Citrus Sinensis ID: 007984


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580--
MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
cHHHHHHcccccEEEccccccccccHHHHHccccccccccccccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHcccccccccccccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHcccccEEEccccccccccHHHcccccccEEEcccccccccccccccccccHHHHHcccccccccccccccccHHHHHHHcccccccccEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccHHHHHcccHHHHHHHHccccccc
ccHHHHccccccEEEccccccccccHHHHcccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEEcccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEccccccccccHHHccccccEEEEccccccccccHHHcccccccEEEccccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHccccccccEEEcccccccccccHHcccccHHHHHHccccccccccccccccccccccHHHccccccEEEEccccccccccHHHcccccccEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccHHcccccccccEEEcccccccccccHHccccccEEEEccccccccc
MDRILKAARtsgslnlsnrslrdvpnevyknfdeagegdkwwEAVDLQKLILAHNNIEKLKEDlrnlplltVLNVSHNKLSELPAAIGELHMlksldvsfnsimkipdeigSATALVkfdcssnqlkelpsslgrclnlsdfkasnncitslpedladcskmskldvegnkltVLSNNLIASWTMLTELIASKnllngmpetIGSLSRLIRLDLhqnrilsipssisgcCSLAefymgnnalsALPAElgklsklgtldlhSNQLKEYCVEACQLRLSVLDlsnnslsglppeigkMTTLRKLLLtgnplrtlrsslvngptpALLKYLRSrlpenedseasttkEDLITMATRLSVTSKELslegmnlsaipseiweageitkldlsrnsiqelppelsscASLQTLILSRnkikdwpdAILTSLsslsclkldnnplrqvpsdgfkdipmlqiLDLSyniaslpenppfsslphLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKnltslteldlsdnnisalppelgllepslqalrldgnplrsIRRTILDRGTKAVLKYLKDKIPEN
mdrilkaartsgslnlsnrslrdvpnEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRtlrsslvngptPALLKYLRsrlpenedseasttkedlitMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQAlrldgnplrsirrtildrgtkavlkylkdkipen
MDRILKAARTSGslnlsnrslrDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQlrlsvldlsnnslsglPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAIltslsslsclklDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRMQLREAPTdilrlqqlrildlSQNSLQSIPEGFKNLTSLTELDLSDNNISAlppelgllepslQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
***************************VYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYL*************************************MNLSAIPSEIWEAGEITKLDL***********LSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELD************LGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYL*******
MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENED**********ITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKY*KDKI***
MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRL**********TKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDxxxxxxxxxxxxxxxxxxxxxPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query582 2.2.26 [Sep-21-2011]
Q5ZLN0603 Leucine-rich repeat-conta yes no 0.938 0.905 0.348 8e-75
Q6GPJ5605 Leucine-rich repeat-conta N/A no 0.939 0.904 0.349 2e-73
Q5M8G4605 Leucine-rich repeat-conta yes no 0.943 0.907 0.350 2e-71
Q5RFE9602 Leucine-rich repeat-conta yes no 0.941 0.910 0.346 7e-70
Q9H9A6602 Leucine-rich repeat-conta yes no 0.941 0.910 0.346 2e-69
Q4R3P6602 Leucine-rich repeat-conta N/A no 0.941 0.910 0.346 3e-69
Q7SXW3601 Leucine-rich repeat-conta yes no 0.941 0.911 0.339 2e-68
Q9CRC8602 Leucine-rich repeat-conta yes no 0.941 0.910 0.335 4e-64
Q8AVI4577 Leucine-rich repeat prote N/A no 0.649 0.655 0.300 6e-36
Q1L8Y7561 Leucine-rich repeat prote no no 0.649 0.673 0.305 4e-35
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function desciption
 Score =  281 bits (720), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 210/603 (34%), Positives = 327/603 (54%), Gaps = 57/603 (9%)

Query: 4   ILKAARTSGSLNLSNRSLRDVPNEVYK-NFD---EA------GEGDKWWEAVDLQKLILA 53
           +++AAR SG LNL+ R L +VP  V++ N D   EA      G  D+WWE  DL KLILA
Sbjct: 31  LIRAARKSGQLNLAGRGLGEVPQHVWRINLDTPEEAHQNLSFGAADRWWEQTDLTKLILA 90

Query: 54  HNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSA 113
            N +  L ED+R LP LTVL+V  N+L+ LP+A+G+L  L+ LDVS N +  IP+E+   
Sbjct: 91  SNQLRCLSEDVRLLPALTVLDVHDNQLTSLPSALGQLENLQKLDVSHNKLKSIPEELLQL 150

Query: 114 TALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLT 173
           + L       N+L  LP   G+ ++L +   SNN +T +P+  A    + +L++  N+L 
Sbjct: 151 SHLKGLLLQHNELSHLPDGFGQLVSLEELDLSNNHLTDIPKSFALLINLVRLNLACNQLK 210

Query: 174 VLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLA 233
            L  + I++   L +L  +KN L  +P  + S++ L +L L +N++ S+P  +  C  L 
Sbjct: 211 DLPAD-ISAMKSLRQLDCTKNYLESVPSELASMASLEQLYLRKNKLRSLP-ELPSCKLLK 268

Query: 234 EFYMGNNALSALPAE-LGKLSKLGTLDLHSNQLKEYCVEACQL-RLSVLDLSNNSLSGLP 291
           E + G N +  L AE L  L+ L  L+L  N++K    E   L +L  LDL+NN +S LP
Sbjct: 269 ELHAGENQIEILNAENLKHLNSLSVLELRDNKIKSVPDEITLLQKLERLDLANNDISRLP 328

Query: 292 PEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITM 351
             +G ++ L+ L L GNPLRT+R  L+   T  LLKYLRSR+   +D +AS  +E  +T 
Sbjct: 329 YTLGNLSQLKFLALEGNPLRTIRRDLLQKGTQELLKYLRSRI---QDDKASPNEEPPVTA 385

Query: 352 AT-----RLSV----TSKELSLEGMNLSAIPSEIWEA---GEITKLDLSRNSIQELPPEL 399
            T     R+++    T K L      ++ IP +++ A     +T ++ S+N +  +PP +
Sbjct: 386 MTLPSESRINMHAITTLKLLDYSEKQVAVIPDDVFSAVRSNPVTSVNFSKNQLTAIPPRI 445

Query: 400 SSCA-SLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDL 458
                S+  +    NKI       L +L  L+ L + NN L  +P +  + +  LQ+++L
Sbjct: 446 VELKDSVCDVNFGFNKISSV-SLELCTLHKLTHLDIRNNVLTSLPEE-MEALTRLQVINL 503

Query: 459 SYNIASLPENPPFSSLPHLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQSI-PEGFK 517
           S+N                       + +  P+ + R+  L  + LS N + SI P   K
Sbjct: 504 SFN-----------------------RFKVFPSVLYRMLALETILLSNNQVGSIDPLQLK 540

Query: 518 NLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKD 577
            +  L  LDL +N++  +PPELG  E +L+ L L+GNP R+ R  IL +GT AVL+YL+ 
Sbjct: 541 KMEQLGTLDLQNNDLLQVPPELGNCE-TLRTLLLEGNPFRTPRAAILAKGTAAVLEYLRS 599

Query: 578 KIP 580
           +IP
Sbjct: 600 RIP 602





Gallus gallus (taxid: 9031)
>sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 Back     alignment and function description
>sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=2 SV=2 Back     alignment and function description
>sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 Back     alignment and function description
>sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query582
224114980580 predicted protein [Populus trichocarpa] 0.993 0.996 0.791 0.0
359493861584 PREDICTED: leucine-rich repeat-containin 1.0 0.996 0.784 0.0
225461397588 PREDICTED: leucine-rich repeat-containin 1.0 0.989 0.772 0.0
356549743583 PREDICTED: leucine-rich repeat-containin 0.998 0.996 0.771 0.0
449431828583 PREDICTED: leucine-rich repeat-containin 0.998 0.996 0.753 0.0
255575336571 leucine-rich repeat-containing protein, 0.955 0.973 0.767 0.0
356544024586 PREDICTED: leucine-rich repeat-containin 0.998 0.991 0.771 0.0
1946300581 hypothetical protein [Silene latifolia] 0.994 0.996 0.731 0.0
30683597584 leucine-rich repeat-containing protein [ 0.998 0.994 0.725 0.0
297830120584 leucine-rich repeat family protein [Arab 0.998 0.994 0.725 0.0
>gi|224114980|ref|XP_002316909.1| predicted protein [Populus trichocarpa] gi|222859974|gb|EEE97521.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/584 (79%), Positives = 511/584 (87%), Gaps = 6/584 (1%)

Query: 1   MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKL 60
           MDR+LKAAR+SGSLNLSNRSL +VP+EVYK  D  GEG+KWWE V+LQKLILAHNNIE +
Sbjct: 1   MDRVLKAARSSGSLNLSNRSLSEVPDEVYKILDAVGEGEKWWENVELQKLILAHNNIEAI 60

Query: 61  KEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFD 120
           KEDL+NL  LTVLNVSHNKLS LPAAIGEL MLK LDVSFN I K+PDEIGSAT+LVKFD
Sbjct: 61  KEDLKNLSQLTVLNVSHNKLSALPAAIGELPMLKLLDVSFNLIQKVPDEIGSATSLVKFD 120

Query: 121 CSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLI 180
           CSSNQL+ELPSSLG CL LSD KASNN ITSLPEDLA CSK++K+DVEGNKL VLS NL+
Sbjct: 121 CSSNQLRELPSSLGGCLALSDLKASNNSITSLPEDLARCSKLTKVDVEGNKLKVLSGNLM 180

Query: 181 ASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNN 240
           ASWTMLTE  ASKNLL+ +P+  GSLSRLIRLDLHQNRI +IP SI GCCSLAEFYMGNN
Sbjct: 181 ASWTMLTEFNASKNLLSDIPDNFGSLSRLIRLDLHQNRISTIPPSIMGCCSLAEFYMGNN 240

Query: 241 ALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTL 300
           ALS LPAE+G LS+LGTLDLHSNQLKE   EAC+L+LS+LDLSNNSL+GLPPE+GKMTTL
Sbjct: 241 ALSTLPAEIGALSRLGTLDLHSNQLKEIPAEACKLQLSMLDLSNNSLTGLPPELGKMTTL 300

Query: 301 RKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEAST-TKEDLITMATRLSVTS 359
           RKLLL GNPLRTLRSSLV+GPT  LL YLRSRL E EDS+A+T  K+DLI+M  RLSV+S
Sbjct: 301 RKLLLNGNPLRTLRSSLVSGPTATLLNYLRSRLSEGEDSKATTPAKKDLISMTARLSVSS 360

Query: 360 KELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWP 419
           KELSL+G+ LSA+PSE+WE+ EI K+DLSRNSIQELP ELS C     LILSRNKI DWP
Sbjct: 361 KELSLQGLGLSAVPSEVWESNEIVKVDLSRNSIQELPLELSLCC----LILSRNKISDWP 416

Query: 420 DAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQE 479
            AIL SL +L CLKLDNN L Q+PSDGF+ +PMLQILDLS N ASL  +P FSSLPHL+E
Sbjct: 417 CAILKSLPNLICLKLDNNALTQIPSDGFQAVPMLQILDLSGNPASLLGHPAFSSLPHLKE 476

Query: 480 LYLR-MQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPE 538
           LYLR +QLRE P+DIL LQQL+IL+LSQNSL SIPEG KNLTSLTELDLSDNNISALPPE
Sbjct: 477 LYLRQVQLREIPSDILSLQQLQILNLSQNSLHSIPEGLKNLTSLTELDLSDNNISALPPE 536

Query: 539 LGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN 582
           LGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYL DKIPE+
Sbjct: 537 LGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLMDKIPEH 580




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359493861|ref|XP_003634682.1| PREDICTED: leucine-rich repeat-containing protein 40-like isoform 2 [Vitis vinifera] gi|302143032|emb|CBI20327.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225461397|ref|XP_002284846.1| PREDICTED: leucine-rich repeat-containing protein 40-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356549743|ref|XP_003543250.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Glycine max] Back     alignment and taxonomy information
>gi|449431828|ref|XP_004133702.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] gi|449478165|ref|XP_004155239.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255575336|ref|XP_002528571.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223532015|gb|EEF33826.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356544024|ref|XP_003540456.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Glycine max] Back     alignment and taxonomy information
>gi|1946300|emb|CAA73132.1| hypothetical protein [Silene latifolia] Back     alignment and taxonomy information
>gi|30683597|ref|NP_188160.2| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|21703129|gb|AAM74505.1| AT3g15410/MJK13_7 [Arabidopsis thaliana] gi|24111377|gb|AAN46812.1| At3g15410/MJK13_7 [Arabidopsis thaliana] gi|332642149|gb|AEE75670.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297830120|ref|XP_002882942.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297328782|gb|EFH59201.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query582
ZFIN|ZDB-GENE-030131-6062601 lrrc40 "leucine rich repeat co 0.941 0.911 0.294 1.4e-55
MGI|MGI:1914394602 Lrrc40 "leucine rich repeat co 0.941 0.910 0.301 4.3e-54
FB|FBgn0028487693 f-cup "flyers-cup" [Drosophila 0.917 0.770 0.268 1.8e-38
UNIPROTKB|E1BU15582 SHOC2 "Leucine-rich repeat pro 0.630 0.630 0.303 7.2e-36
WB|WBGene00004929559 soc-2 [Caenorhabditis elegans 0.713 0.742 0.284 7.4e-36
UNIPROTKB|Q22875559 soc-2 "Leucine-rich repeat pro 0.713 0.742 0.284 7.4e-36
DICTYBASE|DDB_G0294094510 lrrA "leucine-rich repeat-cont 0.690 0.788 0.303 5.1e-35
ZFIN|ZDB-GENE-050208-523561 shoc2 "soc-2 suppressor of cle 0.621 0.645 0.301 8.5e-34
WB|WBGene00002632 699 let-413 [Caenorhabditis elegan 0.606 0.505 0.296 3.3e-33
UNIPROTKB|O61967 699 let-413 "Protein lap1" [Caenor 0.606 0.505 0.296 3.3e-33
ZFIN|ZDB-GENE-030131-6062 lrrc40 "leucine rich repeat containing 40" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 573 (206.8 bits), Expect = 1.4e-55, P = 1.4e-55
 Identities = 177/601 (29%), Positives = 279/601 (46%)

Query:     4 ILKAARTSGXXXXXXXXXXDVPNEVYK-NFD---EA------GEGDKWWEAVDLQKLILA 53
             +LKAAR SG          +VP  V++ N D   EA      G  D+WWE  DL KL+L+
Sbjct:    29 LLKAARKSGQLNLSGRGLTEVPASVWRLNLDTPQEAKQNVSFGAEDRWWEQTDLTKLLLS 88

Query:    54 HNNIEKLKEDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMKIPDEIGSA 113
              N ++ + +D++ LP L VL++  N+LS LP +IG+L  L+ L +S N + ++P  +   
Sbjct:    89 SNKLQSIPDDVKLLPALVVLDIHDNQLSSLPDSIGDLEQLQKLILSHNKLTELPSGVWRL 148

Query:   114 TALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLT 173
             T L       N ++++P  LG+ +NL +   SNN +  +PE LA+   + KLD+  NKL 
Sbjct:   149 TNLRCLHLQQNLIEQIPRDLGQLVNLDELDLSNNHLIDIPESLANLQNLVKLDLSCNKLK 208

Query:   174 VLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLA 233
              L    I+    L  L  S+N +  +P  +  +  L +L L  N++  +P  +  C +L 
Sbjct:   209 SLPP-AISQMKNLRMLDCSRNQMESIPPVLAQMESLEQLYLRHNKLRYLPE-LPCCKTLK 266

Query:   234 EFYMGNNALSALPAE-LGKLSKLGTLDLHSNQLKEYCVE-ACQXXXXXXXXXXXXXXXXP 291
             E + GNN +  L AE L  L+ L  L+L  N++K    E                    P
Sbjct:   267 ELHCGNNQIEVLEAEHLKHLNALSLLELRDNKVKSLPEEITLLQGLERLDLTNNDISSLP 326

Query:   292 PEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITM 351
               +G +  L+ L L GNPLR +R  L+   T  LLKYLRSR+ E  +       +  +T 
Sbjct:   327 CGLGTLPKLKSLSLEGNPLRAIRRDLLTKGTGELLKYLRSRVQEPPNGGLKEEPKTAMTF 386

Query:   352 ATRLSV------TSKELSLEGMNLSAIPSEIWEAGE---ITKLDLSRNSIQELPPELSSC 402
              ++  +      T K L       + IP ++++A +   +  ++ S+N +  +P      
Sbjct:   387 PSQAKINVHAIKTLKTLDYSEKQDATIPDDVFDAVDGNPVANVNFSKNQLTAVP------ 440

Query:   403 ASLQTLILSRNKIKDWPDAIXXXXXXXXXXXXDNNPLRQVPSDGFKDIPMLQILDLSYNI 462
                       ++I D  D++              N L  +P+D F  +  L  +DL  N+
Sbjct:   441 ----------HRIVDLKDSLADINLGF-------NKLTTIPAD-FCHLKQLMHIDLRNNL 482

Query:   463 A-SLPENPPFSSLPHLQELYLRM-QLREAPTXXXXXXXXXXXXXSQNSLQSIPE-GFKNL 519
               SLP       L  L+ + L   + +  P              S N +  I     K L
Sbjct:   483 LISLPME--LEGLIKLRSVILSFNRFKSFPEVLYRIPSLETILISSNQVGGIDAVQMKTL 540

Query:   520 TSLTELDLSDNNISAXXXXXXXXXXXXQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKI 579
             + L+ LDLS+N+I              +AL LDGNP R+ R  IL +GT AVL+YL+ +I
Sbjct:   541 SRLSTLDLSNNDIMQVPPELGNCTSL-RALMLDGNPFRNPRAAILIKGTDAVLEYLRSRI 599

Query:   580 P 580
             P
Sbjct:   600 P 600


GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
MGI|MGI:1914394 Lrrc40 "leucine rich repeat containing 40" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0028487 f-cup "flyers-cup" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BU15 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00004929 soc-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q22875 soc-2 "Leucine-rich repeat protein soc-2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0294094 lrrA "leucine-rich repeat-containing protein (LRR)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-523 shoc2 "soc-2 suppressor of clear homolog (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00002632 let-413 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O61967 let-413 "Protein lap1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9CRC8LRC40_MOUSENo assigned EC number0.3350.94150.9102yesno
Q9H9A6LRC40_HUMANNo assigned EC number0.34660.94150.9102yesno
Q5M8G4LRC40_XENTRNo assigned EC number0.35040.94320.9074yesno
Q5ZLN0LRC40_CHICKNo assigned EC number0.34820.93810.9054yesno
Q5RFE9LRC40_PONABNo assigned EC number0.34660.94150.9102yesno
Q7SXW3LRC40_DANRENo assigned EC number0.33940.94150.9118yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00110941
hypothetical protein (581 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.8595.1.1
hypothetical protein (375 aa)
       0.490
eugene3.00410223
hypothetical protein (478 aa)
       0.488
eugene3.00131095
annotation not avaliable (394 aa)
       0.484
eugene3.00190610
annotation not avaliable (370 aa)
       0.483
fgenesh4_pg.C_LG_XVIII001032
hypothetical protein (534 aa)
       0.478
eugene3.100750001
hypothetical protein (275 aa)
       0.478
fgenesh4_pg.C_scaffold_11988000001
hypothetical protein (315 aa)
       0.455
fgenesh4_pg.C_scaffold_13412000001
hypothetical protein (444 aa)
       0.453
eugene3.06320001
hypothetical protein (344 aa)
       0.450
gw1.XI.3221.1
hypothetical protein (380 aa)
       0.445

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-27
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-26
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-19
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-15
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-15
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 5e-13
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-11
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 3e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-10
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-10
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-08
PRK15387788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 2e-07
PRK15387788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 6e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 7e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  117 bits (295), Expect = 2e-27
 Identities = 148/488 (30%), Positives = 220/488 (45%), Gaps = 54/488 (11%)

Query: 67  LPLLTVLNVSHNKLS-ELPAAIGELHMLKSLDVSFNSIM-KIPDEIGSATALVKFDCSSN 124
           +P L  L++S+N LS E+P  IG    LK LD+  N ++ KIP+ + + T+L     +SN
Sbjct: 139 IPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASN 198

Query: 125 QL-KELPSSLGRCLNLS-DFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIAS 182
           QL  ++P  LG+  +L   +   NN    +P ++   + ++ LD+  N LT    + + +
Sbjct: 199 QLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGN 258

Query: 183 WTMLTELIASKNLLNG-MPETIGSLSRLIRLDLHQNRIL-SIPSSISGCCSLAEFYM-GN 239
              L  L   +N L+G +P +I SL +LI LDL  N +   IP  +    +L   ++  N
Sbjct: 259 LKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSN 318

Query: 240 NALSALPAELGKLSKLGTLDLHSNQLKEYCVE--ACQLRLSVLDLSNNSLSG-LPPEIGK 296
           N    +P  L  L +L  L L SN+      +       L+VLDLS N+L+G +P  +  
Sbjct: 319 NFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCS 378

Query: 297 MTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRS----RLPENEDSEASTTKEDLITMA 352
              L KL+L  N L         G  P  L   RS    RL +N  S       +L +  
Sbjct: 379 SGNLFKLILFSNSL--------EGEIPKSLGACRSLRRVRLQDNSFSG------ELPSEF 424

Query: 353 TRLSVTSKELSLEGMNLSA-IPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILS 411
           T+L +    L +   NL   I S  W+   +  L L+RN      P+      L+ L LS
Sbjct: 425 TKLPLVYF-LDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLS 483

Query: 412 RNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPF 471
           RN+        L SLS L  LKL  N L     D       L  LDLS+N  S      F
Sbjct: 484 RNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASF 543

Query: 472 SSLPHLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQ-SIPEGFKNLTSLTELDLSDN 530
           S +P L +                      LDLSQN L   IP+   N+ SL ++++S N
Sbjct: 544 SEMPVLSQ----------------------LDLSQNQLSGEIPKNLGNVESLVQVNISHN 581

Query: 531 NI-SALPP 537
           ++  +LP 
Sbjct: 582 HLHGSLPS 589


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 582
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
KOG0617264 consensus Ras suppressor protein (contains leucine 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.64
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.63
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.36
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.27
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.25
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.25
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.23
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.21
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.1
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.95
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.69
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.59
KOG4341483 consensus F-box protein containing LRR [General fu 98.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.37
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.36
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.34
PLN03150623 hypothetical protein; Provisional 98.34
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.3
PLN03150623 hypothetical protein; Provisional 98.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.28
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.27
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.24
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.21
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.2
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.19
PRK15386 426 type III secretion protein GogB; Provisional 98.12
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.09
KOG4341483 consensus F-box protein containing LRR [General fu 98.07
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.07
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.02
PRK15386426 type III secretion protein GogB; Provisional 98.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.89
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.31
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.23
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.09
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.0
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.85
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.76
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.74
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.1
smart0037026 LRR Leucine-rich repeats, outliers. 95.08
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.08
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.68
KOG4308478 consensus LRR-containing protein [Function unknown 94.57
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.54
KOG4308478 consensus LRR-containing protein [Function unknown 94.45
smart0037026 LRR Leucine-rich repeats, outliers. 94.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.1
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.95
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.52
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.64
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.95
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.93
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 85.32
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 82.05
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=2e-55  Score=395.61  Aligned_cols=552  Identities=47%  Similarity=0.718  Sum_probs=486.0

Q ss_pred             ChHHHHHHhhcCceecCCCCCCCcchHHHhhhccccCCCccccccCccEEEcCCCCccchhHhhcCCCCCcEEEcCCCCC
Q 007984            1 MDRILKAARTSGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKEDLRNLPLLTVLNVSHNKL   80 (582)
Q Consensus         1 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~i~~~~~~~~~~~~L~~L~L~~~~~   80 (582)
                      .++++|+||+-+.+++|++.+..+|..+++..-...+++.||+-..+.++.++++.++.+.+.+.++..+.+|++.+++.
T Consensus         1 ~~~l~k~arksg~lnlsnr~l~~vp~~vyq~~~t~~e~e~wW~qv~l~~lils~N~l~~l~~dl~nL~~l~vl~~~~n~l   80 (565)
T KOG0472|consen    1 MQRLLKAARKSGSLNLSNRSLKDVPTEVYQINLTTGEGENWWEQVDLQKLILSHNDLEVLREDLKNLACLTVLNVHDNKL   80 (565)
T ss_pred             CchHHHHHHhhcccccccchhhhccHHHHHHHhhccchhhhhhhcchhhhhhccCchhhccHhhhcccceeEEEeccchh
Confidence            36889999999999999999999999999887777889999999999999999999999989999999999999999999


Q ss_pred             cccchhhhCCCCCcEEecCCCcCccCChhhhccCCccEEEccCCcCCcCCcccccCCCCCeEEcCCCcCCCCccccccCC
Q 007984           81 SELPAAIGELHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCS  160 (582)
Q Consensus        81 ~~l~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~i~~~l~~~~  160 (582)
                      .++|.+++.+..++.++.++|++..+|..+..+.+|.+++++++.+.+++..++.+..++.++...|++..+|.++..+.
T Consensus        81 ~~lp~aig~l~~l~~l~vs~n~ls~lp~~i~s~~~l~~l~~s~n~~~el~~~i~~~~~l~dl~~~~N~i~slp~~~~~~~  160 (565)
T KOG0472|consen   81 SQLPAAIGELEALKSLNVSHNKLSELPEQIGSLISLVKLDCSSNELKELPDSIGRLLDLEDLDATNNQISSLPEDMVNLS  160 (565)
T ss_pred             hhCCHHHHHHHHHHHhhcccchHhhccHHHhhhhhhhhhhccccceeecCchHHHHhhhhhhhccccccccCchHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcEEEccCCcccccchhhhcccccCcEEEccCCccCccchhhcCCCCccEEeCCCCcCccCCcCCcCCCCCcEEEcCCC
Q 007984          161 KMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNN  240 (582)
Q Consensus       161 ~L~~L~l~~~~i~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~l~~~~~L~~L~l~~~  240 (582)
                      ++..+++.+|.+...++..+. ++.|++++...|.++.+|..++.+.+|..|++..|.+..+| .|.+|..|++++++.|
T Consensus       161 ~l~~l~~~~n~l~~l~~~~i~-m~~L~~ld~~~N~L~tlP~~lg~l~~L~~LyL~~Nki~~lP-ef~gcs~L~Elh~g~N  238 (565)
T KOG0472|consen  161 KLSKLDLEGNKLKALPENHIA-MKRLKHLDCNSNLLETLPPELGGLESLELLYLRRNKIRFLP-EFPGCSLLKELHVGEN  238 (565)
T ss_pred             HHHHhhccccchhhCCHHHHH-HHHHHhcccchhhhhcCChhhcchhhhHHHHhhhcccccCC-CCCccHHHHHHHhccc
Confidence            999999999999999888666 99999999999999999999999999999999999999998 8999999999999999


Q ss_pred             cCcccchhhh-ccCCCcEEEcccCcccccchhhhccc-ccEEEccCCCCCCCCccccCCCCCCeEEccCCCCcccccccc
Q 007984          241 ALSALPAELG-KLSKLGTLDLHSNQLKEYCVEACQLR-LSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLV  318 (582)
Q Consensus       241 ~i~~l~~~l~-~~~~L~~L~l~~~~~~~~~~~~~~~~-L~~l~l~~~~l~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~  318 (582)
                      .|..+|++.. .++.+..||+..|+++++|+..+..+ ++.+|+++|.++.+|..++++ +|+.|.+.||++..+++...
T Consensus       239 ~i~~lpae~~~~L~~l~vLDLRdNklke~Pde~clLrsL~rLDlSNN~is~Lp~sLgnl-hL~~L~leGNPlrTiRr~ii  317 (565)
T KOG0472|consen  239 QIEMLPAEHLKHLNSLLVLDLRDNKLKEVPDEICLLRSLERLDLSNNDISSLPYSLGNL-HLKFLALEGNPLRTIRREII  317 (565)
T ss_pred             HHHhhHHHHhcccccceeeeccccccccCchHHHHhhhhhhhcccCCccccCCcccccc-eeeehhhcCCchHHHHHHHH
Confidence            9999988765 89999999999999999999988877 999999999999999999999 99999999999999999999


Q ss_pred             CCCcHHHHHHHHhcCCCCCccccccchhhH------HhhhhcccccccEEEecCCCCccCChhhhccCC---ccEEEcCC
Q 007984          319 NGPTPALLKYLRSRLPENEDSEASTTKEDL------ITMATRLSVTSKELSLEGMNLSAIPSEIWEAGE---ITKLDLSR  389 (582)
Q Consensus       319 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~l~~l~l~~~~~~~i~~~~~~~~~---L~~L~l~~  389 (582)
                      ..++.+.+++....+...............      .........+.+.++.++-+++.+|...|....   .+..+++.
T Consensus       318 ~~gT~~vLKyLrs~~~~dglS~se~~~e~~~t~~~~~~~~~~~~i~tkiL~~s~~qlt~VPdEVfea~~~~~Vt~Vnfsk  397 (565)
T KOG0472|consen  318 SKGTQEVLKYLRSKIKDDGLSQSEGGTETAMTLPSESFPDIYAIITTKILDVSDKQLTLVPDEVFEAAKSEIVTSVNFSK  397 (565)
T ss_pred             cccHHHHHHHHHHhhccCCCCCCcccccccCCCCCCcccchhhhhhhhhhcccccccccCCHHHHHHhhhcceEEEeccc
Confidence            999999999998855443322111111111      111222234667889999999999999887554   88999999


Q ss_pred             CcCCcCCccccCCCCCCEEEcccCcCCCCChHHhhCCCCCCEeeCCCCCCccCCCccccCCCCCcEEeCCCCcCCCCCCC
Q 007984          390 NSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENP  469 (582)
Q Consensus       390 ~~l~~l~~~l~~~~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~  469 (582)
                      |++..+|..+..+..+.+.-+..++..++.+..++.+++|..|++++|.+.+++.+ +..+-.|+.+|++.|.|-..   
T Consensus       398 NqL~elPk~L~~lkelvT~l~lsnn~isfv~~~l~~l~kLt~L~L~NN~Ln~LP~e-~~~lv~Lq~LnlS~NrFr~l---  473 (565)
T KOG0472|consen  398 NQLCELPKRLVELKELVTDLVLSNNKISFVPLELSQLQKLTFLDLSNNLLNDLPEE-MGSLVRLQTLNLSFNRFRML---  473 (565)
T ss_pred             chHhhhhhhhHHHHHHHHHHHhhcCccccchHHHHhhhcceeeecccchhhhcchh-hhhhhhhheecccccccccc---
Confidence            99999999887777766555555666677778889999999999999999999877 66777899999998855322   


Q ss_pred             CCCCCccchhhhhccccccCchhhhccCCCCEEecCCCcCCccchh-hcCCCCCCEEeCCCCcCCcCCCcccccccccce
Q 007984          470 PFSSLPHLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQSIPEG-FKNLTSLTELDLSDNNISALPPELGLLEPSLQA  548 (582)
Q Consensus       470 ~~~~~~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~l~~l~~~-~~~l~~L~~L~l~~n~l~~l~~~~~~~~~~L~~  548 (582)
                                          |..+.....++.+-.++|++..++.. +.+|.+|..||+.+|.+..+|+.+.. +.+|++
T Consensus       474 --------------------P~~~y~lq~lEtllas~nqi~~vd~~~l~nm~nL~tLDL~nNdlq~IPp~Lgn-mtnL~h  532 (565)
T KOG0472|consen  474 --------------------PECLYELQTLETLLASNNQIGSVDPSGLKNMRNLTTLDLQNNDLQQIPPILGN-MTNLRH  532 (565)
T ss_pred             --------------------hHHHhhHHHHHHHHhccccccccChHHhhhhhhcceeccCCCchhhCChhhcc-ccceeE
Confidence                                33334445567777788899988654 89999999999999999999997665 499999


Q ss_pred             eeccCCCCCcchHHHhccchHHHHHHHHhcCC
Q 007984          549 LRLDGNPLRSIRRTILDRGTKAVLKYLKDKIP  580 (582)
Q Consensus       549 L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  580 (582)
                      |+++||++.-.+..++-..+.+++.|+++.+|
T Consensus       533 LeL~gNpfr~Pr~~iLmkgT~aiL~ylrdrIp  564 (565)
T KOG0472|consen  533 LELDGNPFRQPRHQILMKGTAAILSYLRDRIP  564 (565)
T ss_pred             EEecCCccCCCHHHHhccChHHHHHHhcccCC
Confidence            99999999988889999999999999999998



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 5e-09
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 2e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 5e-05
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 2e-06
3g06_A622 The Salmonella Virulence Effector Ssph2 Functions A 2e-06
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 4e-06
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-06
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 6e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 7e-05
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 8e-06
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 1e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 2e-05
3oja_B597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 2e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-05
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 4e-05
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 4e-05
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 4e-05
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 4e-05
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 4e-05
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 6e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 7e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 8e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 8e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 3e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 8e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 3e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 1e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 1e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 1e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 3e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 1e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 4e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 1e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 1e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 1e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-04
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 2e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 2e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 2e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 2e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-04
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 3e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-04
2z63_A 570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 3e-04
3fxi_A 605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 3e-04
4g8a_A 635 Crystal Structure Of Human Tlr4 Polymorphic Variant 4e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 5e-04
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 5e-04
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 5e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 5e-04
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure

Iteration: 1

Score = 59.7 bits (143), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 36/103 (34%), Positives = 54/103 (52%), Gaps = 1/103 (0%) Query: 165 LDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPS 224 LD+ ++ +S N I + LT L + N L +P I +LS L LDL NR+ S+P+ Sbjct: 229 LDLSNLQIFNISAN-IFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPA 287 Query: 225 SISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKE 267 + C L FY +N ++ LP E G L L L + N L++ Sbjct: 288 ELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEK 330
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-70
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-50
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-36
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-70
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-53
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-67
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-64
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-61
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-46
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-46
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-42
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-65
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-51
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-63
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-48
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-42
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-56
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-55
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-52
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-50
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-55
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-31
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-54
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-48
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-53
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-48
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-48
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-33
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-47
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-27
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-22
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-21
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-47
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-41
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-38
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-37
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-36
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-44
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-37
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-33
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-43
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-40
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-39
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-43
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-37
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-36
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-29
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-17
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-42
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-40
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-30
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-40
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-36
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-40
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-37
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-31
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-39
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-35
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-33
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-38
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-35
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-33
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-28
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-38
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-37
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-37
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-32
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-31
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-37
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-35
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-33
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-28
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-37
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-34
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-34
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-21
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-36
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-36
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-36
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-28
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-23
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-35
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-34
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-32
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-35
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-28
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-34
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-30
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-29
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-34
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-32
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-26
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-34
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-27
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-33
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-31
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-32
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-29
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-23
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-22
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-26
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-25
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-25
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-20
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-25
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-12
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-22
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-24
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-23
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-23
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-23
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-19
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-15
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-10
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-20
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-18
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-18
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-18
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-17
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-16
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-13
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-11
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-12
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 3e-06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 7e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 7e-04
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
 Score =  241 bits (616), Expect = 4e-70
 Identities = 94/577 (16%), Positives = 181/577 (31%), Gaps = 91/577 (15%)

Query: 47  LQKLILAHNNIEKLK-EDLRNLPLLTVLNVSHNKLSELPAAIGELHMLKSLDVSFNSIMK 105
           +  L LA    +    + +  L  L VL+   +  +      G+  +   +       ++
Sbjct: 325 VTGLSLAGFGAKGRVPDAIGQLTELKVLSFGTHSETVSGRLFGDEELTPDMSEERKHRIR 384

Query: 106 I---PDEIGSATALVKFDCSSNQLKELP------SSLGRCLNLSDFKASNNCITSLPEDL 156
           +      +     L   D   + +   P            L  +      N IT + + +
Sbjct: 385 MHYKKMFLDYDQRLNLSDLLQDAINRNPEMKPIKKDSRISLKDTQIGNLTNRITFISKAI 444

Query: 157 ADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQ 216
              +K+  +    +  T  +  +                      +  +L  L  ++L+ 
Sbjct: 445 QRLTKLQIIYFANSPFTYDNIAVDWEDANSDYA----KQYENEELSWSNLKDLTDVELYN 500

Query: 217 NRIL-SIPSSISGCCSLAEFYMGNNALS----------ALPAELGKLSKLGTLDLHSNQL 265
              +  +P  +     L    +  N              L  +     K+    +  N L
Sbjct: 501 CPNMTQLPDFLYDLPELQSLNIACNRGISAAQLKADWTRLADDEDTGPKIQIFYMGYNNL 560

Query: 266 KEYCVEA--CQLR-LSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPT 322
           +E+   A   ++  L +LD  +N +  L    G    L  L L  N +  +         
Sbjct: 561 EEFPASASLQKMVKLGLLDCVHNKVRHLE-AFGTNVKLTDLKLDYNQIEEIPEDFCA--- 616

Query: 323 PALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAG-- 380
                 +                                L      L  IP+        
Sbjct: 617 --FTDQVE------------------------------GLGFSHNKLKYIPNIFNAKSVY 644

Query: 381 EITKLDLSRNSIQELPPELSS------CASLQTLILSRNKIKDWPDAILTSLSSLSCLKL 434
            +  +D S N I      +S         +  T+ LS N+I+ +P  +  + S +S + L
Sbjct: 645 VMGSVDFSYNKIGSEGRNISCSMDDYKGINASTVTLSYNEIQKFPTELFATGSPISTIIL 704

Query: 435 DNNPLRQVPSDGFKDIP-------MLQILDLSYN-IASLPENPPFSSLPHLQELYLRM-Q 485
            NN +  +P +  K          +L  +DL +N + SL ++   ++LP+L  + +    
Sbjct: 705 SNNLMTSIPENSLKPKDGNYKNTYLLTTIDLRFNKLTSLSDDFRATTLPYLSNMDVSYNC 764

Query: 486 LREAPTDILRLQQLRILDLSQNS-------LQSIPEGFKNLTSLTELDLSDNNISALPPE 538
               PT  L   QL+   +           L+  P G     SL +L +  N+I  +  +
Sbjct: 765 FSSFPTQPLNSSQLKAFGIRHQRDAEGNRILRQWPTGITTCPSLIQLQIGSNDIRKVDEK 824

Query: 539 LGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYL 575
           L    P L  L +  NP  SI  T +    +A +  L
Sbjct: 825 LT---PQLYILDIADNPNISIDVTSVCPYIEAGMYVL 858


>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query582
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.78
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.78
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.72
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.63
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.52
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.51
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.49
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.49
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.4
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.27
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.22
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.2
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.94
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.89
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.72
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.69
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.65
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.01
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.01
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.8
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.75
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.63
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.62
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 92.27
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 91.42
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
Probab=100.00  E-value=7.5e-50  Score=422.68  Aligned_cols=494  Identities=20%  Similarity=0.216  Sum_probs=417.0

Q ss_pred             cCceecCCCCCCCcchHHHhhhccccCCCccccccCccEEEcCCCCccchhH-hhcCCCCCcEEEcCCCCCccc-chhhh
Q 007984           11 SGSLNLSNRSLRDVPNEVYKNFDEAGEGDKWWEAVDLQKLILAHNNIEKLKE-DLRNLPLLTVLNVSHNKLSEL-PAAIG   88 (582)
Q Consensus        11 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~i~~~~~-~~~~~~~L~~L~L~~~~~~~l-~~~~~   88 (582)
                      ..++++++..++.+|.++               .+++++|+++++.++.++. .|.++++|++|++++|.++.+ +.+|.
T Consensus        13 ~~~~~c~~~~l~~ip~~~---------------~~~l~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~i~~~~~~   77 (606)
T 3vq2_A           13 NITYQCMDQKLSKVPDDI---------------PSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWH   77 (606)
T ss_dssp             TTEEECTTSCCSSCCTTS---------------CTTCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCCCCEECTTTTT
T ss_pred             CCceEccCCCcccCCCCC---------------CCCcCEEECCCCCcCEeChhhccCCccCcEEeCCCCcccccCHHHhh
Confidence            357999999999999876               4689999999999998865 899999999999999999977 56899


Q ss_pred             CCCCCcEEecCCCcCccC-ChhhhccCCccEEEccCCcCCcCC-cccccCCCCCeEEcCCCcCC--CCccccccCCCCcE
Q 007984           89 ELHMLKSLDVSFNSIMKI-PDEIGSATALVKFDCSSNQLKELP-SSLGRCLNLSDFKASNNCIT--SLPEDLADCSKMSK  164 (582)
Q Consensus        89 ~~~~L~~L~l~~~~~~~l-~~~~~~~~~L~~L~l~~~~~~~l~-~~~~~~~~L~~L~l~~~~~~--~i~~~l~~~~~L~~  164 (582)
                      .+++|++|++++|.+..+ |..+.++++|++|++++|.+..++ ..+.++++|++|++++|.+.  .+|..++.+++|++
T Consensus        78 ~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~lp~~~~~l~~L~~  157 (606)
T 3vq2_A           78 GLHHLSNLILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVH  157 (606)
T ss_dssp             TCTTCCEEECTTCCCCCCCTTSSTTCTTCCEEECTTSCCCCSSSSCCTTCTTCCEEECCSSCCCCCCCCGGGGTCTTCCE
T ss_pred             chhhcCEeECCCCcccccChhhcCCcccCCEEEccCCccccccccccCCCCCCCEEeCCCCcccceechHhHhhcCCCCE
Confidence            999999999999999987 778999999999999999998776 67899999999999999998  47889999999999


Q ss_pred             EEccCCcccccchhhhcccccCc----EEEccCCccCccchhhcCCCCccEEeCCCCcCc--cCCcCCcCCCCCcEEEc-
Q 007984          165 LDVEGNKLTVLSNNLIASWTMLT----ELIASKNLLNGMPETIGSLSRLIRLDLHQNRIL--SIPSSISGCCSLAEFYM-  237 (582)
Q Consensus       165 L~l~~~~i~~~~~~~~~~~~~L~----~L~l~~~~~~~~~~~l~~~~~L~~L~l~~~~~~--~~~~~l~~~~~L~~L~l-  237 (582)
                      |++++|+++.+.+..++.+.+|+    ++++++|.+..++.......+|+.|++++|.+.  ..+..+.++++++.+.+ 
T Consensus       158 L~Ls~n~l~~~~~~~~~~l~~L~~~l~~L~l~~n~l~~~~~~~~~~~~L~~L~L~~n~~~~~~~~~~~~~l~~L~~l~l~  237 (606)
T 3vq2_A          158 VDLSYNYIQTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLI  237 (606)
T ss_dssp             EECCSSCCCEECTTTTHHHHHCTTCCCEEECTTCCCCEECTTTTTTCEEEEEEEESCCSCHHHHHHHHHTTTTCEEEEEE
T ss_pred             EEccCCcceecChhhhhhhhccccccceeeccCCCcceeCcccccCceeeeeeccCCccchhHHHHHhcccccccccccc
Confidence            99999999998887788887765    899999999888766555569999999999875  33445555666655554 


Q ss_pred             --------------------------------CCCcCcccchhhhccCCCcEEEcccCcccccchhhhcccccEEEccCC
Q 007984          238 --------------------------------GNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNN  285 (582)
Q Consensus       238 --------------------------------~~~~i~~l~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~L~~l~l~~~  285 (582)
                                                      ..+.+......+..+++|++++++++.+..++......+++.+++++|
T Consensus       238 ~~~~~~~~~l~~~~~~~~~~l~~l~l~~l~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~l~~l~~~~~L~~L~l~~n  317 (606)
T 3vq2_A          238 LGEFKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRC  317 (606)
T ss_dssp             EECCTTSCCCSCCCGGGGTTGGGSEEEEEEECCCTTCCGGGGSCGGGTTCSEEEEESCCCCCCCCCCTTCCCSEEEEESC
T ss_pred             ccccccCCcccccChHHhhhhhhccHhheeccccccccccccccccCCCCCEEEecCccchhhhhccccccCCEEEcccc
Confidence                                            334444332337778899999999998888774444446999999999


Q ss_pred             CCCCCCccccCCCCCCeEEccCCCCccccccccCCCcHHHHHHHHhcCCCCCccccccchhhHHhhhhcccccccEEEec
Q 007984          286 SLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLE  365 (582)
Q Consensus       286 ~l~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~l~  365 (582)
                      .+..+| .+ .+++|++|++++|......                                     .......++.++++
T Consensus       318 ~l~~lp-~~-~l~~L~~L~l~~n~~~~~~-------------------------------------~~~~l~~L~~L~ls  358 (606)
T 3vq2_A          318 QLKQFP-TL-DLPFLKSLTLTMNKGSISF-------------------------------------KKVALPSLSYLDLS  358 (606)
T ss_dssp             CCSSCC-CC-CCSSCCEEEEESCSSCEEC-------------------------------------CCCCCTTCCEEECC
T ss_pred             cCcccc-cC-CCCccceeeccCCcCccch-------------------------------------hhccCCCCCEEECc
Confidence            887777 45 8899999999988532110                                     11123578999999


Q ss_pred             CCCCccC---ChhhhccCCccEEEcCCCcCCcCCccccCCCCCCEEEcccCcCCCCCh-HHhhCCCCCCEeeCCCCCCcc
Q 007984          366 GMNLSAI---PSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPD-AILTSLSSLSCLKLDNNPLRQ  441 (582)
Q Consensus       366 ~~~~~~i---~~~~~~~~~L~~L~l~~~~l~~l~~~l~~~~~L~~L~l~~~~l~~~~~-~~l~~l~~L~~L~l~~~~l~~  441 (582)
                      ++.+..+   +..+..+++|++|++++|.+..+|..+..+++|++|++++|.+.+... ..+..+++|++|++++|.+..
T Consensus       359 ~n~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~l~~n~l~~  438 (606)
T 3vq2_A          359 RNALSFSGCCSYSDLGTNSLRHLDLSFNGAIIMSANFMGLEELQHLDFQHSTLKRVTEFSAFLSLEKLLYLDISYTNTKI  438 (606)
T ss_dssp             SSCEEEEEECCHHHHCCSCCCEEECCSCSEEEECCCCTTCTTCCEEECTTSEEESTTTTTTTTTCTTCCEEECTTSCCEE
T ss_pred             CCccCCCcchhhhhccCCcccEeECCCCccccchhhccCCCCCCeeECCCCccCCccChhhhhccccCCEEECcCCCCCc
Confidence            9988765   788888999999999999999998889999999999999999988765 568899999999999999999


Q ss_pred             CCCccccCCCCCcEEeCCCCcCCC-CCCCCCCCCccchhhhh-ccccccC-chhhhccCCCCEEecCCCcCCcc-chhhc
Q 007984          442 VPSDGFKDIPMLQILDLSYNIASL-PENPPFSSLPHLQELYL-RMQLREA-PTDILRLQQLRILDLSQNSLQSI-PEGFK  517 (582)
Q Consensus       442 ~~~~~~~~~~~L~~L~l~~n~l~~-~~~~~~~~~~~L~~L~l-~~~~~~~-~~~~~~~~~L~~L~l~~~~l~~l-~~~~~  517 (582)
                      ..+..+..+++|++|++++|.+++ ..+..+..+++|++|++ .+.+... +..+..+++|++|++++|+++.+ |..+.
T Consensus       439 ~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~  518 (606)
T 3vq2_A          439 DFDGIFLGLTSLNTLKMAGNSFKDNTLSNVFANTTNLTFLDLSKCQLEQISWGVFDTLHRLQLLNMSHNNLLFLDSSHYN  518 (606)
T ss_dssp             CCTTTTTTCTTCCEEECTTCEEGGGEECSCCTTCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCSCEEGGGTT
T ss_pred             cchhhhcCCCCCCEEECCCCcCCCcchHHhhccCCCCCEEECCCCcCCccChhhhcccccCCEEECCCCcCCCcCHHHcc
Confidence            888889999999999999999987 45778999999999999 6566554 55788999999999999999976 77899


Q ss_pred             CCCCCCEEeCCCCcCCcCCCcccccccccceeeccCCCCCc
Q 007984          518 NLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRS  558 (582)
Q Consensus       518 ~l~~L~~L~l~~n~l~~l~~~~~~~~~~L~~L~l~~~~~~~  558 (582)
                      ++++|++|++++|+++.+|..+....++|+.|++++|++..
T Consensus       519 ~l~~L~~L~l~~N~l~~~p~~~~~l~~~L~~l~l~~N~~~c  559 (606)
T 3vq2_A          519 QLYSLSTLDCSFNRIETSKGILQHFPKSLAFFNLTNNSVAC  559 (606)
T ss_dssp             TCTTCCEEECTTSCCCCEESCGGGSCTTCCEEECCSCCCCC
T ss_pred             CCCcCCEEECCCCcCcccCHhHhhhcccCcEEEccCCCccc
Confidence            99999999999999999999865553479999999999864



>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 582
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-15
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-08
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-06
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 7e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 85.8 bits (211), Expect = 1e-18
 Identities = 74/353 (20%), Positives = 132/353 (37%), Gaps = 23/353 (6%)

Query: 186 LTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSAL 245
           +T L A +  +  + + +  L+ L +++   N++  I   +     L +  M NN ++ +
Sbjct: 46  VTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQIADI 103

Query: 246 PAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLL 305
                  +  G    ++       ++       +   SN     +              L
Sbjct: 104 TPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNT----ISDISALSGLTSLQQL 159

Query: 306 TGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTS------ 359
           +     T    L N  T   L    +++ +       T  E LI    ++S  +      
Sbjct: 160 SFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILT 219

Query: 360 --KELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKD 417
              ELSL G  L  I + +     +T LDL+ N I  L P LS    L  L L  N+I +
Sbjct: 220 NLDELSLNGNQLKDIGT-LASLTNLTDLDLANNQISNLAP-LSGLTKLTELKLGANQISN 277

Query: 418 WPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHL 477
                L  L++L+ L+L+ N           ++  L  L L +N  ++ +  P SSL  L
Sbjct: 278 ISP--LAGLTALTNLELNENQ--LEDISPISNLKNLTYLTLYFN--NISDISPVSSLTKL 331

Query: 478 QELYLRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDN 530
           Q L+         + +  L  +  L    N +  +     NLT +T+L L+D 
Sbjct: 332 QRLFFANNKVSDVSSLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query582
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.48
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.2
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.11
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.32
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.18
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.15
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.98
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.83
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.81
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.96  E-value=3.8e-26  Score=224.88  Aligned_cols=145  Identities=29%  Similarity=0.411  Sum_probs=103.7

Q ss_pred             ccCCccEEEcCCCcCCcCCccccCCCCCCEEEcccCcCCCCChHHhhCCCCCCEeeCCCCCCccCCCccccCCCCCcEEe
Q 007984          378 EAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILD  457 (582)
Q Consensus       378 ~~~~L~~L~l~~~~l~~l~~~l~~~~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~  457 (582)
                      .+++|+.+++++|.+++++. +..+++|++|++++++++++..  +..++.++.+.+.+|.+..+.  .+..++++++|+
T Consensus       239 ~l~~L~~L~l~~n~l~~~~~-~~~~~~L~~L~l~~~~l~~~~~--~~~~~~l~~l~~~~n~l~~~~--~~~~~~~l~~L~  313 (384)
T d2omza2         239 SLTNLTDLDLANNQISNLAP-LSGLTKLTELKLGANQISNISP--LAGLTALTNLELNENQLEDIS--PISNLKNLTYLT  313 (384)
T ss_dssp             GCTTCSEEECCSSCCCCCGG-GTTCTTCSEEECCSSCCCCCGG--GTTCTTCSEEECCSSCCSCCG--GGGGCTTCSEEE
T ss_pred             cccccchhccccCccCCCCc-ccccccCCEeeccCcccCCCCc--ccccccccccccccccccccc--ccchhcccCeEE
Confidence            35566666666666666542 5666777777777777766543  566777777777777766643  256677777777


Q ss_pred             CCCCcCCCCCCCCCCCCccchhhhhccccccCchhhhccCCCCEEecCCCcCCccchhhcCCCCCCEEeCCCCcCCcCCC
Q 007984          458 LSYNIASLPENPPFSSLPHLQELYLRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPP  537 (582)
Q Consensus       458 l~~n~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~n~l~~l~~  537 (582)
                      +++|++.++.                        .+..+++|++|++++|.++.++ .+.++++|++|++++|+++++++
T Consensus       314 ls~n~l~~l~------------------------~l~~l~~L~~L~L~~n~l~~l~-~l~~l~~L~~L~l~~N~l~~l~~  368 (384)
T d2omza2         314 LYFNNISDIS------------------------PVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP  368 (384)
T ss_dssp             CCSSCCSCCG------------------------GGGGCTTCCEEECCSSCCCCCG-GGGGCTTCCEEECCSSCCCBCGG
T ss_pred             CCCCCCCCCc------------------------ccccCCCCCEEECCCCCCCCCh-hHcCCCCCCEEECCCCcCCCChh
Confidence            7777665432                        2456788888889888888876 57888999999999998888776


Q ss_pred             cccccccccceeeccCC
Q 007984          538 ELGLLEPSLQALRLDGN  554 (582)
Q Consensus       538 ~~~~~~~~L~~L~l~~~  554 (582)
                        +..+++|+.|+|++|
T Consensus       369 --l~~l~~L~~L~L~~N  383 (384)
T d2omza2         369 --LANLTRITQLGLNDQ  383 (384)
T ss_dssp             --GTTCTTCSEEECCCE
T ss_pred             --hccCCCCCEeeCCCC
Confidence              455688999998887



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure