Citrus Sinensis ID: 008346


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------57
MRTQTFRPFRRGTNLDSGFLQRGQRLASNGYNIMSTSLDNHINRIVDPRGPFWNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFDFFNIIYSSSTPHKHSRANAKKCFYLNSFLKDLLSCLPIPQLVTSIIIITSKGSGFFPAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKSACCILIYLLAAHVFGALWYFMAIERETECWKKACREHTECYQNSFHCYETVGNYTFLTGLCPTMIQDTTMFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTHEGENLLASFIIIASLLLLLLVLGNLTVPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLLTTTTNGGRNTSVFKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQYWQHRNHNMQPLDIFKFYSQEWRTSKACVIQAAWCRYKKRKLEGSLYAKENILQDQKAEAGGKPSKFGTAIYATQFFTYVRRSVKRNGGLPGGRVNITLAASETTRS
cccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccEEEEEcccccEEEEccccEEEHHHHHHHHHHHHHHHccccccccccccccHHHccccEEEEEccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHccccccccccccccccccccEEEEccccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHHcccEEEEcccEEEEccccccEEEEEEEcEEEEEEEcccEEcEEEEEEEcccccccHHHHHccccccccccccccccEEEEEEEEEEEEEcHHHHHHHHHHHHHHHHcccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc
ccccccHHHHHHccccccccccccccccccccEccHHccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEHHHHccccHEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHEEEccccccccEEEccccccccccccccccEEEHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcHHHHHHHHHHHHHHHcccccEEEEEcccHcEEEEEEEccEEEEcccccccccEEEEEcccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccccccc
mrtqtfrpfrrgtnldsgflQRGQrlasngynimstsldnhinrivdprgpfwNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFDFFNiiyssstphkhsranakkCFYLNSFLKDLlsclpipqlvTSIIIITskgsgffpAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKSACCILIYLLAAHVFGALWYFMAIERETECWKKACREHTecyqnsfhcyetvgnytfltglcptmiqdttmFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLqtvscagqnlqtsthEGENLLASFIIIASLLLLLLVLGNLTVPMFQMMGKSILSEMCKCLKPVLYVQECcivkegdpicEMFFITQGTllttttnggrntSVFKKYLStgdfwgeelatsaldpdplsniphsncalisVTNVEAFAINTDDLRAIVYQYWQhrnhnmqpldIFKFYSQEWRTSKACVIQAAWCRYKKRKLEGSLYAKENILqdqkaeaggkpskfgtaIYATQFFTYVRRSVkrngglpggrvnITLAASETTRS
mrtqtfrpfrrgtnldsgflqRGQRLASNGYNIMSTSLDNHINRIVDPRGPFWNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFDFFNIIYSsstphkhsraNAKKCFYLNSFLKDLLSCLPIPQLVTSIIIITSKGSGFFPAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKSACCILIYLLAAHVFGALWYFMAIERETECWKKACREHTECYQNSFHCYETVGNYTFLTGLCPTMIQDTTMFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTHEGENLLASFIIIASLLLLLLVLGNLTVPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLlttttnggrntSVFKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQYWQHRNHNMQPLDIFKFYSQEWRTSKACVIQAAWCRYKKRKLEGSLYAKENILQDqkaeaggkpskfGTAIYATQFFTYVRRSvkrngglpggrvnitlaasettrs
MRTQTFRPFRRGTNLDSGFLQRGQRLASNGYNIMSTSLDNHINRIVDPRGPFWNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFDFFNIIYSSSTPHKHSRANAKKCFYLNSFLKDLLSCLPIPQLVtsiiiitsKGSGFFPAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKSACCILIYLLAAHVFGALWYFMAIERETECWKKACREHTECYQNSFHCYETVGNYTFLTGLCPTMIQDTTMFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTHEGENllasfiiiasllllllvlGNLTVPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFItqgtllttttnggrntSVFKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQYWQHRNHNMQPLDIFKFYSQEWRTSKACVIQAAWCRYKKRKLEGSLYAKENILQDQKAEAGGKPSKFGTAIYATQFFTYVRRSVKRNGGLPGGRVNITLAASETTRS
*******************L***QRLASNGYNIMSTSLDNHINRIVDPRGPFWNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFDFFNIIYSSS******RANAKKCFYLNSFLKDLLSCLPIPQLVTSIIIITSKGSGFFPAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKSACCILIYLLAAHVFGALWYFMAIERETECWKKACREHTECYQNSFHCYETVGNYTFLTGLCPTMIQDTTMFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTHEGENLLASFIIIASLLLLLLVLGNLTVPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLLTTTTNGGRNTSVFKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQYWQHRNHNMQPLDIFKFYSQEWRTSKACVIQAAWCRYKKRKLEGSLYAKENIL************KFGTAIYATQFFTYVRRSVKRNGGLPGGRVNI**********
****************************************H*NRIVDPRGPFWNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFDFFNIIYSSSTPHKHSRANAKKCFYLNSFLKDLLSCLPIPQLVTSIIIITSKGSGFFPAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKSACCILIYLLAAHVFGALWYFMAIERETECWKKACREHTECYQNSFHCYETVGNYTFLTGLCPTMIQDTTMFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTHEGENLLASFIIIASLLLLLLVLGNLTVPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLLTTTTNGGRNTSVFKKYLSTGDFWGEELATSALDPDP****PHSNCALISVTNVEAFAINTDDLRAIVYQYWQHRNHNMQPLDIFKFYSQEWRTSKACVIQAAW*************************************YATQFF******************************
********FRRGTNLDSGFLQRGQRLASNGYNIMSTSLDNHINRIVDPRGPFWNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFDFFNIIYSSS********NAKKCFYLNSFLKDLLSCLPIPQLVTSIIIITSKGSGFFPAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKSACCILIYLLAAHVFGALWYFMAIERETECWKKACREHTECYQNSFHCYETVGNYTFLTGLCPTMIQDTTMFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTHEGENLLASFIIIASLLLLLLVLGNLTVPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLLTTTTNGGRNTSVFKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQYWQHRNHNMQPLDIFKFYSQEWRTSKACVIQAAWCRYKKRKLEGSLYAKENILQDQKAEAGGKPSKFGTAIYATQFFTYVRRSVKRNGGLPGGRVNITLAASETTRS
*******************************NIMSTSLDNHINRIVDPRGPFWNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFDFFNIIYSSSTPHKHSRANAKKCFYLNSFLKDLLSCLPIPQLVTSIIIITSKGSGFFPAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKSACCILIYLLAAHVFGALWYFMAIERETECWKKACREHTECYQNSFHCYETVGNYTFLTGLCPTMIQDTTMFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTHEGENLLASFIIIASLLLLLLVLGNLTVPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLLTTTTNGGRNTSVFKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQYWQHRNHNMQPLDIFKFYSQEWRTSKACVIQAAWCRYKKRKLEGSLYAKENILQD********PSKFGTAIYATQFFTYVRRSVKRNGGLPGGRV************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTQTFRPFRRGTNLDSGFLQRGQRLASNGYNIMSTSLDNHINRIVDPRGPFWNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFDFFNIIYSSSTPHKHSRANAKKCFYLNSFLKDLLSCLPIPQLVTSIIIITSKGSGFFPAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKSACCILIYLLAAHVFGALWYFMAIERETECWKKACREHTECYQNSFHCYETVGNYTFLTGLCPTMIQDTTMFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTHEGENLLASFIIIASLLLLLLVLGNLTVPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLLTTTTNGGRNTSVFKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQYWQHRNHNMQPLDIFKFYSQEWRTSKACVIQAAWCRYKKRKLEGSLYAKENILQDQKAEAGGKPSKFGTAIYATQFFTYVRRSVKRNGGLPGGRVNITLAASETTRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query569 2.2.26 [Sep-21-2011]
O65717716 Cyclic nucleotide-gated i yes no 0.525 0.417 0.432 8e-68
Q9SKD7706 Probable cyclic nucleotid no no 0.530 0.427 0.398 3e-60
Q9LNJ0711 Probable cyclic nucleotid no no 0.523 0.419 0.407 2e-58
O82226747 Probable cyclic nucleotid no no 0.588 0.448 0.338 5e-57
Q9LD40696 Putative cyclic nucleotid no no 0.572 0.468 0.388 1e-56
Q9M0A4733 Putative cyclic nucleotid no no 0.585 0.454 0.336 6e-56
Q8RWS9717 Probable cyclic nucleotid no no 0.597 0.474 0.323 6e-49
Q9FXH6753 Putative cyclic nucleotid no no 0.620 0.468 0.317 2e-47
Q9S9N5738 Putative cyclic nucleotid no no 0.551 0.425 0.342 5e-47
Q8GWD2649 Probable cyclic nucleotid no no 0.551 0.483 0.318 5e-45
>sp|O65717|CNGC1_ARATH Cyclic nucleotide-gated ion channel 1 OS=Arabidopsis thaliana GN=CNGC1 PE=1 SV=1 Back     alignment and function desciption
 Score =  258 bits (660), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 140/324 (43%), Positives = 195/324 (60%), Gaps = 25/324 (7%)

Query: 43  NRIVDPRGPF---WNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRT 99
           ++I+DP+GPF   WN I++   II+ SLDPLFFY+ +++D KKC+ +D K+ I A  LR+
Sbjct: 82  HKILDPQGPFLQRWNKIFVLACIIAVSLDPLFFYVPIIDDAKKCLGIDKKMEITASVLRS 141

Query: 100 IFDFFNI-----------------IYSSSTPHKHSRANAKKCFYLNS-FLKDLLSCLPIP 141
             D F +                 ++      +  R  AK+  YL+S F+ D+L+ LP+P
Sbjct: 142 FTDVFYVLHIIFQFRTGFIAPSSRVFGRGVLVEDKREIAKR--YLSSHFIIDILAVLPLP 199

Query: 142 QLVTSIIIITSKGSGFFPAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKS 201
           Q+V  III   +GS        LK +V  QY+PRF RIY LY     TSGIL +  W  +
Sbjct: 200 QMVILIIIPHMRGSSSLNTKNMLKFIVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGA 259

Query: 202 ACCILIYLLAAHVFGALWYFMAIERETECWKKAC-REHTECYQNSFHC-YETVGNYTFLT 259
           A  + +Y+LA+HVFGA WY  +IERET CWK+AC R +  C     +C  ET G   FL 
Sbjct: 260 AFNLFLYMLASHVFGAFWYLFSIERETVCWKQACERNNPPCISKLLYCDPETAGGNAFLN 319

Query: 260 GLCPTMIQDTTMFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTHE 319
             CP    +TT+F+FG+F +A+QSG+VE + F +KF YCF WGLQ +S  GQNL+TST+ 
Sbjct: 320 ESCPIQTPNTTLFDFGIFLDALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLKTSTYI 379

Query: 320 GENLLASFIIIASLLLLLLVLGNL 343
            E   A FI IA L+L   ++GN+
Sbjct: 380 WEICFAVFISIAGLVLFSFLIGNM 403




Acts as cyclic nucleotide-gated ion channel. Can be activated by cyclic AMP which leads to an opening of the cation channel. May be responsible for cAMP-induced calcium entry in cells and thus should be involved in the calcium signal transduction. Could transport K(+), Na(+) and Pb(2+).
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SKD7|CNGC3_ARATH Probable cyclic nucleotide-gated ion channel 3 OS=Arabidopsis thaliana GN=CNGC3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LNJ0|CNG10_ARATH Probable cyclic nucleotide-gated ion channel 10 OS=Arabidopsis thaliana GN=CNGC10 PE=2 SV=2 Back     alignment and function description
>sp|O82226|CNGC6_ARATH Probable cyclic nucleotide-gated ion channel 6 OS=Arabidopsis thaliana GN=CNGC6 PE=1 SV=2 Back     alignment and function description
>sp|Q9LD40|CNG13_ARATH Putative cyclic nucleotide-gated ion channel 13 OS=Arabidopsis thaliana GN=CNGC13 PE=3 SV=2 Back     alignment and function description
>sp|Q9M0A4|CNGC9_ARATH Putative cyclic nucleotide-gated ion channel 9 OS=Arabidopsis thaliana GN=CNGC9 PE=1 SV=1 Back     alignment and function description
>sp|Q8RWS9|CNGC5_ARATH Probable cyclic nucleotide-gated ion channel 5 OS=Arabidopsis thaliana GN=CNGC5 PE=2 SV=1 Back     alignment and function description
>sp|Q9FXH6|CNGC8_ARATH Putative cyclic nucleotide-gated ion channel 8 OS=Arabidopsis thaliana GN=CNGC8 PE=3 SV=2 Back     alignment and function description
>sp|Q9S9N5|CNGC7_ARATH Putative cyclic nucleotide-gated ion channel 7 OS=Arabidopsis thaliana GN=CNGC7 PE=2 SV=1 Back     alignment and function description
>sp|Q8GWD2|CNG12_ARATH Probable cyclic nucleotide-gated ion channel 12 OS=Arabidopsis thaliana GN=CNGC12 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query569
242093148665 hypothetical protein SORBIDRAFT_10g02055 0.882 0.754 0.333 3e-70
255545024 838 Cyclic nucleotide-gated ion channel, put 0.588 0.399 0.432 4e-69
15238657 716 cyclic nucleotide-gated ion channel 1 [A 0.525 0.417 0.432 5e-66
224135235 708 predicted protein [Populus trichocarpa] 0.564 0.453 0.419 7e-66
356509281 715 PREDICTED: cyclic nucleotide-gated ion c 0.588 0.468 0.402 1e-65
356516029 715 PREDICTED: cyclic nucleotide-gated ion c 0.588 0.468 0.405 2e-65
297796139 716 hypothetical protein ARALYDRAFT_918383 [ 0.528 0.420 0.428 1e-64
225462733 709 PREDICTED: cyclic nucleotide-gated ion c 0.581 0.466 0.413 1e-63
224118210 709 predicted protein [Populus trichocarpa] 0.564 0.452 0.412 4e-63
255578125518 Cyclic nucleotide-gated ion channel, put 0.717 0.787 0.342 8e-63
>gi|242093148|ref|XP_002437064.1| hypothetical protein SORBIDRAFT_10g020550 [Sorghum bicolor] gi|241915287|gb|EER88431.1| hypothetical protein SORBIDRAFT_10g020550 [Sorghum bicolor] Back     alignment and taxonomy information
 Score =  273 bits (697), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 189/566 (33%), Positives = 292/566 (51%), Gaps = 64/566 (11%)

Query: 46  VDPRGPF---WNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFD 102
           + P+GPF   WN I++   I + S+DPLF YI V+ND K C  LD KL + A  LR   D
Sbjct: 75  LHPQGPFLQKWNRIFVISCIFAVSVDPLFLYIPVINDEKPCWYLDRKLEMAASVLRFFTD 134

Query: 103 FFNII---------YSSSTPHKHSRA--NAKKCFYLNSFLK-----DLLSCLPIPQLVTS 146
            F I+         + +S+P    R   N  +C  +  +L      D+ + LPIPQ++  
Sbjct: 135 IFYILHIIFQFRTGFIASSPTTFGRGVLNEDRCAIIKRYLSTYFFIDVFAILPIPQVIIL 194

Query: 147 IIIITSKGSGFFPAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKSACCIL 206
           +++   +GS    A   L +++I QYVPR  RI  LY     ++G++ +     +A  +L
Sbjct: 195 VVLPNLQGSKVMKAKNVLMLIIICQYVPRLIRIRPLYLQITRSAGVITETARAGAAFNLL 254

Query: 207 IYLLAAHVFGALWYFMAIERETECWKKACREHTECYQNSFHC--YETVGNYTFLTGLC-P 263
           +Y+LA+HV GALWY ++I+R+  CW++ CR +  C  +  +C  Y+      FLT  C P
Sbjct: 255 LYMLASHVLGALWYLLSIQRQDSCWRQHCRSNKTCNLSYLYCGDYDNDEGNAFLTKSCQP 314

Query: 264 TMIQDTTMFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTHEGENL 323
               +     FG++  AIQ+ + + K+F +K  +C  WGLQ +S  GQNL+TST+  ENL
Sbjct: 315 RNQPNLPDPYFGIYAPAIQN-VSQSKSFFEKLFFCVWWGLQNLSSLGQNLKTSTYAWENL 373

Query: 324 LASFIIIASLLLLLLVLGNL-------TVPMFQMMGKSILSE-------MCKCLKPVLYV 369
            A F+ I+ L+L  L++GN+       ++ + +M  KS  ++       + + LK  +  
Sbjct: 374 FAVFVSISGLVLFALLIGNVQTYLQSASLRIEEMRVKSRDTDQWMSYRHLPENLKERIRR 433

Query: 370 QECCIVKEGDPICEMFFITQ---------------GTLLTTTTNGG----------RNTS 404
            E    +E   + E   +                   L+    + G          +N  
Sbjct: 434 YEQYRWQETSGVDEEQLLMNLPKDLRRDIKRHLCLSLLMRALRHEGKPNEHDDKWWKNWL 493

Query: 405 VFKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQYW 464
           ++   L  GDF GEEL T ALDP   S++P S   + +++ VEAFA+  +DLR +  Q+ 
Sbjct: 494 LYSDVLKAGDFCGEELLTWALDPTSTSSLPSSTRTVKTMSEVEAFALRAEDLRFVATQF- 552

Query: 465 QHRNHNMQPLDIFKFYSQEWRTSKACVIQAAWCRYKKRKLEGSLYAKENILQDQKAEAGG 524
             R H+ Q    F+FYSQ+WRT  AC IQAAW RY ++K+E SL AKE  LQ   A    
Sbjct: 553 -RRLHSKQLQHTFRFYSQQWRTWAACFIQAAWHRYCRKKIEDSLRAKEKRLQFAIANDSS 611

Query: 525 KPSKFGTAIYATQFFTYVRRSVKRNG 550
               F  A+YA++F   + R ++RN 
Sbjct: 612 TSLSFMAALYASRFAGNMIRILRRNA 637




Source: Sorghum bicolor

Species: Sorghum bicolor

Genus: Sorghum

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255545024|ref|XP_002513573.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223547481|gb|EEF48976.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15238657|ref|NP_200125.1| cyclic nucleotide-gated ion channel 1 [Arabidopsis thaliana] gi|38502855|sp|O65717.1|CNGC1_ARATH RecName: Full=Cyclic nucleotide-gated ion channel 1; Short=AtCNGC1; AltName: Full=Cyclic nucleotide- and calmodulin-regulated ion channel 1 gi|13877753|gb|AAK43954.1|AF370139_1 putative cyclic nucleotide-regulated ion channel protein [Arabidopsis thaliana] gi|3096947|emb|CAA76178.1| putative cyclic nucleotide-regulated ion channel [Arabidopsis thaliana] gi|9757994|dbj|BAB08416.1| cyclic nucleotide-regulated ion channel [Arabidopsis thaliana] gi|24030485|gb|AAN41391.1| putative cyclic nucleotide-regulated ion channel protein [Arabidopsis thaliana] gi|332008928|gb|AED96311.1| cyclic nucleotide-gated ion channel 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224135235|ref|XP_002322017.1| predicted protein [Populus trichocarpa] gi|222869013|gb|EEF06144.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356509281|ref|XP_003523379.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356516029|ref|XP_003526699.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine max] Back     alignment and taxonomy information
>gi|297796139|ref|XP_002865954.1| hypothetical protein ARALYDRAFT_918383 [Arabidopsis lyrata subsp. lyrata] gi|297311789|gb|EFH42213.1| hypothetical protein ARALYDRAFT_918383 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225462733|ref|XP_002268992.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera] gi|302143681|emb|CBI22542.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224118210|ref|XP_002317760.1| predicted protein [Populus trichocarpa] gi|222858433|gb|EEE95980.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255578125|ref|XP_002529932.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223530562|gb|EEF32440.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query569
TAIR|locus:2163776716 CNGC1 "cyclic nucleotide gated 0.463 0.368 0.437 1.8e-99
TAIR|locus:2039084706 CNGC3 "cyclic nucleotide gated 0.472 0.381 0.406 4.5e-84
TAIR|locus:2125206696 CNGC13 "cyclic nucleotide-gate 0.471 0.385 0.407 3.2e-81
TAIR|locus:2061401747 CNGC6 "cyclic nucleotide-gated 0.471 0.358 0.355 1.2e-80
TAIR|locus:2118836733 CNGC9 "cyclic nucleotide gated 0.471 0.365 0.350 4.3e-78
TAIR|locus:2174448717 CNGC5 "cyclic nucleotide gated 0.474 0.376 0.334 1.8e-72
TAIR|locus:2013139 753 CNGC8 "cyclic nucleotide gated 0.471 0.355 0.336 1.3e-69
TAIR|locus:2039099621 CNGC11 "cyclic nucleotide-gate 0.513 0.470 0.322 6.7e-64
TAIR|locus:2200502738 CNGC7 "cyclic nucleotide gated 0.437 0.337 0.339 1.3e-62
TAIR|locus:2062814678 CNGC15 "cyclic nucleotide-gate 0.469 0.393 0.310 2.6e-61
TAIR|locus:2163776 CNGC1 "cyclic nucleotide gated channel 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 579 (208.9 bits), Expect = 1.8e-99, Sum P(2) = 1.8e-99
 Identities = 125/286 (43%), Positives = 170/286 (59%)

Query:    53 WNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFDFF---NIIYS 109
             WN I++   II+ SLDPLFFY+ +++D KKC+ +D K+ I A  LR+  D F   +II+ 
Sbjct:    95 WNKIFVLACIIAVSLDPLFFYVPIIDDAKKCLGIDKKMEITASVLRSFTDVFYVLHIIFQ 154

Query:   110 SST----PHKH----------SRANAKKCFYLNS-FLKDLLSCLPIPQLVXXXXXXXXKG 154
               T    P              R  AK+  YL+S F+ D+L+ LP+PQ+V        +G
Sbjct:   155 FRTGFIAPSSRVFGRGVLVEDKREIAKR--YLSSHFIIDILAVLPLPQMVILIIIPHMRG 212

Query:   155 SGFFPAMVWLKVVVIVQYVPRFYRIYRLYAVAESTSGILAQMKWVKSACCILIYLLAAHV 214
             S        LK +V  QY+PRF RIY LY     TSGIL +  W  +A  + +Y+LA+HV
Sbjct:   213 SSSLNTKNMLKFIVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGAAFNLFLYMLASHV 272

Query:   215 FGALWYFMAIERETECWKKAC-REHTECYQNSFHCY-ETVGNYTFLTGLCPTMIQDTTMF 272
             FGA WY  +IERET CWK+AC R +  C     +C  ET G   FL   CP    +TT+F
Sbjct:   273 FGAFWYLFSIERETVCWKQACERNNPPCISKLLYCDPETAGGNAFLNESCPIQTPNTTLF 332

Query:   273 NFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTH 318
             +FG+F +A+QSG+VE + F +KF YCF WGLQ +S  GQNL+TST+
Sbjct:   333 DFGIFLDALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLKTSTY 378


GO:0005216 "ion channel activity" evidence=IEA
GO:0005261 "cation channel activity" evidence=ISS
GO:0005516 "calmodulin binding" evidence=ISS;TAS;IPI
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006811 "ion transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0030551 "cyclic nucleotide binding" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0005242 "inward rectifier potassium channel activity" evidence=IGI
GO:0005221 "intracellular cyclic nucleotide activated cation channel activity" evidence=IGI
GO:0006813 "potassium ion transport" evidence=IGI
GO:0006816 "calcium ion transport" evidence=IGI
TAIR|locus:2039084 CNGC3 "cyclic nucleotide gated channel 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125206 CNGC13 "cyclic nucleotide-gated channel 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061401 CNGC6 "cyclic nucleotide-gated channel 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118836 CNGC9 "cyclic nucleotide gated channel 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174448 CNGC5 "cyclic nucleotide gated channel 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013139 CNGC8 "cyclic nucleotide gated channel 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039099 CNGC11 "cyclic nucleotide-gated channels" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200502 CNGC7 "cyclic nucleotide gated channel 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062814 CNGC15 "cyclic nucleotide-gated channel 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
Sb10g020550.1
hypothetical protein (665 aa)
(Sorghum bicolor)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query569
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 5e-11
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 4e-06
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 7e-06
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
 Score = 59.6 bits (145), Expect = 5e-11
 Identities = 25/115 (21%), Positives = 48/115 (41%), Gaps = 12/115 (10%)

Query: 347 MFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTL-LTTTTNGGRNTSV 405
           +F  +    L E+   L+   +     I+++GDP   ++ +  G++ +      GR   V
Sbjct: 1   LFSGLDDEELEELADALEERRFPAGEVIIRQGDPADSLYIVLSGSVEVYKLDEDGREQIV 60

Query: 406 FKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIV 460
              +L  GD +GE           L N P S   + ++T+ E   +   D R ++
Sbjct: 61  G--FLGPGDLFGELAL--------LGNGPRS-ATVRALTDSELLVLPRSDFRRLL 104


In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115

>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 569
KOG0498727 consensus K+-channel ERG and related proteins, con 100.0
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 100.0
PLN03192 823 Voltage-dependent potassium channel; Provisional 100.0
KOG0500536 consensus Cyclic nucleotide-gated cation channel C 100.0
KOG0499815 consensus Cyclic nucleotide-gated cation channel C 100.0
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.76
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.74
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.72
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.7
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.64
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.62
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.61
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 99.59
cd00038115 CAP_ED effector domain of the CAP family of transc 99.38
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.38
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.3
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.27
PLN02868 413 acyl-CoA thioesterase family protein 99.23
KOG1113368 consensus cAMP-dependent protein kinase types I an 99.08
PF00520200 Ion_trans: Ion transport protein calcium channel s 99.06
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.0
COG2905 610 Predicted signal-transduction protein containing c 98.76
KOG3713477 consensus Voltage-gated K+ channel KCNB/KCNC [Inor 98.64
KOG1113368 consensus cAMP-dependent protein kinase types I an 98.62
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 98.36
KOG1545507 consensus Voltage-gated shaker-like K+ channel KCN 98.01
KOG1419 654 consensus Voltage-gated K+ channel KCNQ [Inorganic 97.75
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 97.55
PRK10537393 voltage-gated potassium channel; Provisional 97.47
PF01007336 IRK: Inward rectifier potassium channel; InterPro: 97.46
KOG4390632 consensus Voltage-gated A-type K+ channel KCND [In 97.36
PF0841277 Ion_trans_N: Ion transport protein N-terminal; Int 97.3
PRK11832207 putative DNA-binding transcriptional regulator; Pr 97.19
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 96.38
PF04831153 Popeye: Popeye protein conserved region; InterPro: 96.02
KOG1418433 consensus Tandem pore domain K+ channel [Inorganic 95.99
KOG1420 1103 consensus Ca2+-activated K+ channel Slowpoke, alph 95.77
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 95.23
KOG3827400 consensus Inward rectifier K+ channel [Inorganic i 92.46
KOG3684489 consensus Ca2+-activated K+ channel proteins (inte 91.04
KOG4404350 consensus Tandem pore domain K+ channel TASK3/THIK 88.71
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 88.07
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 87.06
KOG1418433 consensus Tandem pore domain K+ channel [Inorganic 85.05
KOG4404350 consensus Tandem pore domain K+ channel TASK3/THIK 82.91
>KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.2e-99  Score=844.78  Aligned_cols=459  Identities=35%  Similarity=0.635  Sum_probs=406.6

Q ss_pred             ccCCeeecCCCch---HHHHHHHHHHHHhhccceeeeeeeecCCceeEEecccceeehheeccccceEEEe-----ee--
Q 008346           40 NHINRIVDPRGPF---WNWIWLAVRIISTSLDPLFFYIFVVNDHKKCVDLDIKLAIIAISLRTIFDFFNII-----YS--  109 (569)
Q Consensus        40 ~~~~~iidP~s~~---Wn~~~li~~i~~~~v~Plf~y~p~~~~~~~c~~~d~~~~~~~~~l~~~~D~~f~~-----f~--  109 (569)
                      ...++||||+|+|   ||+++|++|+|++++||++||+|.++++..|  +|..+...++++|+++|+||++     |+  
T Consensus        64 ~~~~~Ii~P~s~~~~~W~~~~Ll~~iya~~v~P~~f~f~~~~~~~~~--~d~~~~~~l~v~d~ivD~fflvdIvL~Frta  141 (727)
T KOG0498|consen   64 KSRKWILDPYSPFYRVWNKFFLLLVIYAAFVDPLFFYFLLIDDERKC--IDGKLAAPLTVLDTIVDIFFLVDIVLNFRTA  141 (727)
T ss_pred             cccceeECCCChHHHHHHHHHHHHHHHHHHhccceeeEEeccccccc--ccccccCceeeHHHHHHHHHHHHHHHhheEE
Confidence            3446799999999   9999999999999999999999999999999  9999999999999999999998     66  


Q ss_pred             ----cCc-cccchHhhhhccccchh-cHhhhhhcCChhhhhhheeecccCCCCcccchhHHHHHHHHhhhhHHHHHHHHH
Q 008346          110 ----SST-PHKHSRANAKKCFYLNS-FLKDLLSCLPIPQLVTSIIIITSKGSGFFPAMVWLKVVVIVQYVPRFYRIYRLY  183 (569)
Q Consensus       110 ----~s~-v~~D~~~Ia~~~~Yl~s-F~iDlla~lPl~~i~~~~~~~~~~~~~~~~~~~~Lrli~l~q~lpRL~Ri~~l~  183 (569)
                          +++ ++.||++||+  |||++ |++|++|+||+||+++|.++   +........+.|..+.++||+|||+|++|++
T Consensus       142 yv~~~s~elV~dpk~IA~--rYl~twFiiDlis~lP~~~i~~~~~~---~~~~~~~~~~~l~~il~~~rL~Rl~Rv~~l~  216 (727)
T KOG0498|consen  142 YVDPSSYELVDDPKKIAK--RYLKTWFLIDLISTLPFDQIVVLVVI---GSTSLALESTILVGILLLQRLPRLRRVIPLF  216 (727)
T ss_pred             EECCCCceeeeCHHHHHH--HHHhhhHHHHHHHhcChhhheeeeee---cccchhhhHHHHHHHHHHHHHHHHHHHHHHH
Confidence                455 8899999999  99999 99999999999999999877   1122233344788889999999999999999


Q ss_pred             HHHHhhhchhhHHhHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHhhhccccccccccccccccCCccccccccCC
Q 008346          184 AVAESTSGILAQMKWVKSACCILIYLLAAHVFGALWYFMAIERETECWKKACREHTECYQNSFHCYETVGNYTFLTGLCP  263 (569)
Q Consensus       184 ~~i~~~~g~~~~ta~~~a~~~L~~y~LasH~~gc~WYll~i~r~~~cw~~~c~~~~~C~~~~l~c~~~~~~~~W~~~~c~  263 (569)
                      ++++|.+|++.+|||++++++|++|||++||+||+||++|++|.+.||+++|-  .+|...+++|+              
T Consensus       217 ~r~~k~~~~v~~~awa~~a~ll~~~~l~sH~~gc~wYlia~~~~~~~~~~~tw--~~~l~~~~~~~--------------  280 (727)
T KOG0498|consen  217 ARLEKDTGFVYETAWAGAALLLSVYLLASHWAGCIWYLIAIERPASCPRKATW--LGSLGRLLSCY--------------  280 (727)
T ss_pred             HHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccCcccccc--ccccccccccC--------------
Confidence            99999999999999999999999999999999999999999999999987622  11110023332              


Q ss_pred             CcccCCCccccchhHHhhhcccccchhhHhHHHHHHHHHhhhccccCCCCCCCCcchhhHHHHHHHHHHHHHHHHHhcCc
Q 008346          264 TMIQDTTMFNFGMFQEAIQSGMVEEKAFKKKFIYCFRWGLQTVSCAGQNLQTSTHEGENLLASFIIIASLLLLLLVLGNL  343 (569)
Q Consensus       264 ~~~~~~~~f~~gi~~~a~~~~~~~~~~~~~kY~~slyW~l~tLtTvG~g~~~s~~~~E~~faI~~mi~G~~lfA~lIGN~  343 (569)
                           +..|+||+|.++            .||+||||||++||||+|||+++|++..|++|+|++|++|++|||++||||
T Consensus       281 -----~~~~~fg~~s~~------------~kY~~aLyw~l~tLstvG~g~~~s~~~~E~iFsi~~mi~GllL~A~lIGNm  343 (727)
T KOG0498|consen  281 -----NLSFTFGIYSLA------------LKYVYALYWGLSTLSTVGYGLVHANNMGEKIFSIFIMLFGLLLFAYLIGNM  343 (727)
T ss_pred             -----cccccccchhHH------------HHHHHHHHHHhhHhhhccCCccCCCCcHHHHHHHHHHHHhHHHHHHHHhhH
Confidence                 234789987654            499999999999999999999999999999999999999999999999999


Q ss_pred             -------------------------------------------------------------------------------c
Q 008346          344 -------------------------------------------------------------------------------T  344 (569)
Q Consensus       344 -------------------------------------------------------------------------------k  344 (569)
                                                                                                     +
T Consensus       344 t~~iqs~tsR~~~~r~k~rd~e~~m~~~~LP~~LRqRi~~y~q~kw~~t~Gvdee~lL~~LP~~LR~dI~~hL~~~lv~~  423 (727)
T KOG0498|consen  344 TALLQSLTSRTEEMRDKMRDAEQWMSRRQLPPDLRQRIRRYEQYKWLATRGVDEEELLQSLPKDLRRDIKRHLCLDLVRK  423 (727)
T ss_pred             HHhHHHHhHHHHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHhhccCcCHHHHHHhCCHHHHHHHHHHHhHHHHhh
Confidence                                                                                           8


Q ss_pred             cccccCCCHHHHHHHHhcCccEEECCCCEEEecCCCcCeEEEEEeeEEEEEEecCCeeeeeEeEEecCCcEEecchhhhc
Q 008346          345 VPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLLTTTTNGGRNTSVFKKYLSTGDFWGEELATSA  424 (569)
Q Consensus       345 VplF~~ld~~~L~~L~~~lk~~~f~kGe~IireGd~~~~myFI~~G~v~v~~~dgg~~~~~~l~~L~~GdfFGE~~L~wa  424 (569)
                      ||+|++||+++|++||+++|+..|+|||+|++|||++++||||++|.+++.+++||  ++++++.|++||+|||+.++||
T Consensus       424 vpLF~~md~~~L~al~~rlk~~~f~pge~iireGd~v~~myFI~rG~le~~~~~~g--~~~~~~~L~~Gd~~GeEl~~~~  501 (727)
T KOG0498|consen  424 VPLFAGMDDGLLDALCSRLKPEYFTPGEYIIREGDPVTDMYFIVRGSLESITTDGG--GFFVVAILGPGDFFGEELLTWC  501 (727)
T ss_pred             CchhhcCCHHHHHHHHHHhhhhccCCCCeEEecCCccceeEEEEeeeEEEEEccCC--ceEEEEEecCCCccchHHHHHH
Confidence            99999999999999999999999999999999999999999999999999998866  4557899999999999888999


Q ss_pred             CCCCCCCCCCCcccEEEEeceeEEEEecHHHHHHHHHHhhhhhcccCCchhhhhhcccchhhHHHHHHHHHHHHHHHHHh
Q 008346          425 LDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQYWQHRNHNMQPLDIFKFYSQEWRTSKACVIQAAWCRYKKRKL  504 (569)
Q Consensus       425 ld~~s~~~~~~st~tV~Alt~~ell~L~~edl~~l~~~~~~~~~~s~~l~~t~r~ys~~~r~~~~~~iq~a~rr~~~r~~  504 (569)
                      ++.       |+++||+|+|+||++.|+++||++++++|  +++++++++|+||+||++||+|++|++|.+|++|.+|+.
T Consensus       502 ~~~-------p~t~TVralt~~el~~L~~~dL~~V~~~f--~~~~~~~l~~~~r~~s~~~r~~aa~~iq~a~r~~~~~~~  572 (727)
T KOG0498|consen  502 LDL-------PQTRTVRALTYCELFRLSADDLKEVLQQF--RRLGSKFLQHTFRYYSHLWRTWAACFIQAAWRRHIKRKG  572 (727)
T ss_pred             hcC-------CCCceeehhhhhhHHhccHHHHHHHHHHh--HHHHHHHHHhHHHHhhhhhhhhhhhhHHHHHHHHHHhhc
Confidence            852       45899999999999999999999999999  999999999999999999999999999999999999998


Q ss_pred             hhhhhhhhhhhhhhhhhcCCCchhhhhHHhhcHHHHHHHHHHHHcC
Q 008346          505 EGSLYAKENILQDQKAEAGGKPSKFGTAIYATQFFTYVRRSVKRNG  550 (569)
Q Consensus       505 ~~~~~~~e~r~~~~~~~~~~~~~~~~~~~~~sr~~~~~~~~~~~~~  550 (569)
                      .+.+...++.-.... .+.++.++++++.+|+++++|+++.++.+.
T Consensus       573 ~~~l~~~~~~~~~~~-~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~  617 (727)
T KOG0498|consen  573 EEELALEEEESAIRG-DDRGSKSLLRAGILASRFAANGRPPLHTAA  617 (727)
T ss_pred             cchhhhhcchhhhcc-ccccchhhhhcccccccccccCCCcccccc
Confidence            875555433211111 235667899999999999999999987763



>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF08412 Ion_trans_N: Ion transport protein N-terminal; InterPro: IPR013621 This domain is found to the N terminus of IPR005821 from INTERPRO in voltage- and cyclic nucleotide-gated K/Na ion channels Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query569
1wgp_A137 Solution Structure Of The Cnmp-Binding Domain From 2e-17
>pdb|1WGP|A Chain A, Solution Structure Of The Cnmp-Binding Domain From Arabidopsis Thaliana Cyclic Nucleotide-Regulated Ion Channel Length = 137 Back     alignment and structure

Iteration: 1

Score = 87.0 bits (214), Expect = 2e-17, Method: Composition-based stats. Identities = 44/119 (36%), Positives = 67/119 (56%) Query: 345 VPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFIXXXXXXXXXXXXXXXXS 404 VP+F+ M + +L +C+ LKP L+ ++ +V+EGDP+ EM FI Sbjct: 11 VPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGF 70 Query: 405 VFKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQY 463 + L GDF G+EL T ALDP SN+P S + ++T VEAFA+ D+L+ + Q+ Sbjct: 71 YNRSLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQF 129

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query569
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 2e-29
3ukn_A212 Novel protein similar to vertebrate potassium VOL 2e-20
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 3e-19
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 3e-19
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 1e-18
4din_B381 CAMP-dependent protein kinase type I-beta regulat 5e-11
4din_B381 CAMP-dependent protein kinase type I-beta regulat 7e-06
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 6e-11
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 1e-06
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 7e-11
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 1e-10
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 2e-06
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 4e-10
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 1e-07
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 2e-09
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 6e-09
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 1e-07
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 1e-08
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 3e-08
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 3e-08
2pqq_A149 Putative transcriptional regulator; APC7345, strep 1e-07
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 1e-07
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 2e-07
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 2e-07
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 8e-04
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 5e-07
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 8e-07
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 1e-06
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 1e-06
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 2e-06
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 3e-06
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 3e-06
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 6e-06
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 6e-06
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 1e-05
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 2e-05
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 2e-05
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 3e-05
1ft9_A222 Carbon monoxide oxidation system transcription reg 5e-05
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 6e-05
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 1e-04
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 3e-04
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 6e-04
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
 Score =  111 bits (280), Expect = 2e-29
 Identities = 51/119 (42%), Positives = 78/119 (65%)

Query: 345 VPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLLTTTTNGGRNTS 404
           VP+F+ M + +L  +C+ LKP L+ ++  +V+EGDP+ EM FI +G L + TT+GGR+  
Sbjct: 11  VPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGF 70

Query: 405 VFKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQY 463
             +  L  GDF G+EL T ALDP   SN+P S   + ++T VEAFA+  D+L+ +  Q+
Sbjct: 71  YNRSLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQF 129


>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query569
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.96
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.86
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.84
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.84
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.84
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.83
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 99.83
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.83
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.83
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.83
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 99.82
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.82
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 99.81
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.81
1ft9_A222 Carbon monoxide oxidation system transcription reg 99.8
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.79
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.77
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.77
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.73
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 99.73
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.73
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.71
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.7
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.69
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.68
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.66
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.66
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.65
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.64
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 99.64
3b02_A195 Transcriptional regulator, CRP family; structural 99.62
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.62
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.62
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.62
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.6
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.6
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.57
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.56
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.53
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.53
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.5
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.49
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.49
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.49
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.48
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.48
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.43
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.4
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.39
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.36
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.31
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.25
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.19
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 99.17
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.14
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.05
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 98.83
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 98.73
2q67_A114 Potassium channel protein; inverted teepee, helix 98.64
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 98.57
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 98.56
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 98.55
3ouf_A97 Potassium channel protein; ION channel, membrane, 98.51
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 98.4
1xl4_A301 Inward rectifier potassium channel; integral membr 98.35
1p7b_A333 Integral membrane channel and cytosolic domains; t 98.11
2qks_A321 KIR3.1-prokaryotic KIR channel chimera; G-protein 98.1
3sya_A340 G protein-activated inward rectifier potassium CH; 98.03
3um7_A309 Potassium channel subfamily K member 4; potassium 98.0
3ukm_A280 Potassium channel subfamily K member 1; membrane p 97.8
3spc_A343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 97.73
3rvy_A285 ION transport protein; tetrameric ION channel, vol 97.72
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 97.63
1lnq_A336 MTHK channels, potassium channel related protein; 97.61
3um7_A309 Potassium channel subfamily K member 4; potassium 97.59
3ukm_A280 Potassium channel subfamily K member 1; membrane p 97.53
4dxw_A229 Navrh, ION transport protein; tetrameric, voltage- 92.48
2l53_B31 CAM, voltage-gated sodium channel type V alpha iso 88.04
2kxw_B27 Sodium channel protein type 2 subunit alpha; actio 87.32
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
Probab=99.96  E-value=2.5e-30  Score=271.41  Aligned_cols=155  Identities=22%  Similarity=0.381  Sum_probs=49.6

Q ss_pred             HhHHHHHHHHHhhhccccCCCCCCCCcchhhHHHHHHHHHHHHHHHHHhcCc---------------------ccccccC
Q 008346          292 KKKFIYCFRWGLQTVSCAGQNLQTSTHEGENLLASFIIIASLLLLLLVLGNL---------------------TVPMFQM  350 (569)
Q Consensus       292 ~~kY~~slyW~l~tLtTvG~g~~~s~~~~E~~faI~~mi~G~~lfA~lIGN~---------------------kVplF~~  350 (569)
                      +..|..|+||++.||||+||||++|.+..|+++++++|++|++++|+.+|++                     ++|+|++
T Consensus       159 f~~~~~s~y~~~~t~ttvGygd~~p~t~~~~~~~~~~~~~g~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~l~~~~lf~~  238 (355)
T 3beh_A          159 FGSIPQAMWWAVVTLSTTGYGDTIPQSFAGRVLAGAVMMSGIGIFGLWAGILATGFYQEVRRGDFVRNWQLVAAVPLFQK  238 (355)
T ss_dssp             HSSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC----------
T ss_pred             cccHHHHHHHHHhheeecCCCCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccchhhhccccccc
Confidence            4568899999999999999999999999999999999999999999999998                     7899999


Q ss_pred             CCHHHHHHHHhcCccEEECCCCEEEecCCCcCeEEEEEeeEEEEEEecCCeeeeeEeEEecCCcEEecchhhhcCCCCCC
Q 008346          351 MGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLLTTTTNGGRNTSVFKKYLSTGDFWGEELATSALDPDPL  430 (569)
Q Consensus       351 ld~~~L~~L~~~lk~~~f~kGe~IireGd~~~~myFI~~G~v~v~~~dgg~~~~~~l~~L~~GdfFGE~~L~wald~~s~  430 (569)
                      ++++++++++..++++.|+|||+|++|||+++++|||.+|.++++..+  +      ..+++||+|||.++   +.    
T Consensus       239 ls~~~l~~l~~~~~~~~~~~ge~I~~~G~~~~~ly~I~~G~v~v~~~~--~------~~l~~G~~fGe~~~---l~----  303 (355)
T 3beh_A          239 LGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPN--P------VELGPGAFFGEMAL---IS----  303 (355)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCHHHHHHHHHhceEEEECCCCEEEeCCCcCceEEEEEeeEEEEEECC--e------eEECCCCEEeehHH---hC----
Confidence            999999999999999999999999999999999999999999998754  2      35899999999865   21    


Q ss_pred             CCCCCcccEEEEeceeEEEEecHHHHHHHHHHh
Q 008346          431 SNIPHSNCALISVTNVEAFAINTDDLRAIVYQY  463 (569)
Q Consensus       431 ~~~~~st~tV~Alt~~ell~L~~edl~~l~~~~  463 (569)
                        ..+++++++|.++|+++.+++++++++++++
T Consensus       304 --~~~~~~~~~A~~~~~l~~i~~~~f~~ll~~~  334 (355)
T 3beh_A          304 --GEPRSATVSAATTVSLLSLHSADFQMLCSSS  334 (355)
T ss_dssp             ---------------------------------
T ss_pred             --CCCcceEEEECccEEEEEEeHHHHHHHHHHC
Confidence              2357899999999999999999999999999



>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Back     alignment and structure
>2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 569
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 4e-15
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 2e-07
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 5e-07
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 1e-05
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 5e-05
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 1e-04
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 5e-04
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Probable cyclic nucleotide-gated ion channel 6
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 70.0 bits (170), Expect = 4e-15
 Identities = 51/121 (42%), Positives = 79/121 (65%)

Query: 345 VPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLLTTTTNGGRNTS 404
           VP+F+ M + +L  +C+ LKP L+ ++  +V+EGDP+ EM FI +G L + TT+GGR+  
Sbjct: 11  VPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGF 70

Query: 405 VFKKYLSTGDFWGEELATSALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQYW 464
             +  L  GDF G+EL T ALDP   SN+P S   + ++T VEAFA+  D+L+ +  Q+ 
Sbjct: 71  YNRSLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFR 130

Query: 465 Q 465
           +
Sbjct: 131 R 131


>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query569
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.87
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.76
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.71
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.69
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.69
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.68
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.67
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.66
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.65
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.65
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.64
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.61
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.61
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.59
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.56
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.51
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.42
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 98.82
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 98.81
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 98.63
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 98.34
d1i5za169 Catabolite gene activator protein (CAP), C-termina 92.36
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 92.21
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 91.37
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 89.93
d1zyba173 Probable transcription regulator BT4300, C-termina 87.73
d2zcwa182 Transcriptional regulator TTHA1359, C-terminal dom 87.05
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 86.07
d1orsc_132 Potassium channel KVAP {Archaeon Aeropyrum pernix 85.94
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 85.92
d2bgca1100 Listeriolysin regulatory protein PrfA, C-terminal 85.39
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 83.1
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Probable cyclic nucleotide-gated ion channel 6
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.87  E-value=9.8e-23  Score=183.84  Aligned_cols=123  Identities=42%  Similarity=0.753  Sum_probs=110.1

Q ss_pred             ccccccCCCHHHHHHHHhcCccEEECCCCEEEecCCCcCeEEEEEeeEEEEEEecCCeeeeeEeEEecCCcEEecchhhh
Q 008346          344 TVPMFQMMGKSILSEMCKCLKPVLYVQECCIVKEGDPICEMFFITQGTLLTTTTNGGRNTSVFKKYLSTGDFWGEELATS  423 (569)
Q Consensus       344 kVplF~~ld~~~L~~L~~~lk~~~f~kGe~IireGd~~~~myFI~~G~v~v~~~dgg~~~~~~l~~L~~GdfFGE~~L~w  423 (569)
                      +||+|++++++++++|+.+++++.|+|||+|++|||++++||||.+|.|+++..++++........+++|++|||.++.+
T Consensus        10 ~vp~F~~l~~~~l~~l~~~~~~~~~~~ge~I~~~Gd~~~~ly~i~~G~v~~~~~~~~~~~~~~~~~l~~G~~fGE~~ll~   89 (137)
T d1wgpa_          10 RVPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNRSLLKEGDFCGDELLTW   89 (137)
T ss_dssp             SCSGGGSCCHHHHHHHHHHCBCCCBCTTEEEECTTSBCSEEEEEEECCCEEECCSSCSSSSSCEEECCTTCBSSTHHHHH
T ss_pred             CCHhHhCCCHHHHHHHHHhcEEEEECCCCEEEecccccceeehhccCceEEEEecCCCceeeeeeeccCCcEEcchhHhc
Confidence            79999999999999999999999999999999999999999999999999887653332222457899999999999888


Q ss_pred             cCCCCCCCCCCCcccEEEEeceeEEEEecHHHHHHHHHHhhhhhc
Q 008346          424 ALDPDPLSNIPHSNCALISVTNVEAFAINTDDLRAIVYQYWQHRN  468 (569)
Q Consensus       424 ald~~s~~~~~~st~tV~Alt~~ell~L~~edl~~l~~~~~~~~~  468 (569)
                      ..++.+..+.+++++||+|+++|+++.|+++||++++++|  +|.
T Consensus        90 ~~~~~~~~~~~~r~~tv~a~t~~~l~~L~~~dl~~il~~~--~r~  132 (137)
T d1wgpa_          90 ALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQF--RRS  132 (137)
T ss_dssp             HHCSSCCSSSCBCSSEEEESSCBEEEEEEHHHHHHHHHHH--CCC
T ss_pred             cCCCcccccccccCcEEEEeeeEEEEEEEHHHHHHHHHHh--ccc
Confidence            8887777788899999999999999999999999999999  553



>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1orsc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure