydroxylase; Provisional 97.91
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.91
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 97.91
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.91
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.9
PTZ00058561 glutathione reductase; Provisional 97.9
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.9
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.9
PTZ00052499 thioredoxin reductase; Provisional 97.9
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 97.9
PRK06481506 fumarate reductase flavoprotein subunit; Validated 97.9
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.89
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.88
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.88
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.88
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.87
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.87
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.87
PRK06996398 hypothetical protein; Provisional 97.87
PRK10262321 thioredoxin reductase; Provisional 97.87
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.86
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.86
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 97.85
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.85
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.84
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.84
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.83
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.82
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.8
PLN02172461 flavin-containing monooxygenase FMO GS-OX 97.8
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.79
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 97.78
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.77
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.77
KOG2853509 consensus Possible oxidoreductase [General functio 97.77
PRK06847375 hypothetical protein; Provisional 97.76
PLN02661357 Putative thiazole synthesis 97.75
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.75
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.74
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.73
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.72
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.72
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.7
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.7
PRK07538413 hypothetical protein; Provisional 97.7
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.69
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.69
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.69
PTZ00153659 lipoamide dehydrogenase; Provisional 97.66
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.65
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.65
PLN02546558 glutathione reductase 97.64
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.64
PRK12831464 putative oxidoreductase; Provisional 97.63
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.63
COG3349485 Uncharacterized conserved protein [Function unknow 97.62
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.61
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.61
PRK07236386 hypothetical protein; Provisional 97.59
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.57
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.57
PRK07208479 hypothetical protein; Provisional 97.55
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.55
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.55
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 97.53
PLN02852 491 ferredoxin-NADP+ reductase 97.52
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.52
PLN02268435 probable polyamine oxidase 97.5
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.5
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 97.48
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.48
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 97.47
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.46
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.46
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 97.46
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.45
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 97.44
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.43
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.43
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.42
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 97.42
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.4
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.39
PRK06175433 L-aspartate oxidase; Provisional 97.39
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.37
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.37
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.37
PLN02576496 protoporphyrinogen oxidase 97.36
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.35
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 97.35
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 97.35
PRK06834488 hypothetical protein; Provisional 97.32
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 97.31
PRK12416463 protoporphyrinogen oxidase; Provisional 97.31
PRK08244493 hypothetical protein; Provisional 97.3
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.3
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.29
PLN02328808 lysine-specific histone demethylase 1 homolog 97.29
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 97.29
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.29
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.28
PLN02463447 lycopene beta cyclase 97.28
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.25
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 97.24
PTZ00188 506 adrenodoxin reductase; Provisional 97.24
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.23
PLN02529738 lysine-specific histone demethylase 1 97.23
PLN02568539 polyamine oxidase 97.2
PRK06184502 hypothetical protein; Provisional 97.19
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.19
PRK08163396 salicylate hydroxylase; Provisional 97.15
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.14
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.14
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.13
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.1
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.1
KOG1298509 consensus Squalene monooxygenase [Lipid transport 97.09
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.09
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.09
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.07
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.07
PLN02661357 Putative thiazole synthesis 97.07
PLN02697529 lycopene epsilon cyclase 97.06
PRK07190487 hypothetical protein; Provisional 97.06
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.05
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.01
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.01
PTZ00367567 squalene epoxidase; Provisional 96.99
PRK09897 534 hypothetical protein; Provisional 96.98
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 96.98
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 96.92
PRK08132 547 FAD-dependent oxidoreductase; Provisional 96.91
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 96.88
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 96.88
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 96.87
PRK08294634 phenol 2-monooxygenase; Provisional 96.85
PRK07588391 hypothetical protein; Provisional 96.85
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 96.84
KOG2852380 consensus Possible oxidoreductase [General functio 96.84
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 96.84
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 96.84
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 96.83
PLN02676487 polyamine oxidase 96.83
PRK08274466 tricarballylate dehydrogenase; Validated 96.82
PRK07121492 hypothetical protein; Validated 96.82
KOG03992142 consensus Glutamate synthase [Amino acid transport 96.82
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 96.81
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 96.81
PRK06753373 hypothetical protein; Provisional 96.79
PRK13984604 putative oxidoreductase; Provisional 96.78
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 96.76
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 96.76
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.75
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 96.72
PRK05868372 hypothetical protein; Validated 96.71
PRK11445351 putative oxidoreductase; Provisional 96.7
TIGR00275400 flavoprotein, HI0933 family. The model when search 96.67
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 96.66
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 96.65
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 96.64
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 96.64
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 96.63
PRK06475400 salicylate hydroxylase; Provisional 96.59
PRK09126392 hypothetical protein; Provisional 96.59
PRK08013400 oxidoreductase; Provisional 96.57
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 96.54
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 96.54
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 96.52
PRK07045388 putative monooxygenase; Reviewed 96.51
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 96.51
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 96.49
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.49
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 96.46
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.45
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 96.45
PRK07804541 L-aspartate oxidase; Provisional 96.43
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.39
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 96.37
PRK06185407 hypothetical protein; Provisional 96.35
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 96.35
PRK06996398 hypothetical protein; Provisional 96.35
PRK07538413 hypothetical protein; Provisional 96.35
PRK06481506 fumarate reductase flavoprotein subunit; Validated 96.33
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 96.33
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.32
PLN03000 881 amine oxidase 96.31
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 96.31
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 96.29
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 96.27
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 96.22
PRK06567 1028 putative bifunctional glutamate synthase subunit b 96.2
PRK07395553 L-aspartate oxidase; Provisional 96.2
PRK08071510 L-aspartate oxidase; Provisional 96.17
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 96.16
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.16
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 96.16
PRK12839572 hypothetical protein; Provisional 96.13
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.12
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.11
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 96.1
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 96.09
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 96.09
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 96.09
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 96.06
PLN02815594 L-aspartate oxidase 96.04
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 95.99
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.98
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 95.98
PLN02976 1713 amine oxidase 95.95
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 95.93
PRK08275554 putative oxidoreductase; Provisional 95.91
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 95.88
PRK08274 466 tricarballylate dehydrogenase; Validated 95.83
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 95.81
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 95.77
PRK02106560 choline dehydrogenase; Validated 95.72
PLN02985514 squalene monooxygenase 95.66
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 95.65
PRK09231582 fumarate reductase flavoprotein subunit; Validated 95.63
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 95.62
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 95.6
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 95.6
PRK08294 634 phenol 2-monooxygenase; Provisional 95.58
PRK09077536 L-aspartate oxidase; Provisional 95.57
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 95.57
KOG4716503 consensus Thioredoxin reductase [Posttranslational 95.54
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 95.53
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.46
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 95.44
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 95.39
PRK08275 554 putative oxidoreductase; Provisional 95.34
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 95.34
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 95.27
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.09
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 95.09
PRK07512513 L-aspartate oxidase; Provisional 95.08
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 95.02
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 95.01
PRK07121492 hypothetical protein; Validated 94.93
KOG2960328 consensus Protein involved in thiamine biosynthesi 94.88
COG2303542 BetA Choline dehydrogenase and related flavoprotei 94.8
KOG0404322 consensus Thioredoxin reductase [Posttranslational 94.58
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 94.46
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 94.44
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 94.35
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 94.3
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 94.29
PRK06719157 precorrin-2 dehydrogenase; Validated 94.29
COG3573552 Predicted oxidoreductase [General function predict 94.17
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 93.99
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 93.95
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 93.94
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 93.92
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 93.91
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 93.87
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 93.86
PRK06175433 L-aspartate oxidase; Provisional 93.83
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.81
PLN02785587 Protein HOTHEAD 93.8
KOG2755334 consensus Oxidoreductase [General function predict 93.77
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 93.52
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.47
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 93.43
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 93.42
PRK08401466 L-aspartate oxidase; Provisional 93.32
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.15
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 93.13
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.11
PRK07804541 L-aspartate oxidase; Provisional 92.96
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.81
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 92.73
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 92.63
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 92.6
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 92.58
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 92.38
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 92.36
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.26
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 92.24
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 92.15
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 92.14
PRK15116268 sulfur acceptor protein CsdL; Provisional 92.1
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=7.1e-90  Score=684.25  Aligned_cols=488  Identities=60%  Similarity=1.005  Sum_probs=441.6

Q ss_pred             CCccchhhhhhhcccCCCchhHHHHHHHhhccceeeeecccCCCCCcCCCCCCCCCCCCeEEEECCcHHHHHHHHhcCCC
Q 007975            1 MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNP   80 (583)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVIIGgG~aGl~aA~~L~~~   80 (583)
                      |.....+.|..+.+...++..+.+..++++++....|++.++...   .+..+...++++|||+|+||+|.++++.|...
T Consensus         1 m~~~~~~~r~s~~~~~~~s~~k~l~~st~~g~~~~~y~~an~~~~---~~~~~~~~kKk~vVVLGsGW~a~S~lk~ldts   77 (491)
T KOG2495|consen    1 MLFLSSLARISRTTSSSKSTLKILLASTLSGGGLVAYSEANPSEK---VPGPKNGGKKKRVVVLGSGWGAISLLKKLDTS   77 (491)
T ss_pred             CchhhhHHhhccccccCcchhhhhhhheeccceeEEEecCCcccc---CCCCCCCCCCceEEEEcCchHHHHHHHhcccc
Confidence            455566667777777778888888999998888888886664443   33344566789999999999999999999999


Q ss_pred             CCeEEEEcCCCCCCCCCchhhhccccCCCcccchhHHHHHHhCCCcEEEEEeEEEEEecCCCEEEEecCCCCCCCCCceE
Q 007975           81 SYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEF  160 (583)
Q Consensus        81 g~~Vtlie~~~~~~~~p~l~~~~~g~~~~~~i~~~~~~~~~~~~i~v~~~~~~v~~id~~~~~v~~~~~~~~~~~~~~~~  160 (583)
                      -|+|+||++++||.|+|++|....|+++.+++++|++.+.++.+.++.|+++++..||++++.|.++.....+.  ..++
T Consensus        78 ~YdV~vVSPRnyFlFTPLLpS~~vGTve~rSIvEPIr~i~r~k~~~~~y~eAec~~iDp~~k~V~~~s~t~~~~--~~e~  155 (491)
T KOG2495|consen   78 LYDVTVVSPRNYFLFTPLLPSTTVGTVELRSIVEPIRAIARKKNGEVKYLEAECTKIDPDNKKVHCRSLTADSS--DKEF  155 (491)
T ss_pred             ccceEEeccccceEEeeccCCccccceeehhhhhhHHHHhhccCCCceEEecccEeecccccEEEEeeeccCCC--ccee
Confidence            99999999999999999999999999999999999999998877688999999999999999999987654321  2357


Q ss_pred             EeecCEEEEccCCCCCCCCCCCccccCcccCCHHHHHHHHHHHHHHHHHcCCCCCCHHHHhccceEEEEcCChhHHHHHH
Q 007975          161 CMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAA  240 (583)
Q Consensus       161 ~i~yD~LViAtG~~~~~~~ipG~~~~~~~~~~~~~a~~l~~~l~~~~~~~~~~~~~~~~~~~~~~vvVVGgG~tgvE~A~  240 (583)
                      .+.|||||+|+|+.+++|+|||+.|++++++..+||+++|+++.+++|+++++.++++++++.+++|||||||||+|+|+
T Consensus       156 ~i~YDyLViA~GA~~~TFgipGV~e~~~FLKEv~dAqeIR~~~~~~le~a~~~~l~~eerkRlLh~VVVGGGPTGVEFAa  235 (491)
T KOG2495|consen  156 VIGYDYLVIAVGAEPNTFGIPGVEENAHFLKEVEDAQEIRRKVIDNLEKAELPGLSDEERKRLLHFVVVGGGPTGVEFAA  235 (491)
T ss_pred             eecccEEEEeccCCCCCCCCCchhhchhhhhhhhHHHHHHHHHHHHHHHhhcCCCChHHhhheEEEEEECCCCcceeehH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhHhHhhhcCCCCCCceEEEEecCCcccCcccHHHHHHHHHHHHhCCCEEEeCCeEEEEeCCeEEEEEcCCCeeE
Q 007975          241 ELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETS  320 (583)
Q Consensus       241 ~l~~~~~~~~~~~~p~~~~~~~Vtlv~~~~~il~~~~~~~~~~~~~~L~~~GV~v~~~~~V~~v~~~~v~~~~~~~G~~~  320 (583)
                      +|++++.+|+.+.||++.+..+|||+++.|.+|++|+..+.+++++.+.+.||++.+++.|+.|++..+..... +|+.+
T Consensus       236 EL~Dfi~~Dl~k~yp~l~~~i~vtLiEA~d~iL~mFdkrl~~yae~~f~~~~I~~~~~t~Vk~V~~~~I~~~~~-~g~~~  314 (491)
T KOG2495|consen  236 ELADFIPEDLRKIYPELKKDIKVTLIEAADHILNMFDKRLVEYAENQFVRDGIDLDTGTMVKKVTEKTIHAKTK-DGEIE  314 (491)
T ss_pred             HHHHHHHHHHHHhhhcchhheEEEeeccchhHHHHHHHHHHHHHHHHhhhccceeecccEEEeecCcEEEEEcC-CCcee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999998874 78888


Q ss_pred             EeecceEEEccCCCCchhHHHHHHHhCcCCCcceEeCCCCccCCCCCEEEcCcccccccchhhhHHHHHhhhcccCCCCC
Q 007975          321 SMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGT  400 (583)
Q Consensus       321 ~i~~D~vI~a~G~~~~p~~~~l~~~~~~~~~g~i~Vd~~l~~~~~~~VyAiGD~a~~~~~~~~~~~~~~~~~a~~~~~g~  400 (583)
                      +||+.++||++|+.+.|.++.|.++++-..|.++.||++||+++.+||||+|||+..                       
T Consensus       315 ~iPYG~lVWatG~~~rp~~k~lm~~i~e~~rr~L~vDE~LrV~G~~nvfAiGDca~~-----------------------  371 (491)
T KOG2495|consen  315 EIPYGLLVWATGNGPRPVIKDLMKQIDEQGRRGLAVDEWLRVKGVKNVFAIGDCADQ-----------------------  371 (491)
T ss_pred             eecceEEEecCCCCCchhhhhHhhcCCccCceeeeeeceeeccCcCceEEecccccc-----------------------
Confidence            899999999999999999999988776644668999999999999999999999943                       


Q ss_pred             chhHHHHHHHHhhhcccchhHHHhhhcccCchhhhhhhhhccccccccccCHHHHHHHhhhccccCCCCCchhhhHHHHH
Q 007975          401 LTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQG  480 (583)
Q Consensus       401 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~taq~A~~qg  480 (583)
                                                                                        ..+++|||+|.|||
T Consensus       372 ------------------------------------------------------------------~~~~~tAQVA~QqG  385 (491)
T KOG2495|consen  372 ------------------------------------------------------------------RGLKPTAQVAEQQG  385 (491)
T ss_pred             ------------------------------------------------------------------ccCccHHHHHHHHH
Confidence                                                                              24688999999999


Q ss_pred             HHHHHHHHhhhhhccCCCCCc-cccCCCCCCCCCCeeecCcceEEccCCCeeeecC-Cc-ccchhHHHHHHHHHHHHHhc
Q 007975          481 KYLAKCFNRMEEAEKNPEGPL-RFRGTGRHRFQPFRYQHLGQFAPLGGEQTAAQLP-WD-WVSIGRSSQWLWYSVYTSKL  557 (583)
Q Consensus       481 ~~~a~~i~~~~~~~~~~~~~~-~~~g~~~~~~~pf~~~~~G~~~~lG~~~av~~~~-~~-~~~~G~~a~~~w~~~~~~~~  557 (583)
                      +|||+||+.+.+.+..++... ++.+......+||+|+|+|+|||||+++|+++++ |. +...|..+|++||++|+.++
T Consensus       386 ~yLAk~fn~m~k~~~~~e~~~~r~~~~~~~~f~PF~Y~H~GalA~lG~ekaiAdl~~g~~~~~~G~~s~~lWrS~Yls~~  465 (491)
T KOG2495|consen  386 AYLAKNFNKMGKGGNLPEGPSARLRGEGRHQFKPFKYKHLGALAYLGREKAIADLPVGKMWVSAGGSSFWLWRSAYLSKL  465 (491)
T ss_pred             HHHHHHHHHHhcccCCCccchhhhhhhhhhccCCcccccccceeeccccchhhcCccCCeeeeccchhhHHHHHHHHHHh
Confidence            999999999988876654443 5555555678999999999999999999999998 66 77889999999999999999


Q ss_pred             cchhhHHHHHHHHHHhhhcccCCCCC
Q 007975          558 VSWRTRALVVSDWTRRFIFGRDSSGI  583 (583)
Q Consensus       558 ~~~~~~~~~~~~w~~~~~~~~~~~~~  583 (583)
                      .|||||++|+.||++.++||||+|++
T Consensus       466 ~S~R~R~lV~~dW~~~~~fGRd~s~i  491 (491)
T KOG2495|consen  466 VSWRNRFLVAIDWEKTFFFGRDSSSI  491 (491)
T ss_pred             hhhhhheeeeeheeeeEEeccccccC
Confidence            99999999999999999999999975

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query583
4g6g_A502 Crystal Structure Of Ndh With Trt Length = 502 1e-64
4g6g_A502 Crystal Structure Of Ndh With Trt Length = 502 8e-11
4g9k_A471 Structure Of The Ndi1 Protein From Saccharomyces Ce 1e-64
4g9k_A471 Structure Of The Ndi1 Protein From Saccharomyces Ce 8e-11
3cgc_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 2e-10
3lb8_A436 Crystal Structure Of The Covalent Putidaredoxin Red 6e-10
1q1r_A431 Crystal Structure Of Putidaredoxin Reductase From P 6e-10
3ntd_A565 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 8e-09
3cgb_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 2e-08
3szw_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 2e-08
3sxi_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 2e-08
3sx6_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 4e-08
3nt6_A574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 4e-08
3kpk_A434 Crystal Structure Of Sulfide:quinone Oxidoreductase 4e-08
3sy4_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 5e-08
3t2z_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 5e-08
3szf_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 5e-08
3t2y_A434 Crystal Structure Of Sulfide:quinone Oxidoreductase 5e-08
3nta_A574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 7e-08
3icr_A588 Crystal Structure Of Oxidized Bacillus Anthracis Co 4e-07
3hyw_A430 3-D X-Ray Structure Of The Sulfide:quinone Oxidored 7e-07
3hyv_A430 3-D X-Ray Structure Of The Sulfide:quinone Oxidored 7e-07
1ebd_A455 Dihydrolipoamide Dehydrogenase Complexed With The B 1e-06
1xhc_A367 Nadh Oxidase /nitrite Reductase From Pyrococcus Fur 3e-06
3lxd_A415 Crystal Structure Of Ferredoxin Reductase Arr From 8e-06
2cdu_A452 The Crystal Structure Of Water-Forming Nad(P)h Oxid 8e-06
3iwa_A472 Crystal Structure Of A Fad-Dependent Pyridine Nucle 2e-05
3kd9_A449 Crystal Structure Of Pyridine Nucleotide Disulfide 5e-05
3h8i_A409 The First X-Ray Structure Of A Sulfide:quinone Oxid 8e-05
3ef6_A410 Crystal Structure Of Toluene 2,3-Dioxygenase Reduct 9e-05
1nhr_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 2e-04
3fg2_P404 Crystal Structure Of Ferredoxin Reductase For The C 3e-04
1nhq_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 5e-04
>pdb|4G6G|A Chain A, Crystal Structure Of Ndh With Trt Length = 502 Back     alignment and structure 
Iteration: 1

 Score =  244 bits (622), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 133/333 (39%), Positives = 206/333 (61%), Gaps = 15/333 (4%)
Query: 58  KKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVR 117
           K  V++LG+GW   SFLK+++   Y+V +ISPR+YF FTPLLPS   GTV+ +SI+EP+ 
Sbjct: 42  KPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIV 101
Query: 118 NIVRKKNVDICFWEAECFKIDAENKKVYCRS----------SQNTNLNGKEEFCMDYDYL 167
           N   KK  ++ ++EAE   I+ +   V  +S            +  L+  E   + YDYL
Sbjct: 102 NFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYL 161
Query: 168 VIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFV 227
           + A+GA  NTF  PGV +  +FLKE+ ++  IRR    + EKA+L    D ER+R+L  V
Sbjct: 162 ISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIV 221
Query: 228 IVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEK 287
           +VGGGPTGVE A EL D+V +DL K  P + + V+I L+EA   +LNMF+K+++++A+  
Sbjct: 222 VVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSH 281
Query: 288 FSRDGIDVKLGSMVVKVTDKEIFTKVR---GNGETSSMPYGMVVWSTGIAPHAIIKDFMK 344
                I V L + V KV +K++  K +   G     ++PYG ++W+TG     +I D  K
Sbjct: 282 LENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFK 341
Query: 345 QVGQTN--RRALATDEWLRVEGSDSIYALGDCA 375
           ++ + N  +R LA +++L+V+GS++I+A+GD A
Sbjct: 342 KIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNA 374
>pdb|4G6G|A Chain A, Crystal Structure Of Ndh With Trt Length = 502 Back     alignment and structure
>pdb|4G9K|A Chain A, Structure Of The Ndi1 Protein From Saccharomyces Cerevisiae Length = 471 Back     alignment and structure
>pdb|4G9K|A Chain A, Structure Of The Ndi1 Protein From Saccharomyces Cerevisiae Length = 471 Back     alignment and structure
>pdb|3CGC|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(p)h Specificity Length = 480 Back     alignment and structure
>pdb|3LB8|A Chain A, Crystal Structure Of The Covalent Putidaredoxin Reductase- Putidaredoxin Complex Length = 436 Back     alignment and structure
>pdb|1Q1R|A Chain A, Crystal Structure Of Putidaredoxin Reductase From Pseudomonas Putida Length = 431 Back     alignment and structure
>pdb|3NTD|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C531s Mutant Length = 565 Back     alignment and structure
>pdb|3CGB|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(P)h Specificity Length = 480 Back     alignment and structure
>pdb|3SZW|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase Cys128ser Variant From Acidithiobacillus Ferrooxidans In Complex With Decylubiquinone Length = 437 Back     alignment and structure
>pdb|3SXI|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase Cys128ala Variant From Acidithiobacillus Ferrooxidans Complexed With Decylubiquinone Length = 437 Back     alignment and structure
>pdb|3SX6|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase Cys356ala Variant From Acidithiobacillus Ferrooxidans Complexed With Decylubiquinone Length = 437 Back     alignment and structure
>pdb|3NT6|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C43sC531S DOUBLE MUTANT Length = 574 Back     alignment and structure
>pdb|3KPK|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase From Acidithiobacillus Ferrooxidans, C160a Mutant Length = 434 Back     alignment and structure
>pdb|3SY4|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase Ser126ala Variant From Acidithiobacillus Ferrooxidans Length = 437 Back     alignment and structure
>pdb|3T2Z|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase From Acidithiobacillus Ferrooxidans Length = 437 Back     alignment and structure
>pdb|3SZF|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase H198a Variant From Acidithiobacillus Ferrooxidans In Complex With Bound Trisulfide And Decylubiquinone Length = 437 Back     alignment and structure
>pdb|3T2Y|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase His132ala Variant From Acidithiobacillus Ferrooxidans With Bound Disulfide Length = 434 Back     alignment and structure
>pdb|3NTA|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase Length = 574 Back     alignment and structure
>pdb|3ICR|A Chain A, Crystal Structure Of Oxidized Bacillus Anthracis Coadr-Rhd Length = 588 Back     alignment and structure
>pdb|3HYW|A Chain A, 3-D X-Ray Structure Of The Sulfide:quinone Oxidoreductase Of The Hyperthermophilic Bacterium Aquifex Aeolicus In Complex With Decylubiquinone Length = 430 Back     alignment and structure
>pdb|3HYV|A Chain A, 3-D X-Ray Structure Of The Sulfide:quinone Oxidoreductase From The Hyperthermophilic Bacterium Aquifex Aeolicus Length = 430 Back     alignment and structure
>pdb|1EBD|A Chain A, Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of The Dihydrolipoamide Acetylase Length = 455 Back     alignment and structure
>pdb|1XHC|A Chain A, Nadh Oxidase /nitrite Reductase From Pyrococcus Furiosus Pfu-1140779- 001 Length = 367 Back     alignment and structure
>pdb|3LXD|A Chain A, Crystal Structure Of Ferredoxin Reductase Arr From Novosphingobium Aromaticivorans Length = 415 Back     alignment and structure
>pdb|2CDU|A Chain A, The Crystal Structure Of Water-Forming Nad(P)h Oxidase From Lactobacillus Sanfranciscensis Length = 452 Back     alignment and structure
>pdb|3IWA|A Chain A, Crystal Structure Of A Fad-Dependent Pyridine Nucleotide-Disulphide Oxidoreductase From Desulfovibrio Vulgaris Length = 472 Back     alignment and structure
>pdb|3KD9|A Chain A, Crystal Structure Of Pyridine Nucleotide Disulfide Oxidoreductase From Pyrococcus Horikoshii Length = 449 Back     alignment and structure
>pdb|3H8I|A Chain A, The First X-Ray Structure Of A Sulfide:quinone Oxidoreductase: Insights Into Sulfide Oxidation Mechanism Length = 409 Back     alignment and structure
>pdb|3EF6|A Chain A, Crystal Structure Of Toluene 2,3-Dioxygenase Reductase Length = 410 Back     alignment and structure
>pdb|1NHR|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|3FG2|P Chain P, Crystal Structure Of Ferredoxin Reductase For The Cyp199a2 System From Rhodopseudomonas Palustris Length = 404 Back     alignment and structure
>pdb|1NHQ|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query583
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 1e-50
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 2e-49
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 2e-48
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 7e-42
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 3e-04
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 1e-39
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 1e-39
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 1e-04
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 5e-39
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 2e-38
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 1e-37
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 1e-37
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 9e-37
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 2e-36
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 1e-35
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 6e-06
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 1e-29
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 2e-27
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 1e-22
1fcd_A401 Flavocytochrome C sulfide dehydrogenase (flavin- b 4e-19
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 6e-18
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 3e-17
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 5e-17
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 6e-17
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 1e-16
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 2e-16
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 4e-16
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 6e-16
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 2e-15
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 3e-15
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 5e-12
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 6e-12
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 6e-12
1fec_A490 Trypanothione reductase; redox-active center, oxid 1e-11
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 1e-11
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 3e-11
4dna_A463 Probable glutathione reductase; structural genomic 7e-11
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 1e-10
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 4e-10
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 5e-10
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 6e-10
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 7e-10
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 1e-09
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 1e-09
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 2e-09
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 2e-09
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 3e-09
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 5e-09
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 7e-09
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 2e-08
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 4e-08
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 6e-08
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1ojt_A482 Surface protein; redox-active center, glycolysis, 5e-07
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 7e-07
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 2e-05
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 3e-05
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 2e-04
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 3e-04
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 4e-04
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 6e-04
3akb_A166 Putative calcium binding protein; EF-hand, metal b 7e-04
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
 Score =  178 bits (454), Expect = 1e-50
 Identities = 62/328 (18%), Positives = 128/328 (39%), Gaps = 27/328 (8%)

Query: 59  KKVVVLGTGWAGTS---FLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEP 115
            KV+VLG  +   +    LK L     DV+VI+   +  F P LP V  G  +   +   
Sbjct: 2   TKVLVLGGRFGALTAAYTLKRLVGSKADVKVINKSRFSYFRPALPHVAIGVRDVDELKVD 61

Query: 116 VRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARA 175
           +   + +K +   F E    KIDA++  VY       + +  E    +YDY+++ +GA  
Sbjct: 62  LSEALPEKGIQ--FQEGTVEKIDAKSSMVYYT---KPDGSMAE---EEYDYVIVGIGAHL 113

Query: 176 NTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEK------ASLPNLSDEERKRILHFVIV 229
            T    G ++    + E E A ++R   +ESF+       +         + ++    + 
Sbjct: 114 ATELVKGWDKYGYSVCEPEFATKLREK-LESFQGGNIAIGSGPFYQGHNPKPKVPENFVP 172

Query: 230 GGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFS 289
                      E+   +     K    + D V +T+    +++ ++            ++
Sbjct: 173 NADSACEGPVFEMSLMLHGYFKKK--GMLDKVHVTVFSPGEYLSDL-SPNSRKAVASIYN 229

Query: 290 RDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQT 349
           + GI +     + ++ + EI  +    G T  +P  + +       +  +K+    +   
Sbjct: 230 QLGIKLVHNFKIKEIREHEIVDE---KGNT--IPADITILLPPYTGNPALKNSTPDLVDD 284

Query: 350 NRRALATDEWLRVEGSDSIYALGDCATV 377
               + TD  +     D++YA+GD  ++
Sbjct: 285 GGF-IPTDLNMVSIKYDNVYAVGDANSM 311
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query583
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 100.0
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 100.0
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 100.0
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 100.0
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 100.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 100.0
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 100.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 100.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 100.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 100.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 100.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 100.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 100.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 100.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 100.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 100.0
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 100.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 100.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 100.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 100.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
4dna_A463 Probable glutathione reductase; structural genomic 100.0
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 100.0
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 100.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 100.0
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 100.0
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.98
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.98
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.98
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.98
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.98
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.97
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.97
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.97
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.97
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.96
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.96
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.96
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.96
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.95
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.95
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.94
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.93
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.93
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.93
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.92
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.85
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.79
2cul_A232 Glucose-inhibited division protein A-related PROT 99.54
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.48
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.37
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.24
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.0
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.0
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.96
2cul_A232 Glucose-inhibited division protein A-related PROT 98.94
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.8
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.75
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.69
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.67
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.66
2bry_A497 NEDD9 interacting protein with calponin homology a 98.65
3dme_A369 Conserved exported protein; structural genomics, P 98.63
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.62
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.61
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.6
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.59
2bry_A497 NEDD9 interacting protein with calponin homology a 98.58
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.55
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.55
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.54
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.48
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.45
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.44
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.44
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.43
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.42
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.42
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.42
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.41
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.39
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.39
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.38
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.38
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.34
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.33
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.33
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.33
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.33
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.32
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.32
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.31
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.29
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.29
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.28
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.28
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.28
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.28
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.27
3atr_A453 Conserved archaeal protein; saturating double bond 98.27
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.26
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.25
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.24
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.23
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.22
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.22
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.21
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.21
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.19
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.19
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.19
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.19
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.19
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.18
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.17
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.16
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.16
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.14
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.14
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.13
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.13
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.12
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.12
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.12
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.11
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.1
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.1
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.1
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.1
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.09
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.09
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.08
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.08
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.08
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.08
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.07
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.07
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.06
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.06
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.06
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.05
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.05
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.05
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 98.05
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.05
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.05
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.05
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.04
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.04
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.03
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.03
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.03
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.03
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.02
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.02
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.02
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.01
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.01
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.01
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.0
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.0
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.99
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.98
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.97
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.97
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.97
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.97
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.96
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.95
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.95
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.94
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.94
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.94
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.93
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.93
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.92
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.92
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.91
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.9
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.89
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.88
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.88
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.87
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.87
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 97.87
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.86
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 97.85
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.84
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.84
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.83
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.82
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.82
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.81
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.81
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.8
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.79
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.79
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.78
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.78
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 97.77
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.73
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.72
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 97.72
4dna_A463 Probable glutathione reductase; structural genomic 97.72
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.72
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 97.69
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.69
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.69
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.68
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.68
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.67
3atr_A453 Conserved archaeal protein; saturating double bond 97.66
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.65
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 97.63
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 97.62
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 97.62
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.61
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.61
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.61
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.61
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 97.61
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.6
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.58
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 97.57
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.57
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.56
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.54
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.54
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.53
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.5
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.5
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.49
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.49
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.48
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.47
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 97.47
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.46
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.45
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.45
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.45
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.45
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.45
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.42
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.4
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.4
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.4
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.35
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.35
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.34
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.34
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.33
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.32
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.32
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.32
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.31
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.3
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.29
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.29
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.28
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 97.28
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.27
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.25
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.24
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.23
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 97.22
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.21
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.2
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.2
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.16
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.14
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.14
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.1
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.06
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.05
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.05
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.04
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 97.04
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.02
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 96.97
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 96.96
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 96.91
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 96.89
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.88
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 96.85
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 96.85
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 96.83
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 96.82
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 96.8
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 96.77
4gut_A776 Lysine-specific histone demethylase 1B; histone de 96.71
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.7
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.65
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 96.63
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 96.63
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 96.63
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 96.59
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 96.45
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 96.41
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.37
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 96.32
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 96.18
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 96.03
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 96.03
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.02
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 95.94
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 95.8
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 95.8
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 95.79
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 95.58
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.55
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 95.5
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 95.37
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.22
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.09
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 95.08
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 95.08
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 95.04
4gut_A776 Lysine-specific histone demethylase 1B; histone de 94.99
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 94.97
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.97
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 94.88
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.85
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 94.79
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.66
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.62
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 94.48
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 94.42
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 94.39
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 93.75
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.51
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 93.09
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 93.02
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 92.88
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 92.84
3c85_A183 Putative glutathione-regulated potassium-efflux S 92.73
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 92.61
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.49
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.48
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 92.23
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 92.23
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 91.82
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 91.65
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 91.49
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 91.45
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 91.24
4g65_A461 TRK system potassium uptake protein TRKA; structur 91.11
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 91.11
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 90.77
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 90.75
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 90.75
3ius_A286 Uncharacterized conserved protein; APC63810, silic 90.74
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 90.74
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 90.7
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 90.66
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 90.57
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 90.53
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 90.38
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 90.25
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 90.21
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 90.14
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 89.92
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 89.69
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 89.55
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 89.49
3dme_A369 Conserved exported protein; structural genomics, P 89.45
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 89.44
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 89.4
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 89.38
3tl2_A315 Malate dehydrogenase; center for structural genomi 89.37
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 89.32
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 89.21
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 89.18
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 89.15
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 89.1
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 89.08
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 89.05
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 89.0
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 88.89
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 88.82
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 88.8
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 88.74
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 88.42
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 88.38
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 88.3
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 88.28
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 88.2
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 88.15
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 88.11
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 88.11
3qha_A296 Putative oxidoreductase; seattle structural genomi 88.1
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 88.03
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 87.95
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 87.93
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 87.91
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 87.84
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 87.77
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 87.73
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 87.73
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 87.7
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 87.69
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 87.58
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 87.51
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 87.43
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 87.41
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 87.36
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 87.28
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 87.28
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 87.25
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 87.22
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 87.13
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 87.1
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 87.09
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 87.09
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 86.99
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 86.99
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 86.99
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 86.96
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 86.9
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 86.86
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.84
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 86.84
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 86.82
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 86.56
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 86.5
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 86.41
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 86.32
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 86.31
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 86.29
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 86.24
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 86.23
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 86.16
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 86.14
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 86.13
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 86.12
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 85.98
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 85.97
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 85.82
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 85.7
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 85.69
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 85.63
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 85.6
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 85.58
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 85.56
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 85.54
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 85.54
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 85.45
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 85.38
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 85.34
3l6d_A306 Putative oxidoreductase; structural genomics, prot 85.33
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 85.25
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 85.22
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 85.19
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 85.13
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-78  Score=661.18  Aligned_cols=435  Identities=40%  Similarity=0.725  Sum_probs=377.3

Q ss_pred             CCCCCeEEEECCcHHHHHHHHhcCCCCCeEEEEcCCCCCCCCCchhhhccccCCCcccchhHHHHHHhCCCcEEEEEeEE
Q 007975           55 GIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAEC  134 (583)
Q Consensus        55 ~~~~~~VVIIGgG~aGl~aA~~L~~~g~~Vtlie~~~~~~~~p~l~~~~~g~~~~~~i~~~~~~~~~~~~i~v~~~~~~v  134 (583)
                      ...++||||||||+||+++|+.|++.+++|||||++++|.|+|++|+++.|.++++++..++++++.....+++|++++|
T Consensus        39 ~~~KprVVIIGgG~AGl~~A~~L~~~~~~VtLId~~~~~~~~PlL~~va~G~l~~~~i~~p~~~~~~~~~~~v~~~~~~v  118 (502)
T 4g6h_A           39 HSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEA  118 (502)
T ss_dssp             SCSSCEEEEECSSHHHHHHHHHSCTTTCEEEEEESSSEEECGGGGGGTTTTSSCGGGGEEEHHHHHTTCSSCEEEEEEEE
T ss_pred             CCCCCCEEEECCcHHHHHHHHHhhhCCCcEEEECCCCCcccccchhHHhhccccHHHhhhhHHHHHHhhcCCeEEEEEEE
Confidence            34578999999999999999999999999999999999999999999999999999999999988765544688999999


Q ss_pred             EEEecCCCEEEEecCCCC----------CCCCCceEEeecCEEEEccCCCCCCCCCCCccccCcccCCHHHHHHHHHHHH
Q 007975          135 FKIDAENKKVYCRSSQNT----------NLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVI  204 (583)
Q Consensus       135 ~~id~~~~~v~~~~~~~~----------~~~~~~~~~i~yD~LViAtG~~~~~~~ipG~~~~~~~~~~~~~a~~l~~~l~  204 (583)
                      +.||+++++|+++.....          .....+..++.||+||||||++|+++++||++++++++++++|+.++++++.
T Consensus       119 ~~ID~~~k~V~l~~~~~~~~~~~~~~~~~~~~~~~~~i~YD~LViAtGs~~~~~~ipG~~e~a~~l~t~~dA~~ir~~l~  198 (502)
T 4g6h_A          119 TSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFA  198 (502)
T ss_dssp             EEEEGGGTEEEEEEEEEEEECSSSCCCCCCCTTCCEEEECSEEEECCCCEECCTTCTTHHHHCEECSSHHHHHHHHHHHH
T ss_pred             EEEEhhhCEEEEeecccceeecccccccccccCCceEEeCCEEEEcCCcccccCCccCcccccCCCCCHHHHHHHHHHHH
Confidence            999999999988652210          0001123589999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCCCCCHHHHhccceEEEEcCChhHHHHHHHHHHhhhHhHhhhcCCCCCCceEEEEecCCcccCcccHHHHHHH
Q 007975          205 ESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFA  284 (583)
Q Consensus       205 ~~~~~~~~~~~~~~~~~~~~~vvVVGgG~tgvE~A~~l~~~~~~~~~~~~p~~~~~~~Vtlv~~~~~il~~~~~~~~~~~  284 (583)
                      ++++.+.+....+++++..++++|||||++|+|+|++++++.++.+.+.||.+..+.+|+|+++.++++|.+++++++++
T Consensus       199 ~~~e~a~~~~~~~~~~~~~~~vvVvGgG~tGvE~A~~l~~~~~~~l~~~~~~~~~~~~V~lve~~~~il~~~~~~~~~~~  278 (502)
T 4g6h_A          199 ANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYA  278 (502)
T ss_dssp             HHHHHHHHSCTTCHHHHHHTEEEEECCSHHHHHHHHHHHHHHHHTHHHHCHHHHHHCEEEEECSSSSSSTTSCHHHHHHH
T ss_pred             HHHHHHhcccccchhhccccceEEECCCcchhhhHHHHHHHHHHHHHhhcccccccceeEEeccccccccCCCHHHHHHH
Confidence            99999887666666777889999999999999999999999988888888877677899999999999999999999999


Q ss_pred             HHHHHhCCCEEEeCCeEEEEeCCeEEEEEc-CCCe--eEEeecceEEEccCCCCchhHHHHHHHhCc--CCCcceEeCCC
Q 007975          285 EEKFSRDGIDVKLGSMVVKVTDKEIFTKVR-GNGE--TSSMPYGMVVWSTGIAPHAIIKDFMKQVGQ--TNRRALATDEW  359 (583)
Q Consensus       285 ~~~L~~~GV~v~~~~~V~~v~~~~v~~~~~-~~G~--~~~i~~D~vI~a~G~~~~p~~~~l~~~~~~--~~~g~i~Vd~~  359 (583)
                      ++.|+++||+|+++++|++|+++++.+... .+|+  ..+|++|+||||+|++++|.+..+...++.  +.+|+|.||++
T Consensus       279 ~~~L~~~GV~v~~~~~v~~v~~~~~~~~~~~~dg~~~~~~i~ad~viwa~Gv~~~~~~~~l~~~~~~~~~~~g~I~Vd~~  358 (502)
T 4g6h_A          279 QSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDF  358 (502)
T ss_dssp             HHHHHHTTCEEETTEEEEEECSSEEEEEEECTTSCEEEEEEECSEEEECCCEECCHHHHHHHHHSGGGTTCCSSEEBCTT
T ss_pred             HHHHHhcceeeecCceEEEEeCCceEEEEEecCcccceeeeccCEEEEccCCcCCHHHHhHHHhccccccCCCceeECCc
Confidence            999999999999999999999998876542 3453  235999999999999999888788777765  66789999999


Q ss_pred             CccCCCCCEEEcCcccccccchhhhHHHHHhhhcccCCCCCchhHHHHHHHHhhhcccchhHHHhhhcccCchhhhhhhh
Q 007975          360 LRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEA  439 (583)
Q Consensus       360 l~~~~~~~VyAiGD~a~~~~~~~~~~~~~~~~~a~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  439 (583)
                      ||++++|||||+||||..                                                              
T Consensus       359 lq~~~~~~IfAiGD~a~~--------------------------------------------------------------  376 (502)
T 4g6h_A          359 LQVKGSNNIFAIGDNAFA--------------------------------------------------------------  376 (502)
T ss_dssp             SBBTTCSSEEECGGGEES--------------------------------------------------------------
T ss_pred             cccCCCCCEEEEEcccCC--------------------------------------------------------------
Confidence            999999999999999863                                                              


Q ss_pred             hccccccccccCHHHHHHHhhhccccCCCCCchhhhHHHHHHHHHHHHHhhhhhccC----CCC----CccccCCCCCCC
Q 007975          440 KGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVAAQQGKYLAKCFNRMEEAEKN----PEG----PLRFRGTGRHRF  511 (583)
Q Consensus       440 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~taq~A~~qg~~~a~~i~~~~~~~~~----~~~----~~~~~g~~~~~~  511 (583)
                                                  ++|++||+|.|||+++|+||.+...++..    ...    ...+.+   +++
T Consensus       377 ----------------------------~~p~~a~~A~qqg~~~A~ni~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~  425 (502)
T 4g6h_A          377 ----------------------------GLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKNLSSRKDKIDLLFEE---NNF  425 (502)
T ss_dssp             ----------------------------SSCCCHHHHHHHHHHHHHHHHHHTTCHHHHHHTTSSSCCHHHHHHH---TTC
T ss_pred             ----------------------------CCCCchHHHHHHHHHHHHHHHHHhccchhhhhhhhccchhhhhhcC---CCC
Confidence                                        56999999999999999999876433110    000    001223   478


Q ss_pred             CCCeeecCcceEEccCCCeeeecCCc----ccchhHHHHHHHHHHHHHhccchhhHHHHHHHHHHhhhcccCCCC
Q 007975          512 QPFRYQHLGQFAPLGGEQTAAQLPWD----WVSIGRSSQWLWYSVYTSKLVSWRTRALVVSDWTRRFIFGRDSSG  582 (583)
Q Consensus       512 ~pf~~~~~G~~~~lG~~~av~~~~~~----~~~~G~~a~~~w~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~  582 (583)
                      +||+|+++|+|+|||+++||+++++.    +.++|++||++||++|++++++||||++|++||++++|||||+||
T Consensus       426 ~pF~y~~~G~~a~lG~~~av~~~~~~~~~~~~~~G~~a~~~w~~~yl~~l~~~r~r~~v~~~W~~~~~fgRdisr  500 (502)
T 4g6h_A          426 KPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFK  500 (502)
T ss_dssp             CCCCCCCCEEEEECSTTCEEEEEEETTEEEEEEEEHHHHHHHHHHHHHHCSCHHHHHHHHHHHHHHHHSCCCCCT
T ss_pred             CCCEecCcceEEEEeCCceEEEccCCCccceecccHHHHHHHHHHHHHHccchhhhHHHHHHHHHHHhCCCCCcC
Confidence            99999999999999999999998642    334799999999999999999999999999999999999999998
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 583
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 1e-11
d1d7ya2121 c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu 8e-11
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 1e-09
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 9e-09
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 6e-08
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 6e-06
d1h6va2122 c.3.1.5 (A:171-292) Mammalian thioredoxin reductas 1e-07
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 2e-07
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 3e-07
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 3e-05
d1nhpa2123 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus 4e-07
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 9e-07
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 1e-06
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 4e-06
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 5e-06
d1lvla2115 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase 5e-06
d1q1ra2133 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseud 3e-05
d1onfa2117 c.3.1.5 (A:154-270) Glutathione reductase {Plasmod 8e-05
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 1e-04
d1mo9a2121 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl co 3e-04
d3lada2119 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase 5e-04
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 6e-04
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 0.001
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 0.001
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 0.002
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 0.003
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 0.003
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 0.004
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 0.004
d1aoga2117 c.3.1.5 (A:170-286) Trypanothione reductase {Trypa 0.004
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 0.004
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Apoptosis-inducing factor (AIF)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.2 bits (145), Expect = 1e-11
 Identities = 24/155 (15%), Positives = 51/155 (32%), Gaps = 31/155 (20%)

Query: 181 PGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAA 240
             V+      +++ D + + +                 E K I    I+GGG  G E A 
Sbjct: 12  AEVKSRTTLFRKIGDFRSLEKIS--------------REVKSI---TIIGGGFLGSELAC 54

Query: 241 ELHDFVDEDLFKLYPKVKDSVKITLLEAADHIL-NMFDKRITAFAEEKFSRDGIDVKLGS 299
            L                   ++  L      +  +  + ++ +  EK  R+G+ V   +
Sbjct: 55  ALGRKARA----------LGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNA 104

Query: 300 MVVKVTDKEIFTKVR-GNGETSSMPYGMVVWSTGI 333
           +V  V        ++  +G    +    +V + G+
Sbjct: 105 IVQSVGVSSGKLLIKLKDGRK--VETDHIVAAVGL 137
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 123 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 115 Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 133 Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 117 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 121 Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 119 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query583
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.86
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.82
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.81
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.81
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.78
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.76
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.76
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.74
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.72
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.71
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.67
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.67
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.67
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.66
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.65
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.65
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.63
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.61
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.6
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.59
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.59
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.59
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.58
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.58
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.58
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.58
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.56
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.56
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.54
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.53
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.51
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.46
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.46
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.46
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.44
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.4
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.38
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.37
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.35
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.26
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.21
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.21
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.2
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.19
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.18
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.18
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.14
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.11
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.1
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.08
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.07
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.07
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.06
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.06
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.05
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.04
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.03
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.01
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.01
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.99
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.96
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.96
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.94
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.91
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.91
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.9
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.88
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.86
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.86
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.86
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.86
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.84
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.83
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.83
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.81
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.8
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.8
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.8
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.79
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.79
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.79
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.78
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.77
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.76
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.75
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.75
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.74
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.74
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.72
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.69
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.69
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.64
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.64
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.63
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.61
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.58
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.58
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.57
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.54
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.53
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.52
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.5
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.49
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.48
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.47
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.45
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.44
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.37
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.32
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.32
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.29
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.29
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.29
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.27
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.26
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.23
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.18
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.14
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.12
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.12
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.09
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.09
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.08
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.03
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.98
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 97.87
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.87
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 97.84
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.81
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.79
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.74
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.73
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.7
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.69
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.66
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 97.63
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.62
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.57
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.56
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 97.55
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.55
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.5
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.4
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.37
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.33
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.32
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.29
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.28
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.25
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.2
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.14
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 97.13
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.08
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.01
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 96.98
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 96.95
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.89
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 96.77
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.72
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.68
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.67
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 96.64
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.47
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 96.37
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 96.33
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.15
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 96.15
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.06
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.02
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.86
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 95.82
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.63
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.46
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.37
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.22
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.16
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.15
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 95.06
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.04
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 95.02
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.95
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.89
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.88
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.72
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.66
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.64
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.61
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 94.37
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 94.2
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.19
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.17
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.16
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.02
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.99
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 93.95
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 93.92
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.87
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.83
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 93.47
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 93.27
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 93.23
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 92.87
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 92.79
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 92.78
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 92.77
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.01
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 91.78
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 91.53
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 91.3
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 91.25
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 91.23
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 91.18
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 91.18
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 90.99
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 90.69
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.67
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 90.46
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 90.43
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 90.26
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.22
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 90.09
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 90.04
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 89.93
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 89.7
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 89.52
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 89.49
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 89.44
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.4
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 89.29
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 89.1
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 88.85
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 88.5
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 88.22
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 88.12
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 88.09
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 88.0
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 87.89
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.58
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 87.34
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 86.84
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 86.75
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 86.7
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 86.67
d1id1a_153 Rck domain from putative potassium channel Kch {Es 86.27
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 85.94
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 85.5
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 85.5
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 85.2
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 85.19
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 85.1
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 84.83
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 84.77
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 84.38
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 84.35
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 84.07
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 84.01
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 83.63
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 83.52
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 83.3
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 83.21
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 83.09
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 82.91
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 82.67
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 82.64
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 82.43
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 82.43
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 82.08
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 81.67
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 81.59
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 81.57
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 81.43
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 81.38
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 80.92
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 80.81
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 80.8
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 80.53
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 80.35
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 80.07
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: NADH peroxidase
species: Enterococcus faecalis [TaxId: 1351]

Probab=99.86  E-value=2.4e-22  Score=188.99  Aligned_cols=141  Identities=19%  Similarity=0.336  Sum_probs=107.6

Q ss_pred             eEEEEcCChhHHHHHHHHHHhhhHhHhhhcCCCCCCceEEEEecCCccc--Cc-cc----------HHHHHHHHHHHHhC
Q 007975          225 HFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHIL--NM-FD----------KRITAFAEEKFSRD  291 (583)
Q Consensus       225 ~vvVVGgG~tgvE~A~~l~~~~~~~~~~~~p~~~~~~~Vtlv~~~~~il--~~-~~----------~~~~~~~~~~L~~~  291 (583)
                      +|+|||||++|+|+|..|.++.            ++.+|+++++.+.+.  +. ++          +.+.....+.|+++
T Consensus         2 KVvIIGgG~~G~e~A~~l~~~~------------~~~~V~v~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~   69 (198)
T d1nhpa1           2 KVIVLGSSHGGYEAVEELLNLH------------PDAEIQWYEKGDFISFLSAGMQLYLEGKVKDVNSVRYMTGEKMESR   69 (198)
T ss_dssp             EEEEECSSHHHHHHHHHHHHHC------------TTSEEEEEESSSSSSBCGGGHHHHHTTSSCCGGGSBSCCHHHHHHT
T ss_pred             EEEEECCcHHHHHHHHHHHhcC------------CCCeEEEEeCCCcccccccCcchhhcccccchHHHHHhhHHHHHHC
Confidence            7999999999999999998874            357999999887651  11 11          12222345678999


Q ss_pred             CCEEEeCCeEEEEeC--CeEEEEEcCCCeeEEeecceEEEccCCCCc------hhHHHHHHHhCcCCCcceEeCCCCccC
Q 007975          292 GIDVKLGSMVVKVTD--KEIFTKVRGNGETSSMPYGMVVWSTGIAPH------AIIKDFMKQVGQTNRRALATDEWLRVE  363 (583)
Q Consensus       292 GV~v~~~~~V~~v~~--~~v~~~~~~~G~~~~i~~D~vI~a~G~~~~------p~~~~l~~~~~~~~~g~i~Vd~~l~~~  363 (583)
                      ||+++++++|++++.  +.+++.+..+|++.++++|.+|||+|..+.      |++..+...+.++.+|+|.||+++|| 
T Consensus        70 gi~v~~~~~V~~i~~~~~~v~~~~~~~g~~~~~~~D~li~a~G~~~~~~~g~~~~~~~~~~~~~~~~~G~i~vd~~~~T-  148 (198)
T d1nhpa1          70 GVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDGVRPNTAWLKGTLELHPNGLIKTDEYMRT-  148 (198)
T ss_dssp             TCEEEETEEEEEEETTTTEEEEEETTTCCEEEEECSEEEECCCEEECCCCCEEESCGGGTTTSCBCTTSCBCCCTTCBC-
T ss_pred             CcEEEEeeceeeEeeccccceeeecccccccccccceeeEeecceeecccccccccccccccceeccCCceecCCcccc-
Confidence            999999999999985  568887777788778999999999995443      22321211223478899999999999 


Q ss_pred             CCCCEEEcCcccccc
Q 007975          364 GSDSIYALGDCATVN  378 (583)
Q Consensus       364 ~~~~VyAiGD~a~~~  378 (583)
                      +.|+|||+|||+..+
T Consensus       149 ~~~~IyA~GD~a~~~  163 (198)
T d1nhpa1         149 SEPDVFAVGDATLIK  163 (198)
T ss_dssp             SSTTEEECGGGSCEE
T ss_pred             cccceEEecceeecc
Confidence            899999999999864
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure