Citrus Sinensis ID: 008089

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
MRWEKVQPKSPQALVAQQLVSSEISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANKPTSASTTNHNSSRKRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKDPVDSEPSIAQLNLNDDRTTNAPSSTTEVPKEAICSTDKDSATLLLSKDVKIPVAECVTDPAEPI
ccEEEcccccccccccccEEEEEccccccccccccEEEEEccccEEEEEccccccccEEccEEEEEccccEEEEEEcccccccccccEEEEEEccEEEEEcccccccccccEEEEEccccEEEEEEEcccccccccccEEEEEccEEEEEccccccccccccccccEEEEEEcccccEEEEEcccccccccccccEEEEccEEEEEEEccccccccccEEEEEcccccEEEEEccccccccccccEEEEEccEEEEEccccccccccccEEEEEcccccEEEEEEcccccccccccEEEEEccccccEEEEEccccccccccccEEEEEcccccccccEEcccccccccccccccEEEccccEEEEEccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEcccEEEEEcccccEEEcccccccccccccccEEEEEEccEEEEEEccccccccccEEEEEEccccEEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEEccccEEEEEcccccccccccccEEEEEccEEEEEEccccccccccccccccEEEEcccccEEEEEcccccccccccccEEEEEccEEEEEEcccccccccccEEEEcccccEEEEEccccccccccccEEEEEEccEEEEEEcccccccccccEEEEEccccEEEEEcccccccccccccEEEEEEEEcccEEEEEEcccccccccccEEEEEccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccEcccccccccEEEEEEcccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEEEccccccccccc
mrwekvqpkspqALVAQQLVSseisssgpgkrwghtcnaikggrflyvfggygkdncqtnqvHVFDTVnqtwsqpvikgspptprdshscttvgenlyvfggtdgmnplrdlhildtsshtwispsvrgegpeareghsAALVGKRLFifggcgkssntndevyyndlyILNTETFVWKRattsgnppsardshtcsswkNKIIViggedghdyylsdvhildtdtltwkelntsgmvlspraghstvafGKNLfvfggftdsqnlyddlymidvdsglwtkvittgegpsarfsvagdcldplkgGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKcqeqnftpvhdrALVRIdtisdvhqptpllsygeprrnnfplnegkktfqakvtesfplgytiettidgkplrgilfankptsasttnhnssrkRAVGEIggamlngdcnsnSKAFKALRqdgmdqeqvdgvqvkeftshegaaaaapdmknpahsdafqpvkdpvdsepsiaqlnlnddrttnapssttevpkeaicstdkdsatlllskdvkipvaecvtdpaepi
mrwekvqpkspqalVAQQLVSseisssgpgkrwGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTwsqpvikgspptprdshsctTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTsgnppsardshtcssWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLkcqeqnftpvhdrALVRIDTIsdvhqptpllsygeprrnnfplnegKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANkptsasttnhnssrkRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKDPVDSEPSIAqlnlnddrttnapssttevpkeaicsTDKDsatlllskdvkipvaecvtdpaepi
MRWEKVQPKSPQALVAQQLVSSEISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANKPTSASTTNHNSSRKRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGaaaaaPDMKNPAHSDAFQPVKDPVDSEPSIAQLNLNDDRTTNAPSSTTEVPKEAICSTDKDSATLLLSKDVKIPVAECVTDPAEPI
*******************************RWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVI************CTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWI****************AALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRA*************TCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSY***************TFQAKVTESFPLGYTIETTIDGKPLRGILFA********************************************************************************************************************************LLLSKDVKIPVAEC********
MRWEK**PKSPQALVAQ*L************RWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVIT*****SARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERK******************FTPVHDRALVRIDTISDV*************************************************************************************************************************************************************************************************************
**************VAQQ**************WGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVI************CTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISP*************SAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRAT**************SSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANKP************KRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKDPVDSEPSIAQLNLNDDRTT*************ICSTDKDSATLLLSKDVKIPVAECVTDPAEPI
*RWEKVQPKSPQALVAQQLVSSEISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANK*****************************************************************************************************************************TLLLSKDVKIPVAECVTD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRWEKVQPKSPQALVAQQLVSSEISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANKPTSASTTNHNSSRKRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKDPVDSEPSIAQLNLNDDRTTNAPSSTTEVPKEAICSTDKDSATLLLSKDVKIPVAECVTDPAEPI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query578 2.2.26 [Sep-21-2011]
Q8VEM9382 Kelch domain-containing p yes no 0.524 0.793 0.282 8e-32
Q6AYI2382 Kelch domain-containing p yes no 0.524 0.793 0.282 8e-32
Q7M3S9 943 RING finger protein B OS= no no 0.494 0.303 0.300 2e-31
P87061 1147 Tip elongation aberrant p yes no 0.479 0.241 0.302 2e-31
Q58CV6382 Kelch domain-containing p yes no 0.524 0.793 0.279 1e-30
Q6AXB2366 Rab9 effector protein wit N/A no 0.463 0.732 0.309 2e-30
Q9BQ90382 Kelch domain-containing p yes no 0.524 0.793 0.282 6e-30
Q54C94 1127 Ras guanine nucleotide ex no no 0.455 0.233 0.286 8e-28
Q5EA50372 Rab9 effector protein wit no no 0.460 0.715 0.296 1e-27
Q9V4C8 1500 Host cell factor OS=Droso yes no 0.513 0.198 0.307 2e-27
>sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 Back     alignment and function desciption
 Score =  139 bits (349), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 95/336 (28%), Positives = 156/336 (46%), Gaps = 33/336 (9%)

Query: 39  AIKGGRFLYVFGGY--GKDNCQTNQ--VHVFDTVNQTWS-----QPVIKGSPPTP---RD 86
           A+  G  +Y FGGY  G+D     Q  VH+F+ V+  W+     +P ++G  P     R 
Sbjct: 19  AVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVRPAVRGQAPVVPYMRY 78

Query: 87  SHSCTTVGENLYVFGG-TDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGK 145
            HS   + + ++++GG  D       L+  D ++H W +P V G  P AR+GHSA ++GK
Sbjct: 79  GHSTVLIDDTVFLWGGRNDTEGACNVLYAFDVNTHKWSTPRVSGTVPGARDGHSACVLGK 138

Query: 146 RLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIV 205
            ++IFGG  + +    + + ND++ L+T T  W    T GNP   RD H+ +   N + V
Sbjct: 139 IMYIFGGYEQLA----DCFSNDIHKLDTSTMTWTLVCTKGNPARWRDFHSATMLGNHMYV 194

Query: 206 IGG--------EDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVF 257
            GG           ++ Y + + + DT T  W +   + ++   R  HS   +   L++F
Sbjct: 195 FGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPHTPVLPEGRRSHSAFGYNGELYIF 254

Query: 258 GGFTDSQNL-YDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCN 316
           GG+    N  + DL+  +  S  W K+   G+GP  R      C   +   +++F G   
Sbjct: 255 GGYNARLNRHFHDLWKFNPGSFTWKKIEPKGKGPCPR---RRQCCCIVGDKIVLFGGTSP 311

Query: 317 KSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQ 352
              E L D +     L++   L  L     LK  C+
Sbjct: 312 SPEEGLGDEF----DLIDHSDLHILDFSPSLKTLCK 343
May be involved in meiotic recombination process.
Mus musculus (taxid: 10090)
>sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 Back     alignment and function description
>sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 Back     alignment and function description
>sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 Back     alignment and function description
>sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 Back     alignment and function description
>sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 Back     alignment and function description
>sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 Back     alignment and function description
>sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 Back     alignment and function description
>sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 Back     alignment and function description
>sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query578
255547157556 kelch repeat protein, putative [Ricinus 0.955 0.992 0.690 0.0
297734075605 unnamed protein product [Vitis vinifera] 0.840 0.803 0.703 0.0
359491361589 PREDICTED: kelch domain-containing prote 0.813 0.797 0.697 0.0
449440856597 PREDICTED: uncharacterized protein LOC10 0.968 0.938 0.616 0.0
334182672556 galactose oxidase/kelch repeat domain-co 0.899 0.935 0.600 0.0
356562638609 PREDICTED: kelch domain-containing prote 0.908 0.862 0.623 0.0
449477505535 PREDICTED: uncharacterized protein LOC10 0.757 0.818 0.676 1e-179
297844816450 predicted protein [Arabidopsis lyrata su 0.740 0.951 0.662 1e-179
356507056 997 PREDICTED: uncharacterized protein LOC10 0.884 0.512 0.588 1e-178
356519144583 PREDICTED: uncharacterized protein LOC10 0.878 0.871 0.585 1e-177
>gi|255547157|ref|XP_002514636.1| kelch repeat protein, putative [Ricinus communis] gi|223546240|gb|EEF47742.1| kelch repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/582 (69%), Positives = 456/582 (78%), Gaps = 30/582 (5%)

Query: 1   MRWEKVQPKSPQALVAQQLVSSEISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTN 60
           MRWE++Q +   + +          ++GPGKRWGHTCN++KGGRFLYVFGGYGKDNCQTN
Sbjct: 1   MRWERLQQQQQSSNI----------NNGPGKRWGHTCNSVKGGRFLYVFGGYGKDNCQTN 50

Query: 61  QVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSH 120
           QVHVFDT  QTWSQPVIKG+PPTPRDSHSCTTVG++LYVFGGTDGMNPL+DLHILDT SH
Sbjct: 51  QVHVFDTATQTWSQPVIKGTPPTPRDSHSCTTVGDSLYVFGGTDGMNPLKDLHILDTLSH 110

Query: 121 TWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKR 180
           TWI+P+VRGEGPEAREGHSAALVGKRLFIFGGCGKSSN NDEVY+NDLYILNTETFVWK+
Sbjct: 111 TWIAPAVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNNNDEVYFNDLYILNTETFVWKK 170

Query: 181 ATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLS 240
           A TSG PPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILD +TL WKELN +G  L 
Sbjct: 171 AVTSGTPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDAETLVWKELNATGQKLP 230

Query: 241 PRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDC 300
           PRAGHSTV+FGKNLFVFGGFTD+QNLYDDLYM+DVD+G+WTK++T G GPSARFSVAGDC
Sbjct: 231 PRAGHSTVSFGKNLFVFGGFTDAQNLYDDLYMLDVDTGVWTKIMTAGIGPSARFSVAGDC 290

Query: 301 LDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLV---NERKLEKLSLRKQLKLKCQEQNF- 356
           LDP  GGVLVFIGGCNKSLEALDDMYYLYTGL    +E +LEKLSLRKQLKLKCQEQN  
Sbjct: 291 LDPQIGGVLVFIGGCNKSLEALDDMYYLYTGLARIRDELRLEKLSLRKQLKLKCQEQNLN 350

Query: 357 TPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETT 416
           +PVHD+AL+RIDT           S    R N   L++GKKTFQAKVTE FP GYTIET 
Sbjct: 351 SPVHDKALLRIDT-----------SRENLRLNQVQLHQGKKTFQAKVTECFPHGYTIETI 399

Query: 417 IDGKPLRGILFANKPTSASTTNHNSSRKRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQ 476
           IDGKPL GILFANKP S+   + ++SRKR   EI G +LN D N+ SK  KAL+QDG+D 
Sbjct: 400 IDGKPLHGILFANKPISSPMASQSNSRKRVSAEI-GPLLNSDHNNKSKTSKALKQDGVDH 458

Query: 477 EQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKDPVDSEPSIAQLNLNDDRTTNAP 536
            Q D V  KE   HE    A  D KN   SD  Q  + P + EPS+A LNLNDD  ++AP
Sbjct: 459 LQPDNVHGKETLMHESKPEA--DAKN-LPSDVSQLYEVPSNLEPSVAPLNLNDDMISDAP 515

Query: 537 SSTTEVPKEAICSTDKDSATLLLSKDVKIPVAECVTDPAEPI 578
           +S T   KE      K+S TL + +D +I  A    +PA+ +
Sbjct: 516 NSDTGFAKEFFTPA-KESITLSIKQDNRILTAGVGNEPAKSL 556

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297734075|emb|CBI15322.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491361|ref|XP_002265482.2| PREDICTED: kelch domain-containing protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449440856|ref|XP_004138200.1| PREDICTED: uncharacterized protein LOC101209027 [Cucumis sativus] Back     alignment and taxonomy information
>gi|334182672|ref|NP_173296.3| galactose oxidase/kelch repeat domain-containing protein [Arabidopsis thaliana] gi|9795595|gb|AAF98413.1|AC026238_5 Hypothetical protein [Arabidopsis thaliana] gi|332191613|gb|AEE29734.1| galactose oxidase/kelch repeat domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356562638|ref|XP_003549576.1| PREDICTED: kelch domain-containing protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|449477505|ref|XP_004155043.1| PREDICTED: uncharacterized protein LOC101224155 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297844816|ref|XP_002890289.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297336131|gb|EFH66548.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356507056|ref|XP_003522287.1| PREDICTED: uncharacterized protein LOC100785267 [Glycine max] Back     alignment and taxonomy information
>gi|356519144|ref|XP_003528234.1| PREDICTED: uncharacterized protein LOC100808826 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query578
DICTYBASE|DDB_G0270750485 DDB_G0270750 "Kelch repeat-con 0.453 0.540 0.336 3.4e-36
MGI|MGI:2651568382 Klhdc3 "kelch domain containin 0.536 0.811 0.295 2.6e-34
RGD|1307105382 Klhdc3 "kelch domain containin 0.536 0.811 0.295 2.6e-34
UNIPROTKB|A5GFR1410 KLHDC3 "Uncharacterized protei 0.536 0.756 0.295 7.5e-34
UNIPROTKB|Q58CV6382 KLHDC3 "Kelch domain-containin 0.536 0.811 0.293 2.8e-33
DICTYBASE|DDB_G0272080 1523 gacHH "RhoGAP domain-containin 0.273 0.103 0.381 1.1e-19
UNIPROTKB|Q9BQ90382 KLHDC3 "Kelch domain-containin 0.536 0.811 0.295 1e-32
UNIPROTKB|E2RCI2553 KLHDC3 "Uncharacterized protei 0.543 0.567 0.293 2.8e-31
UNIPROTKB|Q58D25550 KLHDC3 "Kelch domain-containin 0.543 0.570 0.290 4.2e-31
ZFIN|ZDB-GENE-040426-2426310 zgc:85727 "zgc:85727" [Danio r 0.448 0.835 0.298 4.9e-31
DICTYBASE|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 391 (142.7 bits), Expect = 3.4e-36, P = 3.4e-36
 Identities = 93/276 (33%), Positives = 138/276 (50%)

Query:     7 QPKSPQALVAQQLVSSEISSSG--PGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHV 64
             Q +  Q +    ++S+   ++G  P +R GHT    K    L  FGG    +   + ++ 
Sbjct:    92 QQQQQQQIQPSSIISTTQETTGFFPVERHGHTTCLYKNKVIL--FGGTPDGSHGLSDLYF 149

Query:    65 FDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWIS 124
                   +W +   KG+ P  R  HS   + + +Y+FGG      L DLH+LD  + TW  
Sbjct:   150 LYLDTYSWVEIKTKGNAPNGRYRHSAIIIEDKMYIFGGYRS-KCLNDLHVLDLETFTWSE 208

Query:   125 PSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTS 184
             P   GE P AR  HS   VGK + +FGG G         Y N+L+ L+T T  W +    
Sbjct:   209 PICIGEAPSARSSHSVCCVGKMMILFGGSGAR-------YSNELFSLDTVTMRWTKHDVL 261

Query:   185 GNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAG 244
             G PPS R  HT  S+  K++  GG +      + V+ILDTDT+ W +  TSG    PR  
Sbjct:   262 GTPPSERWCHTMCSFGKKVVTFGGSNDKRKD-NKVYILDTDTMEWSQPPTSGNCPIPRQL 320

Query:   245 HSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLW 280
             H+ VA G+++ VFGG+   Q L +DLY+++  +  W
Sbjct:   321 HTAVAIGESMIVFGGWGKHQEL-NDLYILNTRTMKW 355
GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0003674 "molecular_function" evidence=ND
MGI|MGI:2651568 Klhdc3 "kelch domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307105 Klhdc3 "kelch domain containing 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A5GFR1 KLHDC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q58CV6 KLHDC3 "Kelch domain-containing protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272080 gacHH "RhoGAP domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BQ90 KLHDC3 "Kelch domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCI2 KLHDC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q58D25 KLHDC3 "Kelch domain-containing protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2426 zgc:85727 "zgc:85727" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query578
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 1e-20
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 1e-19
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 2e-19
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 4e-16
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 9e-16
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 7e-13
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-11
PLN02772398 PLN02772, PLN02772, guanylate kinase 5e-10
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-09
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-08
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 6e-08
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 8e-08
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-07
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 2e-07
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 5e-07
pfam1385442 pfam13854, Kelch_5, Kelch motif 5e-07
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 7e-07
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 8e-07
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-06
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 2e-06
pfam1385442 pfam13854, Kelch_5, Kelch motif 3e-06
pfam0764648 pfam07646, Kelch_2, Kelch motif 5e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 6e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 6e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 7e-06
PLN02772398 PLN02772, PLN02772, guanylate kinase 1e-05
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 1e-05
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-05
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-05
pfam1385442 pfam13854, Kelch_5, Kelch motif 2e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-05
pfam0764648 pfam07646, Kelch_2, Kelch motif 3e-05
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 3e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 1e-04
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 1e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-04
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 3e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 3e-04
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 3e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 4e-04
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 4e-04
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 8e-04
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 0.001
pfam0134446 pfam01344, Kelch_1, Kelch motif 0.002
pfam0134446 pfam01344, Kelch_1, Kelch motif 0.002
pfam1385442 pfam13854, Kelch_5, Kelch motif 0.002
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 0.004
pfam0764648 pfam07646, Kelch_2, Kelch motif 0.004
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information 
 Score = 95.0 bits (236), Expect = 1e-20
 Identities = 89/324 (27%), Positives = 142/324 (43%), Gaps = 35/324 (10%)

Query: 23  EISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQ-VHVFDTVNQTWSQPVIKGSP 81
           E    GPG R  H    +  G  +Y FGG    N   ++ ++VFD   +TWS     G  
Sbjct: 157 EQKGEGPGLRCSHGIAQV--GNKIYSFGGEFTPNQPIDKHLYVFDLETRTWSISPATGDV 214

Query: 82  PTPRDSHSC-----TTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEARE 136
           P      SC      ++G  LYVFGG D        +  DT+++ W   +   EGP  R 
Sbjct: 215 PH----LSCLGVRMVSIGSTLYVFGGRDASRQYNGFYSFDTTTNEWKLLTPVEEGPTPRS 270

Query: 137 GHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTC 196
            HS A   + +++FGG   ++       YN   I++ +   W   +T G+  S R     
Sbjct: 271 FHSMAADEENVYVFGGVSATARLKTLDSYN---IVDKK---WFHCSTPGDSFSIRGGAGL 324

Query: 197 SSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFV 256
              + K+ V+ G +G +  + DVH  D     W ++ T G+  S R+  ++ A GK++ +
Sbjct: 325 EVVQGKVWVVYGFNGCE--VDDVHYYDPVQDKWTQVETFGVRPSERSVFASAAVGKHIVI 382

Query: 257 FGG--------FTDSQNLYDDLYMIDVDSGLWTKVITTG---EGPSARFSVAGD--CLDP 303
           FGG              L D  + +D ++  W ++   G   E PS+R   A     +D 
Sbjct: 383 FGGEIAMDPLAHVGPGQLTDGTFALDTETLQWERLDKFGEEEETPSSRGWTASTTGTIDG 442

Query: 304 LKGGVLVFIGGCNKSLEALDDMYY 327
            KG  LV  GG   + +  DD+++
Sbjct: 443 KKG--LVMHGGKAPTNDRFDDLFF 464

Length = 470
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 578
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 100.0
PLN02193470 nitrile-specifier protein 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.98
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.97
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.97
PHA02790480 Kelch-like protein; Provisional 99.97
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.96
PHA02790480 Kelch-like protein; Provisional 99.95
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.79
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.75
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.64
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.6
PF1396450 Kelch_6: Kelch motif 98.97
PLN02772398 guanylate kinase 98.91
PLN02772398 guanylate kinase 98.88
PF1396450 Kelch_6: Kelch motif 98.88
PF1341549 Kelch_3: Galactose oxidase, central domain 98.79
PF1341549 Kelch_3: Galactose oxidase, central domain 98.73
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.65
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.65
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.64
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.61
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.61
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.56
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.56
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.52
PF1385442 Kelch_5: Kelch motif 98.45
PF1385442 Kelch_5: Kelch motif 98.44
smart0061247 Kelch Kelch domain. 98.29
smart0061247 Kelch Kelch domain. 98.1
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 97.92
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.9
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 97.58
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.56
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.17
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.07
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.0
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.92
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.45
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.01
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.44
PRK05137435 tolB translocation protein TolB; Provisional 95.03
KOG2055514 consensus WD40 repeat protein [General function pr 94.52
KOG2055514 consensus WD40 repeat protein [General function pr 94.5
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.08
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 93.76
PF12768281 Rax2: Cortical protein marker for cell polarity 93.56
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 93.24
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 93.17
PRK04792448 tolB translocation protein TolB; Provisional 92.96
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 92.84
PF12768281 Rax2: Cortical protein marker for cell polarity 92.62
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 92.48
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 92.47
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 92.26
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 91.82
PRK04792448 tolB translocation protein TolB; Provisional 91.82
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 91.36
PRK00178430 tolB translocation protein TolB; Provisional 91.23
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 91.23
PRK05137435 tolB translocation protein TolB; Provisional 91.15
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 90.3
PF09910339 DUF2139: Uncharacterized protein conserved in arch 90.24
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 90.11
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 90.11
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 90.08
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 89.94
PRK04043419 tolB translocation protein TolB; Provisional 89.13
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 88.64
PRK04043419 tolB translocation protein TolB; Provisional 88.39
PF12217367 End_beta_propel: Catalytic beta propeller domain o 88.09
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 87.87
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 87.59
PRK04922433 tolB translocation protein TolB; Provisional 87.49
PRK00178430 tolB translocation protein TolB; Provisional 87.35
COG1520370 FOG: WD40-like repeat [Function unknown] 86.72
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 86.53
PRK04922433 tolB translocation protein TolB; Provisional 84.91
PRK13684334 Ycf48-like protein; Provisional 84.8
PTZ00421493 coronin; Provisional 84.55
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 84.41
PRK03629429 tolB translocation protein TolB; Provisional 84.25
PRK03629429 tolB translocation protein TolB; Provisional 82.25
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 81.75
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 81.45
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 81.37
PF09910339 DUF2139: Uncharacterized protein conserved in arch 81.24
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 80.84
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 80.67
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=7.9e-47  Score=362.14  Aligned_cols=339  Identities=27%  Similarity=0.515  Sum_probs=280.9

Q ss_pred             ccccccCCCCCCCcceEEEEEcCCCEEEEEcCCCCCC----CCcccEEEEEcCCCcEEEeee----------cCCCCCCC
Q 008089           20 VSSEISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDN----CQTNQVHVFDTVNQTWSQPVI----------KGSPPTPR   85 (578)
Q Consensus        20 ~~~~~~g~~P~~R~ghs~v~v~~g~~Iyv~GG~~~~~----~~~~~v~~yD~~t~~W~~l~~----------~g~~P~~R   85 (578)
                      |..++. ++| +|++|+++++  |..||.|||+....    ...-|++++|..+..|.+++.          .+..|..|
T Consensus         4 WTVHLe-GGP-rRVNHAavaV--G~riYSFGGYCsGedy~~~~piDVH~lNa~~~RWtk~pp~~~ka~i~~~yp~VPyqR   79 (392)
T KOG4693|consen    4 WTVHLE-GGP-RRVNHAAVAV--GSRIYSFGGYCSGEDYDAKDPIDVHVLNAENYRWTKMPPGITKATIESPYPAVPYQR   79 (392)
T ss_pred             EEEEec-CCc-ccccceeeee--cceEEecCCcccccccccCCcceeEEeeccceeEEecCcccccccccCCCCccchhh
Confidence            334443 345 8999999999  77999999984322    245689999999999998763          11246679


Q ss_pred             cceeEEEECCEEEEEcccCC-CCCCCcEEEEECCCCeEEecccCCCCCCCCcccEEEEECCEEEEEccCCCCCCCCCcee
Q 008089           86 DSHSCTTVGENLYVFGGTDG-MNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVY  164 (578)
Q Consensus        86 ~~hs~~~~~~kIYv~GG~~~-~~~~~~v~~yD~~t~~W~~l~~~g~~P~~R~~hs~~~~~~~lyvfGG~~~~~~~~~~~~  164 (578)
                      ++|+.+.+++++||+||+++ .+.+|-+++||+.++.|.++++.|-+|.+|.+|++|++++.+|||||+.+.    ...+
T Consensus        80 YGHtvV~y~d~~yvWGGRND~egaCN~Ly~fDp~t~~W~~p~v~G~vPgaRDGHsAcV~gn~MyiFGGye~~----a~~F  155 (392)
T KOG4693|consen   80 YGHTVVEYQDKAYVWGGRNDDEGACNLLYEFDPETNVWKKPEVEGFVPGARDGHSACVWGNQMYIFGGYEED----AQRF  155 (392)
T ss_pred             cCceEEEEcceEEEEcCccCcccccceeeeeccccccccccceeeecCCccCCceeeEECcEEEEecChHHH----HHhh
Confidence            99999999999999999987 678899999999999999999999999999999999999999999998643    5578


Q ss_pred             eceEEEEEcCcceEEEeccCCCCCCCCCceeEEEeCCEEEEEecCCC--------CCcccCceEEEECCCCceEEecCCC
Q 008089          165 YNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDG--------HDYYLSDVHILDTDTLTWKELNTSG  236 (578)
Q Consensus       165 ~ndv~~yd~~t~~W~~~~~~g~~p~~R~~h~~~~~~~~lyV~GG~~~--------~~~~~~di~~yD~~t~~W~~v~~~g  236 (578)
                      .++++.+|..|.+|+.+.+.+.+|..|.+|+++++++.+|||||...        .+.+.+.|..+|+.++.|......+
T Consensus       156 S~d~h~ld~~TmtWr~~~Tkg~PprwRDFH~a~~~~~~MYiFGGR~D~~gpfHs~~e~Yc~~i~~ld~~T~aW~r~p~~~  235 (392)
T KOG4693|consen  156 SQDTHVLDFATMTWREMHTKGDPPRWRDFHTASVIDGMMYIFGGRSDESGPFHSIHEQYCDTIMALDLATGAWTRTPENT  235 (392)
T ss_pred             hccceeEeccceeeeehhccCCCchhhhhhhhhhccceEEEeccccccCCCccchhhhhcceeEEEeccccccccCCCCC
Confidence            99999999999999999999999999999999999999999999753        3457788999999999999998888


Q ss_pred             CCCCCCceeEEEEeCCEEEEEcCccCCCC-ccCcEEEEECCCCcEEEEEeCCCCCCCceeeeEeeeeccCCCEEEEEccc
Q 008089          237 MVLSPRAGHSTVAFGKNLFVFGGFTDSQN-LYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGC  315 (578)
Q Consensus       237 ~~p~~R~~hs~v~~~~~iyV~GG~~~~~~-~~~dv~~ydi~t~~W~~l~~~~~~P~~r~~~~~~~~~~~~~~~l~v~GG~  315 (578)
                      ..|..|..|++.+++++||+|||++...+ -++|+|+||+.+..|..|...+..|++|..+++++.    ++++|+|||.
T Consensus       236 ~~P~GRRSHS~fvYng~~Y~FGGYng~ln~HfndLy~FdP~t~~W~~I~~~Gk~P~aRRRqC~~v~----g~kv~LFGGT  311 (392)
T KOG4693|consen  236 MKPGGRRSHSTFVYNGKMYMFGGYNGTLNVHFNDLYCFDPKTSMWSVISVRGKYPSARRRQCSVVS----GGKVYLFGGT  311 (392)
T ss_pred             cCCCcccccceEEEcceEEEecccchhhhhhhcceeecccccchheeeeccCCCCCcccceeEEEE----CCEEEEecCC
Confidence            89999999999999999999999987544 489999999999999999999999999999887654    8999999998


Q ss_pred             cCCC------CccCcEEEEecccccceecccchhhHhhHh----hhhccccCCccccceEEecccC
Q 008089          316 NKSL------EALDDMYYLYTGLVNERKLEKLSLRKQLKL----KCQEQNFTPVHDRALVRIDTIS  371 (578)
Q Consensus       316 ~~~~------~~~~d~~~l~~~~~~~~~l~~ls~~k~lk~----~~~~~~~~p~~~~~~~~~~~~~  371 (578)
                      ....      ...+- ..-..++.+-+|+..|++.+.||.    ..+.+.+.....+.-+|++...
T Consensus       312 sP~~~~~~Spt~~~G-~~~~~~LiD~SDLHvLDF~PsLKTLa~~~Vl~~~ldqs~Lp~diR~el~~  376 (392)
T KOG4693|consen  312 SPLPCHPLSPTNYNG-MISPSGLIDLSDLHVLDFAPSLKTLAMQSVLMFELDQSELPADIRFELYC  376 (392)
T ss_pred             CCCCCCCCCccccCC-CCCcccccccccceeeecChhHHHHHHHHHHHHhhhhhhcchhhhhhhee
Confidence            6521      00000 001124556788999999999883    3445555555556666666543

>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query578
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 6e-05
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-04
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 6e-04
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 7e-04
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure 
Iteration: 1

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 100/244 (40%), Gaps = 29/244 (11%)
Query: 46  LYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDG 105
           L V GG+G      + V  +D   Q WS      S    R   +  ++ + +YV GG DG
Sbjct: 17  LLVVGGFGSQQSPIDVVEKYDPKTQEWS---FLPSITRKRRYVASVSLHDRIYVIGGYDG 73
Query: 106 MNPLRDLHILDTSSH---TWISPSVRGEGPEAREGHSAA-LVGKRLFIFGGC-GKSSNTN 160
            + L  +  LD ++     W S +        R G + A  +G  +++ GG  G   +T+
Sbjct: 74  RSRLSSVECLDYTADEDGVWYSVAPM----NVRRGLAGATTLGDMIYVSGGFDGSRRHTS 129
Query: 161 DEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVH 220
            E Y  ++           + +  G+  +AR+          I  +GG DG +  L+ V 
Sbjct: 130 MERYDPNI----------DQWSMLGDMQTAREGAGLVVASGVIYCLGGYDGLN-ILNSVE 178
Query: 221 ILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYD-DLYMIDVDSGL 279
             D  T  W  +     + + R+G        +++V GGF  + +L   + Y I  DS  
Sbjct: 179 KYDPHTGHWTNVTP---MATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDS-- 233
Query: 280 WTKV 283
           WT V
Sbjct: 234 WTTV 237
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query578
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-56
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-43
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 9e-21
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-12
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 5e-08
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 6e-41
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 6e-35
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-23
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-38
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-34
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-33
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-24
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-36
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-35
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-27
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-19
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-36
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-32
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-25
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-35
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-32
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-21
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-20
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-13
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-35
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-33
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-30
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-24
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-32
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-30
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 8e-21
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 3e-05
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 2e-04
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  201 bits (512), Expect = 1e-56
 Identities = 56/310 (18%), Positives = 89/310 (28%), Gaps = 35/310 (11%)

Query: 24  ISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIK---GS 80
           +    P  R     +    G  ++  GG   +  + N++              I+     
Sbjct: 380 LECECPINRKFGDVDVA--GNDVFYMGGS--NPYRVNEILQLSIHYDKIDMKNIEVSSSE 435

Query: 81  PPTPRDSHSCTTVGEN--LYVFGG-TDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREG 137
            P  R  H+ TT+  N  L + GG       L D  I D  +  W            R  
Sbjct: 436 VPVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDMKTREWSMI---KSLSHTRFR 492

Query: 138 HSAALVGK-RLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTC 196
           HSA  +    + I GG  +            + + N    ++K  T              
Sbjct: 493 HSACSLPDGNVLILGGVTEG---------PAMLLYNVTEEIFKDVTPKDEFFQNSLVSAG 543

Query: 197 SSW----KNKIIVIGGEDGHDYYLSDVHI----LDTDTLTWKELNTSGMVLSPRAGHSTV 248
             +    K  II+ GG            I     +  T     +      L  R G    
Sbjct: 544 LEFDPVSKQGIILGGGFMDQTTVSDKAIIFKYDAENATEPITVIKKLQHPLFQRYGSQIK 603

Query: 249 AFGKN-LFVFGGFTDSQNL--YDDLYMIDVDSGLWTKV-ITTGEGPSARFSVAGDCLDPL 304
                 L + GG + S      + +  +D  S   T + I+          +AG  L   
Sbjct: 604 YITPRKLLIVGGTSPSGLFDRTNSIISLDPLSETLTSIPISRRIWEDHSLMLAGFSLVST 663

Query: 305 KGGVLVFIGG 314
             G +  IGG
Sbjct: 664 SMGTIHIIGG 673
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A Length = 376 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query578
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.97
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.93
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.91
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.79
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.67
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.63
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.46
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.33
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.28
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.26
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.17
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.16
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.14
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.06
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.03
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.01
3jrp_A379 Fusion protein of protein transport protein SEC13 96.81
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.6
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.5
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.5
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.48
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.38
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.34
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.33
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.32
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.29
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.21
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.19
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.17
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.11
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.1
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.09
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.09
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.99
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.97
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.96
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.89
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.88
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.79
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.76
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.73
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.61
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.61
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.53
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.53
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.45
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.19
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.18
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.11
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.06
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.03
3v9f_A781 Two-component system sensor histidine kinase/RESP 94.98
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.95
3jro_A 753 Fusion protein of protein transport protein SEC13 94.75
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.74
3ow8_A321 WD repeat-containing protein 61; structural genomi 94.73
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.65
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.63
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 94.59
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.56
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.56
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 94.51
3jrp_A379 Fusion protein of protein transport protein SEC13 94.49
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.41
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.37
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 94.37
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 94.36
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 94.34
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.22
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.11
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.08
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 94.05
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.86
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 93.84
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 93.79
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 93.78
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.76
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 93.72
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 93.61
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 93.45
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 93.43
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 93.41
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 93.37
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 93.36
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.34
4g56_B357 MGC81050 protein; protein arginine methyltransfera 93.31
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 93.29
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 93.26
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 93.19
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 93.17
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 93.14
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 93.05
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.03
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 93.02
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 92.99
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 92.92
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 92.9
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 92.88
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 92.81
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 92.68
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 92.68
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 92.67
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 92.57
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 92.46
4e54_B435 DNA damage-binding protein 2; beta barrel, double 92.3
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 92.11
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 92.07
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 92.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.98
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 91.89
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 91.88
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 91.76
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 91.76
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 91.66
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 91.66
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 91.47
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 91.4
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 91.38
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 91.36
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 91.25
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 91.16
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 91.07
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 91.05
3ott_A758 Two-component system sensor histidine kinase; beta 90.84
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 90.84
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 90.77
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 90.75
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 90.71
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 90.67
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 90.61
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 90.59
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 90.06
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 90.05
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 89.94
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 89.88
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 89.86
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 89.85
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 89.84
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 89.69
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 89.46
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 89.36
1itv_A195 MMP9; adaptive molecular recognition, beta propell 89.31
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 89.27
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 89.26
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 89.05
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 89.04
3ott_A 758 Two-component system sensor histidine kinase; beta 88.99
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 88.99
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 88.89
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 88.63
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 88.43
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 88.42
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 88.31
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 88.3
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 88.3
3jro_A 753 Fusion protein of protein transport protein SEC13 88.25
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 88.21
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 88.02
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 87.88
2ymu_A577 WD-40 repeat protein; unknown function, two domain 87.62
2pm7_B297 Protein transport protein SEC13, protein transport 87.46
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 87.4
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 87.31
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 87.17
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 86.97
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 86.92
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 86.88
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 86.84
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 86.78
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 86.71
4e54_B435 DNA damage-binding protein 2; beta barrel, double 86.63
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 86.37
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 86.14
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 86.1
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 85.98
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 85.76
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 85.69
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 85.62
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 85.5
2xyi_A430 Probable histone-binding protein CAF1; transcripti 85.38
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 85.3
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 85.19
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 85.03
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 85.02
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 84.72
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 84.48
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 84.43
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 84.37
1itv_A195 MMP9; adaptive molecular recognition, beta propell 83.85
2pm7_B297 Protein transport protein SEC13, protein transport 83.56
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 83.5
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 83.41
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 83.32
3ju4_A670 Endo-N-acetylneuraminidase; endonf, polysia, high- 82.84
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 82.62
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 81.13
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 81.04
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 80.92
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 80.83
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 80.34
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 80.21
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=4.2e-42  Score=353.13  Aligned_cols=283  Identities=18%  Similarity=0.316  Sum_probs=237.8

Q ss_pred             CCCCCCCcceEEEEEcCCCEEEEEcCCCCCCCCcccEEEEEcCCCcEEEeeecCCCCCCCcceeEEEECCEEEEEccc--
Q 008089           26 SSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGT--  103 (578)
Q Consensus        26 g~~P~~R~ghs~v~v~~g~~Iyv~GG~~~~~~~~~~v~~yD~~t~~W~~l~~~g~~P~~R~~hs~~~~~~kIYv~GG~--  103 (578)
                      +..|.+|..|+++.+  +++||+|||.  .....+++++||+.+++|..+.   ++|.+|.+|+++.++++|||+||.  
T Consensus         9 ~~~~~~~~~~~~~~~--~~~i~v~GG~--~~~~~~~~~~~d~~~~~W~~~~---~~p~~r~~~~~~~~~~~lyv~GG~~~   81 (308)
T 1zgk_A            9 HSSGLVPRGSHAPKV--GRLIYTAGGY--FRQSLSYLEAYNPSNGTWLRLA---DLQVPRSGLAGCVVGGLLYAVGGRNN   81 (308)
T ss_dssp             ------------CCC--CCCEEEECCB--SSSBCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCEEE
T ss_pred             ccCCeeeCCccccCC--CCEEEEEeCc--CCCCcceEEEEcCCCCeEeECC---CCCcccccceEEEECCEEEEECCCcC
Confidence            456789999999988  5579999998  2346789999999999999964   889999999999999999999998  


Q ss_pred             --CCCCCCCcEEEEECCCCeEEecccCCCCCCCCcccEEEEECCEEEEEccCCCCCCCCCceeeceEEEEEcCcceEEEe
Q 008089          104 --DGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRA  181 (578)
Q Consensus       104 --~~~~~~~~v~~yD~~t~~W~~l~~~g~~P~~R~~hs~~~~~~~lyvfGG~~~~~~~~~~~~~ndv~~yd~~t~~W~~~  181 (578)
                        ++...++++++||+.+++|++++   ++|.+|.+|+++.++++|||+||..      .....+++++||+.+++|+.+
T Consensus        82 ~~~~~~~~~~~~~~d~~~~~W~~~~---~~p~~r~~~~~~~~~~~iyv~GG~~------~~~~~~~~~~yd~~~~~W~~~  152 (308)
T 1zgk_A           82 SPDGNTDSSALDCYNPMTNQWSPCA---PMSVPRNRIGVGVIDGHIYAVGGSH------GCIHHNSVERYEPERDEWHLV  152 (308)
T ss_dssp             ETTEEEECCCEEEEETTTTEEEECC---CCSSCCBTCEEEEETTEEEEECCEE------TTEECCCEEEEETTTTEEEEC
T ss_pred             CCCCCeecceEEEECCCCCeEeECC---CCCcCccccEEEEECCEEEEEcCCC------CCcccccEEEECCCCCeEeEC
Confidence              55567899999999999999876   6899999999999999999999964      234678999999999999998


Q ss_pred             ccCCCCCCCCCceeEEEeCCEEEEEecCCCCCcccCceEEEECCCCceEEecCCCCCCCCCceeEEEEeCCEEEEEcCcc
Q 008089          182 TTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFT  261 (578)
Q Consensus       182 ~~~g~~p~~R~~h~~~~~~~~lyV~GG~~~~~~~~~di~~yD~~t~~W~~v~~~g~~p~~R~~hs~v~~~~~iyV~GG~~  261 (578)
                      .   .+|.+|..|++++++++|||+||.+... .++++++||+.+++|+.+..   +|.+|.+|+++.++++|||+||..
T Consensus       153 ~---~~p~~r~~~~~~~~~~~iyv~GG~~~~~-~~~~~~~yd~~~~~W~~~~~---~p~~r~~~~~~~~~~~iyv~GG~~  225 (308)
T 1zgk_A          153 A---PMLTRRIGVGVAVLNRLLYAVGGFDGTN-RLNSAECYYPERNEWRMITA---MNTIRSGAGVCVLHNCIYAAGGYD  225 (308)
T ss_dssp             C---CCSSCCBSCEEEEETTEEEEECCBCSSC-BCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBC
T ss_pred             C---CCCccccceEEEEECCEEEEEeCCCCCC-cCceEEEEeCCCCeEeeCCC---CCCccccceEEEECCEEEEEeCCC
Confidence            7   5788999999999999999999987665 48999999999999999976   889999999999999999999987


Q ss_pred             CCCCccCcEEEEECCCCcEEEEEeCCCCCCCceeeeEeeeeccCCCEEEEEccccCCCCccCcEEEEecccccceeccc
Q 008089          262 DSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEK  340 (578)
Q Consensus       262 ~~~~~~~dv~~ydi~t~~W~~l~~~~~~P~~r~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~d~~~l~~~~~~~~~l~~  340 (578)
                      .. ..++++++||+++++|+.+..   .|.+|..++++.+    +++|||+||.+.. ..++++|.|+.....|..+..
T Consensus       226 ~~-~~~~~v~~yd~~~~~W~~~~~---~p~~r~~~~~~~~----~~~i~v~GG~~~~-~~~~~v~~yd~~~~~W~~~~~  295 (308)
T 1zgk_A          226 GQ-DQLNSVERYDVETETWTFVAP---MKHRRSALGITVH----QGRIYVLGGYDGH-TFLDSVECYDPDTDTWSEVTR  295 (308)
T ss_dssp             SS-SBCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEE----TTEEEEECCBCSS-CBCCEEEEEETTTTEEEEEEE
T ss_pred             CC-CccceEEEEeCCCCcEEECCC---CCCCccceEEEEE----CCEEEEEcCcCCC-cccceEEEEcCCCCEEeecCC
Confidence            53 458999999999999999864   5778888876654    7899999998753 567899999999888877644
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 578
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-15
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-05
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-05
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 6e-05
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 75.3 bits (183), Expect = 1e-15
 Identities = 43/285 (15%), Positives = 76/285 (26%), Gaps = 28/285 (9%)

Query: 43  GRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGG 102
           GR +Y  GGY       + +  ++  N TW +         PR   +   VG  LY  GG
Sbjct: 4   GRLIYTAGGY--FRQSLSYLEAYNPSNGTWLR---LADLQVPRSGLAGCVVGGLLYAVGG 58

Query: 103 T-DGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTND 161
             +  +   D   LD  +      S        R      ++   ++  GG     + N 
Sbjct: 59  RNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNS 118

Query: 162 EVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHI 221
              Y                       + R     +     +  +GG D     L+    
Sbjct: 119 VERYE---------PERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFD-GTNRLNSAEC 168

Query: 222 LDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWT 281
              +   W+ +         R+G         ++  GG+     L               
Sbjct: 169 YYPERNEWRMITAMNT---IRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE----TE 221

Query: 282 KVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMY 326
                      R ++          G +  +GG +     LD + 
Sbjct: 222 TWTFVAPMKHRRSALGITVHQ----GRIYVLGGYDGH-TFLDSVE 261
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query578
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.9
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.63
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.91
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.9
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.34
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.12
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.99
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.84
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 93.35
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.33
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 93.32
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 92.39
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 92.21
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 91.83
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 91.76
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 91.71
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 91.52
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 90.93
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 90.91
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 90.29
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 90.14
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 89.67
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.42
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 88.77
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 88.52
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 88.35
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 88.12
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 87.28
d1tbga_340 beta1-subunit of the signal-transducing G protein 86.59
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 85.12
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 85.11
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 85.07
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 84.17
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 83.64
d1tbga_340 beta1-subunit of the signal-transducing G protein 83.47
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 82.8
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 81.71
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.1e-35  Score=294.17  Aligned_cols=269  Identities=18%  Similarity=0.329  Sum_probs=232.9

Q ss_pred             CCEEEEEcCCCCCCCCcccEEEEEcCCCcEEEeeecCCCCCCCcceeEEEECCEEEEEcccCC----CCCCCcEEEEECC
Q 008089           43 GRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDG----MNPLRDLHILDTS  118 (578)
Q Consensus        43 g~~Iyv~GG~~~~~~~~~~v~~yD~~t~~W~~l~~~g~~P~~R~~hs~~~~~~kIYv~GG~~~----~~~~~~v~~yD~~  118 (578)
                      ++.||||||+..  ...+++++||+.+++|+++.   ++|.+|.+|++++++++|||+||...    ...++++|+||+.
T Consensus         4 g~~iyv~GG~~~--~~~~~~~~yd~~t~~W~~~~---~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~   78 (288)
T d1zgka1           4 GRLIYTAGGYFR--QSLSYLEAYNPSNGTWLRLA---DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPM   78 (288)
T ss_dssp             CCCEEEECCBSS--SBCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETT
T ss_pred             CCEEEEECCcCC--CCCceEEEEECCCCeEEECC---CCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccc
Confidence            567999999965  36789999999999999964   78999999999999999999999743    3457899999999


Q ss_pred             CCeEEecccCCCCCCCCcccEEEEECCEEEEEccCCCCCCCCCceeeceEEEEEcCcceEEEeccCCCCCCCCCceeEEE
Q 008089          119 SHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSS  198 (578)
Q Consensus       119 t~~W~~l~~~g~~P~~R~~hs~~~~~~~lyvfGG~~~~~~~~~~~~~ndv~~yd~~t~~W~~~~~~g~~p~~R~~h~~~~  198 (578)
                      +++|+.+.   ++|.+|.+|+++++++++|++||..      .....+++++||+.+..|....   ..+.+|..|++++
T Consensus        79 ~~~w~~~~---~~p~~r~~~~~~~~~~~i~~~gg~~------~~~~~~~~~~~~~~~~~~~~~~---~~~~~r~~~~~~~  146 (288)
T d1zgka1          79 TNQWSPCA---PMSVPRNRIGVGVIDGHIYAVGGSH------GCIHHNSVERYEPERDEWHLVA---PMLTRRIGVGVAV  146 (288)
T ss_dssp             TTEEEECC---CCSSCCBTCEEEEETTEEEEECCEE------TTEECCCEEEEETTTTEEEECC---CCSSCCBSCEEEE
T ss_pred             cccccccc---cccceecceeccccceeeEEeccee------cccccceeeeeccccCcccccc---ccccccccceeee
Confidence            99999875   7899999999999999999999953      4456788999999999998876   5678899999999


Q ss_pred             eCCEEEEEecCCCCCcccCceEEEECCCCceEEecCCCCCCCCCceeEEEEeCCEEEEEcCccCCCCccCcEEEEECCCC
Q 008089          199 WKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSG  278 (578)
Q Consensus       199 ~~~~lyV~GG~~~~~~~~~di~~yD~~t~~W~~v~~~g~~p~~R~~hs~v~~~~~iyV~GG~~~~~~~~~dv~~ydi~t~  278 (578)
                      +++++|++||..... ..++++.||+.+++|.....   .+.++..|+++.++++|+++||... ...++++++||+.++
T Consensus       147 ~~~~~~~~GG~~~~~-~~~~~~~~d~~~~~~~~~~~---~~~~~~~~~~~~~~~~i~i~GG~~~-~~~~~~~~~~~~~~~  221 (288)
T d1zgka1         147 LNRLLYAVGGFDGTN-RLNSAECYYPERNEWRMITA---MNTIRSGAGVCVLHNCIYAAGGYDG-QDQLNSVERYDVETE  221 (288)
T ss_dssp             ETTEEEEECCBCSSC-BCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBCS-SSBCCCEEEEETTTT
T ss_pred             eeecceEecCccccc-ccceEEEeeccccccccccc---cccccccccccceeeeEEEecCccc-cccccceeeeeecce
Confidence            999999999987654 67889999999999998876   7788999999999999999999865 356789999999999


Q ss_pred             cEEEEEeCCCCCCCceeeeEeeeeccCCCEEEEEccccCCCCccCcEEEEecccccceecccc
Q 008089          279 LWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKL  341 (578)
Q Consensus       279 ~W~~l~~~~~~P~~r~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~d~~~l~~~~~~~~~l~~l  341 (578)
                      +|..+..   .|.+|..++++.+    +++|||+||.+.. ..++++|.|+.....|..+..+
T Consensus       222 ~~~~~~~---~p~~r~~~~~~~~----~~~l~v~GG~~~~-~~~~~v~~yd~~~~~W~~~~~~  276 (288)
T d1zgka1         222 TWTFVAP---MKHRRSALGITVH----QGRIYVLGGYDGH-TFLDSVECYDPDTDTWSEVTRM  276 (288)
T ss_dssp             EEEECCC---CSSCCBSCEEEEE----TTEEEEECCBCSS-CBCCEEEEEETTTTEEEEEEEC
T ss_pred             eeecccC---ccCcccceEEEEE----CCEEEEEecCCCC-eecceEEEEECCCCEEEECCCC
Confidence            9998754   5778888876544    7899999998654 6788999999998888777543
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure