Citrus Sinensis ID: 008149
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 576 | ||||||
| 225432124 | 712 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.977 | 0.790 | 0.564 | 0.0 | |
| 341868935 | 710 | domain rearranged methyltransferase [Vit | 0.973 | 0.790 | 0.561 | 0.0 | |
| 449441506 | 724 | PREDICTED: uncharacterized protein LOC10 | 0.963 | 0.766 | 0.547 | 1e-175 | |
| 449528407 | 644 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.963 | 0.861 | 0.547 | 1e-174 | |
| 224112050 | 609 | DNA methyltransferase [Populus trichocar | 0.916 | 0.866 | 0.536 | 1e-172 | |
| 255556520 | 678 | conserved hypothetical protein [Ricinus | 0.916 | 0.778 | 0.536 | 1e-166 | |
| 147779004 | 1960 | hypothetical protein VITISV_038412 [Viti | 0.847 | 0.248 | 0.568 | 1e-165 | |
| 356564666 | 729 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.967 | 0.764 | 0.516 | 1e-162 | |
| 356519874 | 702 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.965 | 0.792 | 0.519 | 1e-161 | |
| 357479111 | 1032 | DNA (cytosine-5)-methyltransferase DRM2 | 0.960 | 0.535 | 0.507 | 1e-155 |
| >gi|225432124|ref|XP_002264226.1| PREDICTED: DNA (cytosine-5)-methyltransferase DRM2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 668 bits (1723), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 337/597 (56%), Positives = 429/597 (71%), Gaps = 34/597 (5%)
Query: 3 QPKEEPNVMDEGLHIEKRASLLMMNFSVNEVDFALDKLGKDAPVYELVDFITAAQISENF 62
PKEEP+V G++ +KRA+L+MM FSV+EV+FA+DKLG+ APV ELVDFI AAQI+ +
Sbjct: 125 HPKEEPDV-SSGVNDDKRATLVMMKFSVDEVEFAMDKLGEGAPVNELVDFIIAAQIAGSS 183
Query: 63 EKETDDAPHDNDGTNEDKSDETLYGTMEITLQLLEMGFSENQVSLAIEKFGSKTPISELA 122
+ + DD + N+ ED ++E L+GTM+ TL+LLEMGFSEN++S AIEKFGS+ PISELA
Sbjct: 184 KMDADDPTYGNEERKEDCNNEALFGTMDKTLRLLEMGFSENEISSAIEKFGSEVPISELA 243
Query: 123 DKIFSGQIFLDTPRSRSYDTVKVKTEYCSPDVVSQSRKMNTSETSRGKRPKEEYFDDFS- 181
D IF+GQI S + T ++ + D S + M R +++S
Sbjct: 244 DSIFAGQIAEKDKHSSA--TFRLNHSHTGNDYRSFGKGMEDGLKRRSSGTFMVKTEEYSP 301
Query: 182 NSTSQFQHVDFQENRKGKRPKQESLDDSSSFLDSSWEE---------------------K 220
+ SQ + VD ++ KGKRPKQESLDDSS+++ +W E +
Sbjct: 302 EAVSQLRAVDIGDDHKGKRPKQESLDDSSAYIGPTWLEGRKGDHKFSSCRMPLPRRDLNQ 361
Query: 221 VKPNSSRYGMQQAFNSNPCRSINKVVAQPPYFFYGNVVDVSIDCWVKMSHFLYSLEPEFV 280
V +++GM PC+S++++VA+PPYFFYGNV +VS D W K+S FLY+LEPEFV
Sbjct: 362 VAGQLNKFGMSSISKPMPCKSLDQLVAKPPYFFYGNVTNVSHDSWNKISQFLYALEPEFV 421
Query: 281 NSQYFSALSRREGYLHNLPTTNRFHIPPEPPMTIQDAIPHTKKWWPSWDTRKHLSCINSG 340
N+Q+FSAL+R+EGY+HNLP+ NRFHI P+PPMTI++ IP+TKKWWPSWDTRK LSCI+S
Sbjct: 422 NTQFFSALNRKEGYIHNLPSENRFHILPKPPMTIEEVIPYTKKWWPSWDTRKQLSCISSE 481
Query: 341 TSGISQLCERFEKLLRDSRGVLSSQQQRDILHRSEKLNLVWVGAYKLGPVDPEHIELILG 400
TSGISQLC+R K+L DSRG+LS +QQRDILH LNLVWVG KL P++PEH+E ILG
Sbjct: 482 TSGISQLCDRLGKILVDSRGLLSFEQQRDILHHCRTLNLVWVGQCKLSPIEPEHLERILG 541
Query: 401 YPSNHTQAAGNSLTARLESLRHCFQTDTLGYHLSVLKSMFPGGLTMLSVFSGIGGAEVTL 460
YP NHT+ SL RL+SLRHCFQ DTLGYHLSVLKSMFP GLTMLS+FSGIGGAE+TL
Sbjct: 542 YPLNHTRVPEYSLIERLQSLRHCFQIDTLGYHLSVLKSMFPKGLTMLSLFSGIGGAELTL 601
Query: 461 HRLGIKLKGVISIETSETNRRILKRWWESSGQTGELVQIEDIQALTTKKFESLIHKLGSI 520
H+LGI LKGV+S+E SET R ILK+WW ++GQTGELVQI+DIQ L + K ESLI K G
Sbjct: 602 HQLGIHLKGVVSVEISETKRNILKKWWHNTGQTGELVQIDDIQKLASSKLESLIEKFGGF 661
Query: 521 DFVICQNSVPQIPNSKQISNSKDPKMAAESDNLPDFDFSLYYEFVRVVQRVRS-MKR 576
DFVICQN +S++ KM A+ D+L FDFSL+ EFVRV+ RVRS M+R
Sbjct: 662 DFVICQNPC--------TYSSRNSKMVADGDSLTGFDFSLFCEFVRVLHRVRSTMER 710
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|341868935|gb|AEK98591.1| domain rearranged methyltransferase [Vitis amurensis] | Back alignment and taxonomy information |
|---|
| >gi|449441506|ref|XP_004138523.1| PREDICTED: uncharacterized protein LOC101206985 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449528407|ref|XP_004171196.1| PREDICTED: DNA (cytosine-5)-methyltransferase DRM2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224112050|ref|XP_002316067.1| DNA methyltransferase [Populus trichocarpa] gi|222865107|gb|EEF02238.1| DNA methyltransferase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255556520|ref|XP_002519294.1| conserved hypothetical protein [Ricinus communis] gi|223541609|gb|EEF43158.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147779004|emb|CAN75753.1| hypothetical protein VITISV_038412 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356564666|ref|XP_003550572.1| PREDICTED: DNA (cytosine-5)-methyltransferase DRM1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356519874|ref|XP_003528594.1| PREDICTED: DNA (cytosine-5)-methyltransferase DRM1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357479111|ref|XP_003609841.1| DNA (cytosine-5)-methyltransferase DRM2 [Medicago truncatula] gi|355510896|gb|AES92038.1| DNA (cytosine-5)-methyltransferase DRM2 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 576 | ||||||
| TAIR|locus:2089075 | 710 | DRM3 "domains rearranged methy | 0.678 | 0.550 | 0.478 | 1.2e-123 | |
| TAIR|locus:2222627 | 626 | DRM2 "domains rearranged methy | 0.565 | 0.520 | 0.430 | 1.2e-79 | |
| TAIR|locus:2150991 | 624 | DRM1 "domains rearranged methy | 0.562 | 0.519 | 0.4 | 9.7e-74 |
| TAIR|locus:2089075 DRM3 "domains rearranged methyltransferase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 965 (344.8 bits), Expect = 1.2e-123, Sum P(2) = 1.2e-123
Identities = 200/418 (47%), Positives = 267/418 (63%)
Query: 162 NTSETSRGKRPKEEYFDDFSNSTSQFQHVDFQENRKGKRPKQEXXXXXXXXXXXXW-EEK 220
N ETSRGKRPK+E D+ N+ + ++ + + +GKR + E W +++
Sbjct: 314 NVGETSRGKRPKDE--DE--NAYPE-EYTGYDD--RGKRLRPEDMGDSSSFMETPWMQDE 366
Query: 221 VKPNSSRYGMQQAFNSNPCRSINKVVAQPPYFFYGNVVDVSIDCWVKMSHFLYSLEPEFV 280
K N+ Y +S+ VA+ PYFFYG + ++S W K+S FL+ + PE V
Sbjct: 367 WKDNT--YEFPSVMQPRLSQSLGPKVARRPYFFYGQLGELSPSWWSKISGFLFGIHPEHV 424
Query: 281 NSQYFSALSRREGYLHNLPTTNRFHIPPEPPMTIQDAIPHTKKWWPSWDTRKHLSCINSG 340
+++ SAL R EGYLHNLPT NRF+ P P +TIQDA+PH + WWP WD RKH NSG
Sbjct: 425 DTRLCSALRRTEGYLHNLPTVNRFNTLPNPRLTIQDAMPHMRSWWPQWDIRKHF---NSG 481
Query: 341 T-SGISQ---LCERFEKLLRDSRGVLSSQQQRDILHRSEKLNLVWVGAYKLGPVDPEHIE 396
T S + LCER + + + +G + Q Q IL NL+W+ L P++PEH+E
Sbjct: 482 TCSNMKDATLLCERIGRRIAECKGKPTQQDQTLILRHCHTSNLIWIAPNILSPLEPEHLE 541
Query: 397 LILGYPSNHTQAAGNSLTARLESLRHCFQTDTLGYHLSVLKSMFPGGLTMLSVFSGIGGA 456
I+GYP NHT G L RL+ +CFQTDTLGYHLSVLKSMFP GLT+LS+FSGIGGA
Sbjct: 542 CIMGYPMNHTNIGGGRLAERLKLFDYCFQTDTLGYHLSVLKSMFPQGLTVLSLFSGIGGA 601
Query: 457 EVTLHRLGIKLKGVISIETSETNRRILKRWWESSGQTGELVQIEDIQALTTKKFESLIHK 516
E+ L RLGI LKGV+S+E+ +R ILKRWW++SGQTGELVQIE+I++LT K+ E+L+ +
Sbjct: 602 EIALDRLGIHLKGVVSVESCGLSRNILKRWWQTSGQTGELVQIEEIKSLTAKRLETLMQR 661
Query: 517 LGSIDFVICQNSVPQIPNSKQISNSKDPKMAAESDNLPDFDFSLYYEFVRVVQRVRSM 574
G DFVICQN + SK+ISNS+ A E FD++L+ EF RV +RVR M
Sbjct: 662 FGGFDFVICQNPSTPLDLSKEISNSE----ACE------FDYTLFNEFARVTKRVRDM 709
|
|
| TAIR|locus:2222627 DRM2 "domains rearranged methyltransferase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2150991 DRM1 "domains rearranged methylase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00019681001 | SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (691 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 576 | |||
| COG0270 | 328 | Dcm Site-specific DNA methylase [DNA replication, | 99.91 | |
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 99.91 | |
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 99.88 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 99.86 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 99.86 | |
| KOG0919 | 338 | consensus C-5 cytosine-specific DNA methylase [Tra | 99.28 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 99.24 | |
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 98.61 | |
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 98.44 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 97.99 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 97.89 | |
| COG0270 | 328 | Dcm Site-specific DNA methylase [DNA replication, | 97.62 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 97.45 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 97.44 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 97.35 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 97.33 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 97.31 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 97.21 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 97.18 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 97.02 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 96.95 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 96.87 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 96.84 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 96.82 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 96.77 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 96.76 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 96.71 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 96.68 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 96.58 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 96.52 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 96.39 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 96.38 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 96.35 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 96.33 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 96.28 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 96.28 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 96.28 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 96.25 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 96.17 | |
| KOG0944 | 763 | consensus Ubiquitin-specific protease UBP14 [Postt | 96.17 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 96.15 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 96.14 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 96.13 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 96.07 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 96.02 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 95.89 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 95.88 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 95.79 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 95.77 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 95.74 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 95.73 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 95.68 | |
| KOG0919 | 338 | consensus C-5 cytosine-specific DNA methylase [Tra | 95.67 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 95.66 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 95.65 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 95.63 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 95.61 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 95.61 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 95.56 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 95.49 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 95.44 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 95.26 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 95.24 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 94.86 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 94.6 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 94.59 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 94.55 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 94.52 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 94.32 | |
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 94.32 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 94.3 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 94.23 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 94.22 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 94.2 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 94.15 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 94.13 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 94.13 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 94.12 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 94.1 | |
| KOG3420 | 185 | consensus Predicted RNA methylase [Translation, ri | 94.06 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 93.87 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 93.79 | |
| PF09288 | 55 | UBA_3: Fungal ubiquitin-associated domain ; InterP | 93.55 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 93.55 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 93.51 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 93.31 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 93.03 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 92.98 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 92.94 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 92.88 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 92.82 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 92.81 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 92.73 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 92.63 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 92.63 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 92.25 | |
| PF07499 | 47 | RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 | 92.21 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 92.14 | |
| KOG2730 | 263 | consensus Methylase [General function prediction o | 91.89 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 91.81 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 91.77 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 91.61 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 91.48 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 91.45 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 91.35 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 91.09 | |
| COG0116 | 381 | Predicted N6-adenine-specific DNA methylase [DNA r | 90.95 | |
| KOG1227 | 351 | consensus Putative methyltransferase [General func | 90.38 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 90.23 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 90.12 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 90.06 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 90.01 | |
| KOG2561 | 568 | consensus Adaptor protein NUB1, contains UBA domai | 89.98 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 89.82 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 89.69 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 89.59 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 89.3 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 89.25 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 89.2 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 88.8 | |
| PF07499 | 47 | RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 | 88.76 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 88.65 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 88.47 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 88.28 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 88.05 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 87.92 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 87.9 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 87.84 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 87.83 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 87.82 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 87.82 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 87.51 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 87.43 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 87.19 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 87.18 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 86.69 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 86.64 | |
| PF01555 | 231 | N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th | 86.23 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 86.04 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 85.27 | |
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 85.2 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 85.1 | |
| PF02086 | 260 | MethyltransfD12: D12 class N6 adenine-specific DNA | 84.93 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 84.77 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 84.59 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 83.6 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 83.14 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 83.08 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 83.05 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 82.9 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 82.87 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 82.56 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 82.45 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 81.89 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 81.54 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 81.47 | |
| KOG2561 | 568 | consensus Adaptor protein NUB1, contains UBA domai | 81.16 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 80.93 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 80.75 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 80.59 |
| >COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Probab=99.91 E-value=5.1e-25 Score=228.83 Aligned_cols=109 Identities=19% Similarity=0.343 Sum_probs=95.5
Q ss_pred CCCcccccCCCCChhHHHHHHcCCceeeEEEeeCCHHHHHHHHHHhhhcCCCCCccccccccccChhhHHHhhhccCCcc
Q 008149 442 GGLTMLSVFSGIGGAEVTLHRLGIKLKGVISIETSETNRRILKRWWESSGQTGELVQIEDIQALTTKKFESLIHKLGSID 521 (576)
Q Consensus 442 ~~l~VLsLFSGiGG~slGL~~aGi~~k~vvavEid~~a~~t~k~~~~~tn~~g~l~~~~DI~~lt~~~Ie~l~~~~g~~D 521 (576)
..++++||||||||+++||+++|| ++++++|||+.|++||++++. ...+...||.++..+.+... ++|
T Consensus 2 ~~~~~idLFsG~GG~~lGf~~agf--~~~~a~Eid~~a~~ty~~n~~-----~~~~~~~di~~~~~~~~~~~-----~~D 69 (328)
T COG0270 2 EKMKVIDLFAGIGGLSLGFEEAGF--EIVFANEIDPPAVATYKANFP-----HGDIILGDIKELDGEALRKS-----DVD 69 (328)
T ss_pred CCceEEeeccCCchHHHHHHhcCC--eEEEEEecCHHHHHHHHHhCC-----CCceeechHhhcChhhcccc-----CCC
Confidence 358999999999999999999997 679999999999999987653 24467799999998877532 799
Q ss_pred EEEecCCCCCccccCCCCCCCCccccccCCCCCCCCcchHHHHHHHHHHhhcc
Q 008149 522 FVICQNSVPQIPNSKQISNSKDPKMAAESDNLPDFDFSLYYEFVRVVQRVRSM 574 (576)
Q Consensus 522 LVIGGpPCQ~FS~agr~~~~~~~~~aG~R~Gl~D~Rs~Lf~EyvRIV~~vK~~ 574 (576)
+|+||||||+||.+ |+|.|++|+|++||++|+|+|+.++|.
T Consensus 70 vligGpPCQ~FS~a------------G~r~~~~D~R~~L~~~~~r~I~~~~P~ 110 (328)
T COG0270 70 VLIGGPPCQDFSIA------------GKRRGYDDPRGSLFLEFIRLIEQLRPK 110 (328)
T ss_pred EEEeCCCCcchhhc------------CcccCCcCccceeeHHHHHHHHhhCCC
Confidence 99999999999976 466789999999999999999999984
|
|
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >KOG0919 consensus C-5 cytosine-specific DNA methylase [Transcription] | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >KOG0919 consensus C-5 cytosine-specific DNA methylase [Transcription] | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >KOG2730 consensus Methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1227 consensus Putative methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 576 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-16 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 7e-10 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 6e-05 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 2e-05 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 4e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 82.2 bits (202), Expect = 2e-16
Identities = 102/695 (14%), Positives = 195/695 (28%), Gaps = 262/695 (37%)
Query: 26 MNFSVNEVDFA--------LDKLGKDAPVYELVDFITAAQISENFEKETDD---APHDND 74
M+F E + D + ++ D + +S ++E D +
Sbjct: 7 MDFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSI-LS---KEEIDHIIMSKDAVS 62
Query: 75 GTN------EDKSDETLYGTMEITLQ-----LLE-MGFSENQVSLAIEKFGSKTPISELA 122
GT K +E + +E L+ L+ + + Q S+ + E
Sbjct: 63 GTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMY------IEQR 116
Query: 123 DKIF-SGQIF--LDTPRSRSYDTVKV--------------------KT------------ 147
D+++ Q+F + R + Y ++ KT
Sbjct: 117 DRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKV 176
Query: 148 --------------EYCSPDVV--------SQSRKMNTSETSRGKRPKEEYFDDFSNSTS 185
SP+ V Q TS + K
Sbjct: 177 QCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLR-IHSIQAELR 235
Query: 186 QFQHVDFQENRKGKRPKQESLDDSSSFLDSSWEEKVKPNSSRYGMQQAFNSNPCRSI--- 242
+ +P + L L + K AFN + C+ +
Sbjct: 236 RLLK---------SKPYENCLLV----LLNVQNAKA---------WNAFNLS-CKILLTT 272
Query: 243 -NKVVAQPPYFFYGNVVDVSIDCWVKMSHFLYSLEPEFVNSQYFSALSRREGYLHNLPTT 301
K V + + + + + H +L P+ + S L + YL P
Sbjct: 273 RFKQVT--------DFLSAATTTHISLDHHSMTLTPD----EVKSLLLK---YLDCRPQD 317
Query: 302 NRFHIPPEP----PMTIQDAIPHTKKWWPS-WDTRKHLSCINSGTSGISQLCERFEKLLR 356
+P E P + I + + + WD KH++ C++ ++
Sbjct: 318 ----LPREVLTTNPRRL-SIIAESIRDGLATWDNWKHVN------------CDKLTTIIE 360
Query: 357 DSRGVLSSQQQRD------ILHRSEK-----LNLVWVGAYKLGPVDPEHIE-------LI 398
S VL + R + S L+L+W + + D + L+
Sbjct: 361 SSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIW---FDVIKSDVMVVVNKLHKYSLV 417
Query: 399 LGYPSNHT-----------------QAAGNSLTARLESLRHCFQTDT------------- 428
P T A S+ + F +D
Sbjct: 418 EKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPK-TFDSDDLIPPYLDQYFYSH 476
Query: 429 LGYHLSVLK-----SMFPGGLTMLSVFSGIGGAEVTLHRLGIKLKGVISIETSETNRRIL 483
+G+HL ++ ++F VF + L K+ R
Sbjct: 477 IGHHLKNIEHPERMTLFR------MVF-------LDFRFLEQKI------------RHDS 511
Query: 484 KRWWESSGQTGELVQIEDIQALTTK---KFESLIHKLGSIDFVICQNSVPQIPNSK---- 536
W S L Q++ + K+E L++ + +DF+ + SK
Sbjct: 512 TAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAI--LDFL--PKIEENLICSKYTDL 567
Query: 537 -QISNSKDPKMAAESDNLPDFDFSLYYEFVRVVQR 570
+I+ + AE + +++ E + VQR
Sbjct: 568 LRIA------LMAEDE-------AIFEEAHKQVQR 589
|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 576 | |||
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 99.93 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 99.92 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 99.9 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 99.9 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 99.89 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 99.88 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 99.88 | |
| 4ft4_B | 784 | DNA (cytosine-5)-methyltransferase 1; chromodomain | 99.87 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 99.87 | |
| 4dkj_A | 403 | Cytosine-specific methyltransferase; CG-specificit | 99.85 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 99.79 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 99.78 | |
| 2qrv_B | 230 | DNA (cytosine-5)-methyltransferase 3-like; DNA met | 99.77 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 99.73 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 99.57 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 99.48 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 99.41 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 99.17 | |
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 98.94 | |
| 4dkj_A | 403 | Cytosine-specific methyltransferase; CG-specificit | 98.92 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 98.83 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 98.83 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 98.73 | |
| 2qrv_B | 230 | DNA (cytosine-5)-methyltransferase 3-like; DNA met | 98.64 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 98.52 | |
| 4ft4_B | 784 | DNA (cytosine-5)-methyltransferase 1; chromodomain | 98.32 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 98.14 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 97.81 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 97.77 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 97.7 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 97.68 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 97.63 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 97.56 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 97.54 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 97.47 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 97.36 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 97.35 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 97.32 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 97.29 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 97.27 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 97.26 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 97.25 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 97.18 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 97.18 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 97.11 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 97.07 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 97.06 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 97.04 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 96.97 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 96.93 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 96.9 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 96.89 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 96.78 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 96.76 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 96.74 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 96.74 | |
| 1wgn_A | 63 | UBAP1, ubiquitin associated protein; ubiquitin ass | 96.73 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 96.71 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 96.7 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 96.69 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 96.66 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 96.63 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 96.62 | |
| 1whc_A | 64 | RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain | 96.6 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 96.6 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 96.6 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 96.6 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 96.6 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 96.56 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 96.53 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 96.53 | |
| 2cos_A | 54 | Serine/threonine protein kinase LATS2; UBA domain, | 96.52 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 96.48 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 96.45 | |
| 2ekk_A | 47 | UBA domain from E3 ubiquitin-protein ligase HUWE1; | 96.42 | |
| 2ekk_A | 47 | UBA domain from E3 ubiquitin-protein ligase HUWE1; | 96.4 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 96.4 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 96.4 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 96.38 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 96.36 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 96.29 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 96.28 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 96.27 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 96.27 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 96.27 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 96.25 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 96.24 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 96.23 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 96.22 | |
| 1wgn_A | 63 | UBAP1, ubiquitin associated protein; ubiquitin ass | 96.21 | |
| 1vek_A | 84 | UBP14, ubiquitin-specific protease 14, putative; U | 96.2 | |
| 2dag_A | 74 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 96.18 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 96.15 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 96.14 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 96.14 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 96.1 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 96.08 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 96.08 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 96.07 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 96.06 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 96.05 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 96.03 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 95.99 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 95.95 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 95.92 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 95.92 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 95.91 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 95.9 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 95.88 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 95.87 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 95.87 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 95.86 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 95.85 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 95.83 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 95.81 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 95.8 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 95.78 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 95.76 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 95.75 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 95.74 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 95.72 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 95.72 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 95.72 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 95.67 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 95.66 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 95.66 | |
| 1whc_A | 64 | RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain | 95.64 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 95.62 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 95.6 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 95.59 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 95.53 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 95.52 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 95.49 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 95.46 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 95.46 | |
| 2dag_A | 74 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 95.45 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 95.44 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 95.44 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 95.42 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 95.41 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 95.39 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 95.36 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 95.33 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 95.29 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 95.24 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 95.23 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 95.22 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 95.19 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 95.16 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 95.16 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 95.15 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 95.13 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 95.13 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 95.08 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 95.06 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 95.02 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 95.0 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 95.0 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 94.92 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 94.88 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 94.88 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 94.85 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 94.84 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 94.84 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 94.77 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 94.7 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 94.67 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 94.66 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 94.66 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 94.64 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 94.6 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 94.59 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 94.57 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 94.56 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 94.55 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 94.55 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 94.45 | |
| 2dkl_A | 85 | Trinucleotide repeat containing 6C protein; TNRC6C | 94.44 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 94.44 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 94.43 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 94.42 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 94.36 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 94.34 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 94.33 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 94.29 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 94.28 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 94.27 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 94.22 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 94.2 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 94.18 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 94.18 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 94.15 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 94.11 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 94.09 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 94.08 | |
| 2dkl_A | 85 | Trinucleotide repeat containing 6C protein; TNRC6C | 94.08 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 94.07 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 94.06 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 94.05 | |
| 2ooa_A | 52 | E3 ubiquitin-protein ligase CBL-B; alpha-helical d | 94.04 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 94.02 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 94.02 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 93.99 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 93.95 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 93.91 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 93.89 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 93.89 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 93.87 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 93.86 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 93.86 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 93.83 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 93.83 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 93.82 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 93.76 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 93.76 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 93.7 | |
| 2dah_A | 54 | Ubiquilin-3; UBA domain, structural genomics, NPPS | 93.63 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 93.61 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 93.61 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 93.57 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 93.56 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 93.48 | |
| 2ooa_A | 52 | E3 ubiquitin-protein ligase CBL-B; alpha-helical d | 93.48 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 93.46 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 93.45 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 93.4 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 93.4 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 93.39 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 93.37 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 93.35 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 93.33 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 93.33 | |
| 1vek_A | 84 | UBP14, ubiquitin-specific protease 14, putative; U | 93.3 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 93.28 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 93.25 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 93.22 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 93.21 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 93.15 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 93.12 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 93.12 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 93.05 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 93.01 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 92.96 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 92.96 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 92.93 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 92.89 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 92.89 | |
| 2d9s_A | 53 | CBL E3 ubiquitin protein ligase; UBA domain, dimer | 92.89 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 92.84 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 92.84 | |
| 2d9s_A | 53 | CBL E3 ubiquitin protein ligase; UBA domain, dimer | 92.81 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 92.77 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 92.63 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 92.59 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 92.55 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 92.54 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 92.44 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 92.35 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 92.33 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 92.26 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 92.2 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 92.16 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 92.13 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 92.09 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 92.07 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 92.07 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 92.04 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 92.03 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 92.01 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 91.97 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 91.79 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 91.78 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 91.73 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 91.64 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 91.59 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 91.54 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 91.49 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 91.48 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 91.43 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 91.42 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 91.33 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 91.27 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 91.21 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 91.17 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 91.09 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 90.99 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 90.87 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 90.82 | |
| 2cp8_A | 54 | NEXT to BRCA1 gene 1 protein; UBA domain, structur | 90.81 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 90.66 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 90.6 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 90.47 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 90.41 | |
| 2dah_A | 54 | Ubiquilin-3; UBA domain, structural genomics, NPPS | 90.26 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 90.14 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 90.11 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 90.1 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 89.66 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 89.65 | |
| 2cos_A | 54 | Serine/threonine protein kinase LATS2; UBA domain, | 89.45 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 89.44 | |
| 2oo9_A | 46 | E3 ubiquitin-protein ligase CBL; alpha-helical dom | 89.39 | |
| 2oo9_A | 46 | E3 ubiquitin-protein ligase CBL; alpha-helical dom | 89.27 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 89.26 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 89.25 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 89.24 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 89.21 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 89.14 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 89.12 | |
| 1ixs_A | 62 | Holliday junction DNA helicase RUVA; heterodimeric | 88.89 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 88.65 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 88.61 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 88.5 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 88.43 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 88.1 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 87.84 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 87.79 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 87.67 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 87.49 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 87.39 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 87.29 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 87.01 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 86.96 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 86.89 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 86.65 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 86.62 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 86.06 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 85.96 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 85.88 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 85.58 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 85.58 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 84.99 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 84.96 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 84.92 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 84.64 | |
| 3ufb_A | 530 | Type I restriction-modification system methyltran | 83.34 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 83.0 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 82.96 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 82.56 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 81.11 | |
| 1ixs_A | 62 | Holliday junction DNA helicase RUVA; heterodimeric | 81.01 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 80.95 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 80.43 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 80.23 |
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
Probab=99.93 E-value=7.5e-27 Score=236.52 Aligned_cols=105 Identities=17% Similarity=0.347 Sum_probs=93.2
Q ss_pred CcccccCCCCChhHHHHHHcCCceeeEEEeeCCHHHHHHHHHHhhhcCCCCCccccccccccChhhHHHhhhccCCccEE
Q 008149 444 LTMLSVFSGIGGAEVTLHRLGIKLKGVISIETSETNRRILKRWWESSGQTGELVQIEDIQALTTKKFESLIHKLGSIDFV 523 (576)
Q Consensus 444 l~VLsLFSGiGG~slGL~~aGi~~k~vvavEid~~a~~t~k~~~~~tn~~g~l~~~~DI~~lt~~~Ie~l~~~~g~~DLV 523 (576)
|+||||||||||+++||+++|| ++++|+|+|+.|++||+.+|. ..++.+||++++.+++ +++|||
T Consensus 1 mkvidLFsG~GG~~~G~~~aG~--~~v~a~e~d~~a~~ty~~N~~------~~~~~~DI~~i~~~~~-------~~~D~l 65 (331)
T 3ubt_Y 1 MNLISLFSGAGGLDLGFQKAGF--RIICANEYDKSIWKTYESNHS------AKLIKGDISKISSDEF-------PKCDGI 65 (331)
T ss_dssp CEEEEESCTTCHHHHHHHHTTC--EEEEEEECCTTTHHHHHHHCC------SEEEESCGGGCCGGGS-------CCCSEE
T ss_pred CeEEEeCcCccHHHHHHHHCCC--EEEEEEeCCHHHHHHHHHHCC------CCcccCChhhCCHhhC-------CcccEE
Confidence 6899999999999999999998 569999999999999998753 2356899999998765 579999
Q ss_pred EecCCCCCccccCCCCCCCCccccccCCCCCCCCcchHHHHHHHHHHhhccc
Q 008149 524 ICQNSVPQIPNSKQISNSKDPKMAAESDNLPDFDFSLYYEFVRVVQRVRSMK 575 (576)
Q Consensus 524 IGGpPCQ~FS~agr~~~~~~~~~aG~R~Gl~D~Rs~Lf~EyvRIV~~vK~~~ 575 (576)
+||||||+||.+ |+++|++|+|+.||++|+|+|+++||..
T Consensus 66 ~ggpPCQ~fS~a------------g~~~g~~d~R~~L~~~~~r~i~~~~Pk~ 105 (331)
T 3ubt_Y 66 IGGPPSQSWSEG------------GSLRGIDDPRGKLFYEYIRILKQKKPIF 105 (331)
T ss_dssp ECCCCGGGTEET------------TEECCTTCGGGHHHHHHHHHHHHHCCSE
T ss_pred EecCCCCCcCCC------------CCccCCCCchhHHHHHHHHHHhccCCeE
Confidence 999999999976 4567899999999999999999999853
|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
| >4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1ixs_A Holliday junction DNA helicase RUVA; heterodimeric protein complex, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.20A {Thermus thermophilus} SCOP: a.5.1.1 | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >1ixs_A Holliday junction DNA helicase RUVA; heterodimeric protein complex, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.20A {Thermus thermophilus} SCOP: a.5.1.1 | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 576 | ||||
| d1g55a_ | 343 | c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: | 7e-05 |
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: C5 cytosine-specific DNA methylase, DCM domain: DNMT2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 42.8 bits (99), Expect = 7e-05
Identities = 16/94 (17%), Positives = 37/94 (39%), Gaps = 10/94 (10%)
Query: 444 LTMLSVFSGIGGAEVTLHRLGIKLKGVISIETSETNRRILKRWWESSGQTGELVQIEDIQ 503
L +L ++SG+GG L I + V +I+ + + K + + + + I+
Sbjct: 3 LRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHT-----QLLAKTIE 57
Query: 504 ALTTKKFESLIHKLGSIDFVICQNSVPQIPNSKQ 537
+T ++F+ S D ++ +
Sbjct: 58 GITLEEFDR-----LSFDMILMSPPCQPFTRIGR 86
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 576 | |||
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 99.92 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 99.92 | |
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 99.09 | |
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 98.96 | |
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 98.9 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 98.1 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 98.04 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 97.97 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 97.92 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 97.91 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 97.82 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 97.8 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 97.79 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 97.75 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 97.66 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 97.51 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 97.46 | |
| d2crna1 | 51 | Suppressor of T-cell receptor signaling 2 (STS-2) | 96.89 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 96.87 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 96.84 | |
| d1whca_ | 64 | UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta | 96.71 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 96.68 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 96.67 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 96.59 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 96.53 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 96.51 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 96.5 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 96.47 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 96.43 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 96.35 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 96.31 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 96.26 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 96.24 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 96.18 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 96.17 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 96.16 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 95.96 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 95.91 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 95.87 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 95.68 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 95.6 | |
| d1veka_ | 84 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 95.53 | |
| d1whca_ | 64 | UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta | 95.53 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 95.37 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 95.35 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 95.3 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 95.22 | |
| d2crna1 | 51 | Suppressor of T-cell receptor signaling 2 (STS-2) | 95.1 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 94.81 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 94.81 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 94.76 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 94.68 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 94.67 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 94.59 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 94.48 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 94.43 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 93.85 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 93.82 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 93.34 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 93.2 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 92.47 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 92.46 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 92.29 | |
| d1ttea1 | 55 | Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc | 92.14 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 91.23 | |
| d2cosa1 | 41 | Serine/threonine protein kinase LATS2 {Mouse (Mus | 91.06 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 91.04 | |
| d1veka_ | 84 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 90.49 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 90.35 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 90.16 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 89.95 | |
| d1ej0a_ | 180 | RNA methyltransferase FtsJ {Escherichia coli [TaxI | 89.71 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 89.48 | |
| d1z96a1 | 38 | UBA-domain protein mud1 {Schizosaccharomyces pombe | 89.42 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 88.77 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 88.69 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 87.19 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 87.08 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 86.59 | |
| d1sqga2 | 284 | Ribosomal RNA small subunit methyltransferase B, R | 85.54 | |
| d1cuka1 | 48 | DNA helicase RuvA subunit, C-terminal domain {Esch | 85.09 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 85.04 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 84.93 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 84.82 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 84.71 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 84.49 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 84.31 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 84.23 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 83.9 | |
| d2ar0a1 | 524 | M.EcoKI {Escherichia coli [TaxId: 562]} | 83.56 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 82.74 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 82.58 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 82.47 | |
| d1z96a1 | 38 | UBA-domain protein mud1 {Schizosaccharomyces pombe | 82.08 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 81.64 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 80.71 |
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: C5 cytosine-specific DNA methylase, DCM domain: DNA methylase HaeIII species: Haemophilus aegyptius [TaxId: 197575]
Probab=99.92 E-value=6e-26 Score=222.73 Aligned_cols=105 Identities=17% Similarity=0.347 Sum_probs=92.4
Q ss_pred CcccccCCCCChhHHHHHHcCCceeeEEEeeCCHHHHHHHHHHhhhcCCCCCccccccccccChhhHHHhhhccCCccEE
Q 008149 444 LTMLSVFSGIGGAEVTLHRLGIKLKGVISIETSETNRRILKRWWESSGQTGELVQIEDIQALTTKKFESLIHKLGSIDFV 523 (576)
Q Consensus 444 l~VLsLFSGiGG~slGL~~aGi~~k~vvavEid~~a~~t~k~~~~~tn~~g~l~~~~DI~~lt~~~Ie~l~~~~g~~DLV 523 (576)
|+||||||||||+++||+++|| ++++++|+|+.|+++|+++|. . .+..+||++++.+++ +.+|||
T Consensus 1 mk~~~lF~G~Gg~~~gl~~aG~--~~~~a~e~d~~a~~~~~~N~~-----~-~~~~~Di~~~~~~~~-------~~~dll 65 (324)
T d1dcta_ 1 MNLISLFSGAGGLDLGFQKAGF--RIICANEYDKSIWKTYESNHS-----A-KLIKGDISKISSDEF-------PKCDGI 65 (324)
T ss_dssp CEEEEESCSSCHHHHHHHHHTC--EEEEEEECCHHHHHHHHHHCC-----S-EEEESCTTTSCGGGS-------CCCSEE
T ss_pred CeEEEeCcCcCHHHHHHHHCCC--EEEEEEeCCHHHHHHHHHHCC-----C-CCccCChhhCCHhHc-------ccccEE
Confidence 6899999999999999999998 569999999999999988653 2 256799999988765 579999
Q ss_pred EecCCCCCccccCCCCCCCCccccccCCCCCCCCcchHHHHHHHHHHhhccc
Q 008149 524 ICQNSVPQIPNSKQISNSKDPKMAAESDNLPDFDFSLYYEFVRVVQRVRSMK 575 (576)
Q Consensus 524 IGGpPCQ~FS~agr~~~~~~~~~aG~R~Gl~D~Rs~Lf~EyvRIV~~vK~~~ 575 (576)
+||||||+||.+| ++.|++|+|+.||++|+|+|+.+||..
T Consensus 66 ~~g~PCq~fS~ag------------~~~g~~d~r~~l~~~~~~~i~~~~Pk~ 105 (324)
T d1dcta_ 66 IGGPPCQSWSEGG------------SLRGIDDPRGKLFYEYIRILKQKKPIF 105 (324)
T ss_dssp EECCCCTTTSSSS------------CCCCSSSHHHHHHHHHHHHHHHHCCSE
T ss_pred eeccccccccccc------------ccccccccccchHHHHHHHHHhhCCce
Confidence 9999999999764 456889999999999999999999853
|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cuka1 a.5.1.1 (A:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|