Citrus Sinensis ID: 008415


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560------
MGNLISTFLPADLFDRTSNCVGEQAKYVWGLEKNLRVLETELHKLTRARADLKTKVEIEEQRPRTRRTNQVAGWLEDVQKLETEYTELERDRAQEMDRLCLGGLCSKNFVSNSEIPKRQLIDYWISEGFVCDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVHAGVELTEAPKFEEWEGAKRVSLMGNGIRSLSEIPTCPRLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWVVTEEEGNVLCEDAEPLMKELLGSKHLNVLSWTFRSSLGVQNFLKYPKLVSITQSVLVKSGVHTSPPFNVLHLAYMENLQKFELESCNLEEMKIDSTEEVKKLFQSGFRSLNTVSVHYCRKAKDLTWLVFVQNLKVLRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYLSISWGTNLKSVYPNPLPFPKLKKIDVCHCPQLKKLPLNSSSAKERRVVIEGEKKWWEELQWEDQATQNAFSSRCRTWG
ccccEEEcccccHHHHHHHHHHHHHHHHHcHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccEEEEcHHHHHHHHHHHccccccccccEEEccccEEEcccccccccEEEEEEEccccccccccccccccEEEccccccccccccHHHcccccccEEEccccccccccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccHHHHHHHcccccccEEEEEEcccccccccccccccccccEEEEEEcccccccccccccccccccccEEEEccccccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEEEccccccEEcccccccccEEEccccccccccccEEEEcccccccEEcccccccccccEEEEEccccccccccccccccccEEEEEccHHHHcccccccHHHHHHccccccccc
cccHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccEEcHcccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccHHHEEEEEEcccccHcccccccccccEEEEEEccccccccHHHHHHcccEEEEEccccccHccccccHHcccHHHHHHHHcEEEEccccHHHHcccHHHHHHHHcccEEEccccccccccccccccccccHHHHHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHHHHHEEEccccccccccccHcccHcHHHccEEEcccccccEEEEcccccccccccccccccEEEEEcccccccccccHcccccccEEEEcccHcHHHcccHcccccccccccccccccHcccEEEEcccHcHHHccccccccccccEEEEccccHHHccccccccHHccEEEEcccHHHHHHcccccHHHHHHccccccccc
mgnlistflpadlfdrtsncvgeqAKYVWGLEKNLRVLETELHKLTRARADLKTKVEieeqrprtrrtnqvAGWLEDVQKLETEYTELERDRAQEMDRLClgglcsknfvsnseipkrqLIDYWIsegfvcdfddgcDFIDDLLQACLLeeegddhvKMHDMIREMSLWIACTVDKEEQNFLVHAGvelteapkfeewegaKRVSLmgngirslseiptcprlVTLLlggnrieeitdgFFQSMSTLRVLSLRINIslrklpsgirglPQELKALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWvvteeegnvlceDAEPLMKELlgskhlnvlSWTFRSslgvqnflkypklVSITQSVLvksgvhtsppfnVLHLAYMENLQKFELEscnleemkIDSTEEVKKLFQSGFRSLNTVSVHYCRKAKDLTWLVFVQNLkvlrigdcydmeeiisvdkLRDISVIIGSEHNFFAQLEYLSIswgtnlksvypnplpfpklkkidvchcpqlkklplnsssakERRVVIEGEKKWWEELQWEDQATQNAFSSRCRTWG
mgnlistflpadlfdrTSNCVGEQAKYVWGLEKNLRVLETELHKltraradlktkveieeqrprtrrtnqvagwledvqKLETEYTELERDRAQEMDRLCLGGLcsknfvsnseiPKRQLIDYWISEGFVCDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVHAGVelteapkfeeweGAKRVSLMGNGirslseiptcPRLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINIslrklpsgirglpQELKALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWVVTEEEGNVLCEDAEPLMKELLGSKHLNVLSWTFRSSLGVQNFLKYPKLVSITQSVLVKSGVHTSPPFNVLHLAYMENLQKFELESCNLEEMKIDSTEEVKKLFQSGFRSLNTVSVHYCRKAKDLTWLVFVQNLKVLRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYLSISWGTNLKSVYPNPLPFPKLKKIDVCHCPqlkklplnsssakerrVVIEGEKKWWEelqwedqatqnafssrcrtwg
MGNLISTFLPADLFDRTSNCVGEQAKYVWGLEKNLRVLETELHKLTRARADLKTKVEIEEQRPRTRRTNQVAGWLEDVQKLETEYTELERDRAQEMDRLCLGGLCSKNFVSNSEIPKRQLIDYWISEgfvcdfddgcdfiddLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVHAGVELTEAPKFEEWEGAKRVSLMGNGIRSLSEIPTCPRLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWVVTEEEGNVLCEDAEPLMKELLGSKHLNVLSWTFRSSLGVQNFLKYPKLVSITQSVLVKSGVHTSPPFNVLHLAYMENLQKFELESCNLEEMKIDSTEEVKKLFQSGFRSLNTVSVHYCRKAKDLTWLVFVQNLKVLRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYLSISWGTNLKSVYPNPLPFPKLKKIDVCHCPQLKKLPLNSSSAKERRVVIEGEKKWWEELQWEDQATQNAFSSRCRTWG
***LISTFLPADLFDRTSNCVGEQAKYVWGLEKNLRVLETELHKLTRARA********************VAGWLEDVQKLETEYTEL*****QEMDRLCLGGLCSKNFVSNSEIPKRQLIDYWISEGFVCDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVHAGVELTEAPKFEEWEGAKRVSLMGNGIRSLSEIPTCPRLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWVVTEEEGNVLCEDAEPLMKELLGSKHLNVLSWTFRSSLGVQNFLKYPKLVSITQSVLVKSGVHTSPPFNVLHLAYMENLQKFELESCNLEEMKIDSTEEVKKLFQSGFRSLNTVSVHYCRKAKDLTWLVFVQNLKVLRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYLSISWGTNLKSVYPNPLPFPKLKKIDVCHCPQLKKLP*********RVVIEGEKKWWEELQWED***************
****ISTFLPADLFDRTSNCVGEQAKYVWGLEKNLRVLETELHKLTRARADLKTKVEIEEQRPRTRRTNQ*AGWLEDVQKLETEYTELERDRAQEMDRLCLGGLCSKNFVSNSEIPKRQLIDYWISEGFVCDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVHAGVELTEAPKFEEWEGAKRVSLMGNGIRSLSEIPTCPRLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWVVTEEEGNVLCEDAEPLMKELLGSKHLNVLSWTFRSSLGVQNFLKYPKLVSITQSVLVKSGVHTSPPFNVLHLAYMENLQKFELESCNLEEMKIDSTEEVKKLFQSGFRSLNTVSVHYCRKAKDLTWLVFVQNLKVLRIGDCYDMEEIISVDKLRD***IIGSEHNFFAQLEYLSISWGTNLKSVYPNPLPFPKLKKIDVCHCPQLKKLPL************EGEKKWWEELQWEDQATQNAFSSRCRTWG
MGNLISTFLPADLFDRTSNCVGEQAKYVWGLEKNLRVLETELHKLTRARADLKTKVEI**********NQVAGWLEDVQKLETEYTELERDRAQEMDRLCLGGLCSKNFVSNSEIPKRQLIDYWISEGFVCDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVHAGVELTEAPKFEEWEGAKRVSLMGNGIRSLSEIPTCPRLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWVVTEEEGNVLCEDAEPLMKELLGSKHLNVLSWTFRSSLGVQNFLKYPKLVSITQSVLVKSGVHTSPPFNVLHLAYMENLQKFELESCNLEEMKIDSTEEVKKLFQSGFRSLNTVSVHYCRKAKDLTWLVFVQNLKVLRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYLSISWGTNLKSVYPNPLPFPKLKKIDVCHCPQLKKLPL*********VVIEGEKKWWEELQWEDQA*************
*GNLISTFLPADLFDRTSNCVGEQAKYVWGLEKNLRVLETELHKLTRARADLKTKVEIEEQRPRTRRTNQVAGWLEDVQKLETEYTELERDRAQEMDRLCLGGLCSKNFVSNSEIPKRQLIDYWISEGFVCDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVHAGVELTEAPKFEEWEGAKRVSLMGNGIRSLSEIPTCPRLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWVVTEEEGNVLCEDAEPLMKELLGSKHLNVLSWTFRSSLGVQNFLKYPKLVSITQSVLVKSGVHTSPPFNVLHLAYMENLQKFELESCNLEEMKIDSTEEVKKLFQSGFRSLNTVSVHYCRKAKDLTWLVFVQNLKVLRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYLSISWGTNLKSVYPNPLPFPKLKKIDVCHCPQLKKLPLNSSSAKERRVVIEGEKKWWEELQWEDQATQNAFSSRCRT**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNLISTFLPADLFDRTSNCVGEQAKYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPRTRRTNQxxxxxxxxxxxxxxxxxxxxxxxxxxxxLCLGGLCSKNFVSNSEIPKRQLIDYWISEGFVCDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVHAGVELTEAPKFEEWEGAKRVSLMGNGIRSLSEIPTCPRLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWVVTEEEGNVLCEDAEPLMKELLGSKHLNVLSWTFRSSLGVQNFLKYPKLVSITQSVLVKSGVHTSPPFNVLHLAYMENLQKFELESCNLEEMKIDSTEEVKKLFQSGFRSLNTVSVHYCRKAKDLTWLVFVQNLKVLRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYLSISWGTNLKSVYPNPLPFPKLKKIDVCHCPQLKKLPLNSSSAKERRVVIEGEKKWWEELQWEDQATQNAFSSRCRTWG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query566 2.2.26 [Sep-21-2011]
Q8RXS5888 Probable disease resistan yes no 0.754 0.480 0.365 5e-69
O64973889 Disease resistance protei no no 0.756 0.481 0.359 3e-59
Q8L3R3885 Disease resistance protei no no 0.768 0.491 0.361 1e-57
Q9FLB4874 Putative disease resistan no no 0.765 0.495 0.336 7e-57
P60838894 Probable disease resistan no no 0.749 0.474 0.367 1e-55
Q9C8T9898 Putative disease resistan no no 0.745 0.469 0.340 1e-53
P60839884 Probable disease resistan no no 0.749 0.479 0.338 5e-52
O82484892 Putative disease resistan no no 0.770 0.488 0.324 1e-51
Q9SI85893 Probable disease resistan no no 0.749 0.474 0.315 3e-51
Q9LVT3948 Probable disease resistan no no 0.770 0.459 0.316 3e-51
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function desciption
 Score =  262 bits (669), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 174/476 (36%), Positives = 265/476 (55%), Gaps = 49/476 (10%)

Query: 109 FVSNSEIPKRQLIDYWISEGFVCDF-----DDGCDFIDDLLQACLLEEEGDDHVKMHDMI 163
           F  +  I K  L+DYWI EGF+        + G + I  L+++CLL EE  + VKMHD++
Sbjct: 416 FPEDHNIEKNDLVDYWIGEGFIDRNKGKAENQGYEIIGILVRSCLLMEENQETVKMHDVV 475

Query: 164 REMSLWIACTVDKEEQNFLVHAGVELTEAPKFEEWEGAKRVSLMGNGIRSLSEIPTCPRL 223
           REM+LWIA    K+++NF+V AG++    P+ E+W+ A+RVSLM N I S+ + P  P+L
Sbjct: 476 REMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQL 535

Query: 224 VTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKLP----------------SGIRG 267
           +TLLL  N +  I+  FF+ M  L VL L +N  LR LP                + IR 
Sbjct: 536 ITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRI 595

Query: 268 LPQELKALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWVVTEEEGNVLCED 327
            P  L  L KL YLNL+YTR +  I    ISG + L+VLRLF  GF             +
Sbjct: 596 WPAGLVELRKLLYLNLEYTRMVESICG--ISGLTSLKVLRLFVSGF------------PE 641

Query: 328 AEPLMKELLGSKHLNVLSWTFRSSLGVQNFLKYPKLVSITQSVLVKSGVHTSPPFNVLH- 386
              ++ EL   ++L  L+ T   +  ++ FL   +L S T+++ ++   + +P  +V+  
Sbjct: 642 DPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIE---NLNPQSSVISF 698

Query: 387 LAYMENLQKFELESCNLEEMKIDSTEEVKKLF----QSGFRSLNTVSVHYCRKAKDLTWL 442
           +A M++LQ+      ++ E+K+   E V  L      + F +L+ VS+ +C + +DLTWL
Sbjct: 699 VATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWL 758

Query: 443 VFVQNLKVLRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYLSISWGTNLKSVYPN 502
           +F  NL VLR+    D++E+I+ +K    ++I       F +L+ L +     LK ++  
Sbjct: 759 IFAPNLTVLRVISASDLKEVINKEKAEQQNLIP------FQELKELRLENVQMLKHIHRG 812

Query: 503 PLPFPKLKKIDVCHCPQLKKLPLNSSSAKERRVVIEGEKKWWEELQWEDQATQNAF 558
           PLPFP L+KI V  C +L+KLPLN +S     +VIE  KKW E L+WED+AT+  F
Sbjct: 813 PLPFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARF 868




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q9LVT3|DRL38_ARATH Probable disease resistance protein At5g47260 OS=Arabidopsis thaliana GN=At5g47260 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query566
24461865 892 NBS-LRR type disease resistance protein 0.773 0.491 0.472 5e-99
24461866 890 NBS-LRR type disease resistance protein 0.773 0.492 0.450 3e-98
24461864 899 NBS-LRR type disease resistance protein 0.795 0.500 0.443 5e-92
24461861 890 NBS-LRR type disease resistance protein 0.761 0.484 0.452 5e-90
24461863 889 NBS-LRR type disease resistance protein 0.780 0.497 0.439 2e-85
225443158 903 PREDICTED: probable disease resistance p 0.828 0.519 0.406 7e-84
224122896 820 cc-nbs-lrr resistance protein [Populus t 0.756 0.521 0.414 1e-83
359482672 905 PREDICTED: probable disease resistance p 0.810 0.507 0.406 9e-79
255553103 910 Disease resistance protein RPS5, putativ 0.780 0.485 0.395 1e-77
225442867 893 PREDICTED: probable disease resistance p 0.768 0.487 0.399 2e-77
>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  368 bits (944), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 221/468 (47%), Positives = 299/468 (63%), Gaps = 30/468 (6%)

Query: 115 IPKRQLIDYWISEGFVCDFD------DGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSL 168
           I K +LID WI E  + + D      +G   +  LL ACLLEE GD  VKMHD+IR+M+L
Sbjct: 424 ISKEKLIDCWIGERLLTERDRTGEQKEGYHILGILLHACLLEEGGDGEVKMHDVIRDMAL 483

Query: 169 WIACTVDKEEQNFLVHAGVELTEAPKFEEWEGAKRVSLMGNGIRSLSEIPTCPRLVTLLL 228
           WIAC +++E++NF V+AGV L EAP    WE A+R+SLM N IR+LSEIPTCP L+TLLL
Sbjct: 484 WIACDIEREKENFFVYAGVGLVEAPDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLLL 543

Query: 229 GGNRIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGL----------------PQEL 272
             N + +I + FFQ M +L+VL+L  +  L KLP GI  L                P EL
Sbjct: 544 NENNLRKIQNYFFQFMPSLKVLNLS-HCELTKLPVGISELVSLQHLDLSESDIEEFPGEL 602

Query: 273 KALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWVVTE-EEGNVLCEDAEPL 331
           KAL  L+ L+L+YTR L  IP QLIS  S+L VLR+FG       E  E ++L    E +
Sbjct: 603 KALVNLKCLDLEYTRNLITIPRQLISNLSRLRVLRMFGASHNAFDEASENSILFGGGELI 662

Query: 332 MKELLGSKHLNVLSWTFRSSLGVQNFLKYPKLVSITQSVLVKSGVHTSPPFNVLHLAYME 391
           ++ELLG KHL V++ T RSS G+Q+FL   KL S TQ++L++     S    V  LA ++
Sbjct: 663 VEELLGLKHLEVITLTLRSSYGLQSFLNSHKLRSCTQALLLQH-FKDSTSLEVSALADLK 721

Query: 392 NLQKFEL-ESCNLEEMKIDSTEEVKKLFQSGFRSLNTVSVHYCRKAKDLTWLVFVQNLKV 450
            L + ++  S  LEE+K+D  EEV+   Q  FRSLN V +  C + KDLT+LVF  NLK 
Sbjct: 722 QLNRLQIANSVILEELKMDYAEEVQ---QFAFRSLNMVEICNCIQLKDLTFLVFAPNLKS 778

Query: 451 LRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYLSISWGTNLKSVYPNPLPFPKLK 510
           +++G C+ MEEI S  K  ++  ++ +  N F +L+ L ++   NLKS+Y   LPFP LK
Sbjct: 779 IKVGICHAMEEIASEGKFAEVPEVMAN-LNPFEKLQNLEVAGARNLKSIYWKSLPFPHLK 837

Query: 511 KIDVCHCPQLKKLPLNSSSAKERRVVIEGEKKWWEELQWEDQATQNAF 558
            +   HC +LKKLPL+S+SAKER++VI GE+ W E+LQWED+AT+NAF
Sbjct: 838 AMSFLHCKKLKKLPLDSNSAKERKIVISGERNWREQLQWEDEATRNAF 885




Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122896|ref|XP_002318943.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857319|gb|EEE94866.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255553103|ref|XP_002517594.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223543226|gb|EEF44758.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query566
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.772 0.488 0.353 3.2e-69
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.780 0.497 0.352 4.3e-69
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.784 0.501 0.344 3.4e-67
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.879 0.560 0.341 1.8e-64
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.761 0.479 0.334 9.2e-64
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.772 0.494 0.342 2.6e-63
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.756 0.479 0.318 5.5e-61
TAIR|locus:2153474874 AT5G05400 [Arabidopsis thalian 0.782 0.506 0.336 6.9e-61
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.727 0.484 0.327 5.7e-60
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.667 0.390 0.349 2e-57
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 566 (204.3 bits), Expect = 3.2e-69, Sum P(2) = 3.2e-69
 Identities = 170/481 (35%), Positives = 247/481 (51%)

Query:   105 CSKNFVSNSEIPKRQLIDYWI-------SEXXXXXXXXXXXXXXXLLQACLLEEEG--DD 155
             CS  F  +  + K +LIDYWI       +E               L++ACLL EE    +
Sbjct:   414 CSL-FPEDYRMEKERLIDYWICEGFIDENESRERALSQGYEIIGILVRACLLLEEAINKE 472

Query:   156 HVKMHDMIREMSLWIACTVDKEEQNFLVHAGVELTEAPKFEEWEGAKRVSLMGNGIRSLS 215
              VKMHD++REM+LWIA  + + ++  +V  GV L E PK + W   +R+SLM N I  LS
Sbjct:   473 QVKMHDVVREMALWIASDLGEHKERCIVQVGVGLREVPKVKNWSSVRRMSLMENEIEILS 532

Query:   216 EIPTCPRLVTLLLGGN-RIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKA 274
               P C  L TL L  N  +  I+D FF+ +  L VL L  N SLRKLP+       ++  
Sbjct:   533 GSPECLELTTLFLQKNDSLLHISDEFFRCIPMLVVLDLSGNSSLRKLPN-------QISK 585

Query:   275 LEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGC-------GFWVVTEEEGNVLCED 327
             L  LRYL+L +T ++  +P  L     KL  LRL          G   ++      L + 
Sbjct:   586 LVSLRYLDLSWT-YIKRLPVGL-QELKKLRYLRLDYMKRLKSISGISNISSLRKLQLLQS 643

Query:   328 AEPL----MKELLGSKHLNVLSWTFRSSLGVQNFLKYPKLVSITQSVLVKSGVHTSPPFN 383
                L    ++EL   +HL VL+ + +SSL V+  L  P+LV   Q +LV  GV       
Sbjct:   644 KMSLDMSLVEELQLLEHLEVLNISIKSSLVVEKLLNAPRLVKCLQ-ILVLRGVQEESS-G 701

Query:   384 VLHLAYMENLQKFELESCNLEEMKID----STEEVKKLFQSGFRSLNTVSVHYCRKAKDL 439
             VL L  M+NL K  +  C + E+KI+    S    +        +L+TV +  C   KDL
Sbjct:   702 VLTLPDMDNLNKVIIRKCGMCEIKIERKTLSLSSNRSPKTQFLHNLSTVHISSCDGLKDL 761

Query:   440 TWLVFVQNLKVLRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYLSISWGTNLKSV 499
             TWL+F  NL  L + D   +E II+ +K   +S II      F +LE L +     L+S+
Sbjct:   762 TWLLFAPNLTSLEVLDSELVEGIINQEKAMTMSGIIP-----FQKLESLRLHNLAMLRSI 816

Query:   500 YPNPLPFPKLKKIDVCHCPQLKKLPLNSSSA-KERRVVIE-GEKKWWEELQWEDQATQNA 557
             Y  PL FP LK I +  CP+L+KLPL+S  A ++  +VI+  E++W E ++W+++AT+  
Sbjct:   817 YWQPLSFPCLKTIHITKCPELRKLPLDSEIAIRDEELVIKYQEEEWLERVEWDNEATRLR 876

Query:   558 F 558
             F
Sbjct:   877 F 877


GO:0006952 "defense response" evidence=IGI;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XIII000034
cc-nbs-lrr resistance protein (820 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 44.5 bits (106), Expect = 3e-06
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 7/67 (10%)

Query: 222 RLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKALEKLRYL 281
            L +L L  NR+  I DG F+ +  L+VL L  N +L  +       P+    L  LR L
Sbjct: 1   NLKSLDLSNNRLTVIPDGAFKGLPNLKVLDLSGN-NLTSIS------PEAFSGLPSLRSL 53

Query: 282 NLDYTRF 288
           +L     
Sbjct: 54  DLSGNNL 60


Length = 60

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 566
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.81
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.79
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.75
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.73
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.69
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.64
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.56
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.54
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.53
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.48
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.44
KOG0617264 consensus Ras suppressor protein (contains leucine 99.35
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.34
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.33
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.33
KOG0617264 consensus Ras suppressor protein (contains leucine 99.32
KOG4237498 consensus Extracellular matrix protein slit, conta 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.97
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.96
KOG4237498 consensus Extracellular matrix protein slit, conta 98.88
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.86
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.86
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.69
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.65
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.64
KOG4341483 consensus F-box protein containing LRR [General fu 98.6
KOG4341483 consensus F-box protein containing LRR [General fu 98.59
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.49
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.47
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.44
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.38
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.24
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.23
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.19
PLN03150623 hypothetical protein; Provisional 98.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.02
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.0
PLN03150623 hypothetical protein; Provisional 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.98
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.84
PRK15386 426 type III secretion protein GogB; Provisional 97.82
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.72
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.71
PRK15386426 type III secretion protein GogB; Provisional 97.7
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.56
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.48
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.38
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.29
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.09
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.02
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.88
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.84
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.52
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.99
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.47
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.4
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.31
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.19
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.11
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.65
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.19
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.9
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.2
smart0037026 LRR Leucine-rich repeats, outliers. 92.2
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 91.65
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.55
smart0037026 LRR Leucine-rich repeats, outliers. 89.56
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.56
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.43
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.84
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 81.88
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.3e-55  Score=479.55  Aligned_cols=525  Identities=32%  Similarity=0.463  Sum_probs=401.2

Q ss_pred             CCCceeecchhhhhhhhhhhhcccccchhchHHhHHHHHHHHHHHHHHHHHHHHHH---HHH--HhccccccCcchhhHH
Q 008415            1 MGNLISTFLPADLFDRTSNCVGEQAKYVWGLEKNLRVLETELHKLTRARADLKTKV---EIE--EQRPRTRRTNQVAGWL   75 (566)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~l~~~~~~L~~i~~~i~~k~---~la--~~~g~l~~~~~~~~W~   75 (566)
                      ||.+..+.+.|-..++||++|.+.|+.... ...        +++.++|++|+++|   |+|  ++||.|+.|+++++|+
T Consensus       306 m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~-~~~--------~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~  376 (889)
T KOG4658|consen  306 MGVDYPIEVECLTPEEAWDLFQKKVGPNTL-GSH--------PDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWR  376 (889)
T ss_pred             ccCCccccccccCccccHHHHHHhhccccc-ccc--------ccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHH
Confidence            788889999998889999999999975421 111        12678888889888   888  6689999999999999


Q ss_pred             HHHHHHHHh--------------hHHHhhhchHHHHHHHhcccccCccccCCC---CChHHHHHHHHhcCCCccccc---
Q 008415           76 EDVQKLETE--------------YTELERDRAQEMDRLCLGGLCSKNFVSNSE---IPKRQLIDYWISEGFVCDFDD---  135 (566)
Q Consensus        76 ~~~~~l~~~--------------~~~~~~~~L~~~lK~Cf~lyc~~~~~~Fp~---i~~~~Li~~wiaegfi~~~~~---  135 (566)
                      ++.+.+.+.              +.+++|++||+++|.|| +||    |+|||   |++++||.+||||||+.+...   
T Consensus       377 ~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CF-Lyc----alFPED~~I~~e~Li~yWiaEGfi~~~~~~~~  451 (889)
T KOG4658|consen  377 RALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCF-LYC----ALFPEDYEIKKEKLIEYWIAEGFIDPLDGGET  451 (889)
T ss_pred             HHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHH-Hhh----ccCCcccccchHHHHHHHHhccCcCccccccc
Confidence            999887653              23577899999999999 999    99999   999999999999999988442   


Q ss_pred             ----HhHHHHHHHHcccccccC----CcceecchhHHHHHHHHhcccCcccceEEEecCCccccCCCccccccccEEEee
Q 008415          136 ----GCDFIDDLLQACLLEEEG----DDHVKMHDMIREMSLWIACTVDKEEQNFLVHAGVELTEAPKFEEWEGAKRVSLM  207 (566)
Q Consensus       136 ----~~~~~~~L~~r~ll~~~~----~~~~~mHdli~dl~~~i~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~lr~Lsl~  207 (566)
                          |++|+.+|++++|++.++    ..+|+|||+|||||.|+|++.+..+++.++..+.+....|+...+..+|++++.
T Consensus       452 ~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~  531 (889)
T KOG4658|consen  452 AEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLM  531 (889)
T ss_pred             hhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEe
Confidence                999999999999999973    478999999999999999988887778777777677778889999999999999


Q ss_pred             cCCcccccCCCCCCCccEEEecCCc--ccccchHHHhcCccCCEEecCCCCCCccccccccccCcchhccccCcEecccC
Q 008415          208 GNGIRSLSEIPTCPRLVTLLLGGNR--IEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKALEKLRYLNLDY  285 (566)
Q Consensus       208 ~~~~~~l~~~~~~~~Lr~L~l~~~~--l~~lp~~~~~~l~~Lr~L~L~~~~~i~~lp~~i~~LP~~i~~L~~L~~L~L~~  285 (566)
                      ++.+..++....++.|++|.+.++.  +..++..+|..|+.||+|||++|..+.+||+       +|++|.|||||++++
T Consensus       532 ~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~-------~I~~Li~LryL~L~~  604 (889)
T KOG4658|consen  532 NNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPS-------SIGELVHLRYLDLSD  604 (889)
T ss_pred             ccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCCh-------HHhhhhhhhcccccC
Confidence            9999999988999999999999995  7889988899999999999999867765555       569999999999999


Q ss_pred             cccCCccchhhhcCCCCCcEEEecCCCCccc----------ccccc--cccccCccchHhhhcCCCCCceEEEEEcCccc
Q 008415          286 TRFLSIIPHQLISGFSKLEVLRLFGCGFWVV----------TEEEG--NVLCEDAEPLMKELLGSKHLNVLSWTFRSSLG  353 (566)
Q Consensus       286 ~~~l~~lP~~~i~~L~~L~~L~l~~~~~~~~----------~~~~~--~~~~~~~~~~~~~l~~L~~L~~L~i~~~~~~~  353 (566)
                      + .++.+|.+ +++|+.|.+|++..+.....          ++.+.  ......+...+.++.+|++|+.++++..+...
T Consensus       605 t-~I~~LP~~-l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~~ls~~~~s~~~  682 (889)
T KOG4658|consen  605 T-GISHLPSG-LGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSALSNDKLLLKELENLEHLENLSITISSVLL  682 (889)
T ss_pred             C-CccccchH-HHHHHhhheeccccccccccccchhhhcccccEEEeeccccccchhhHHhhhcccchhhheeecchhHh
Confidence            8 88899988 89999999998887664331          00000  00112234455566666666666665433322


Q ss_pred             hhccccCCcccccceEEEEecccCCCCCeeeeccccccCcceEEEeccc-cceeeecccccccccCcc-CCCcccEEecc
Q 008415          354 VQNFLKYPKLVSITQSVLVKSGVHTSPPFNVLHLAYMENLQKFELESCN-LEEMKIDSTEEVKKLFQS-GFRSLNTVSVH  431 (566)
Q Consensus       354 ~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~-l~~l~~~~~~~~~~~~~~-~l~~L~~L~L~  431 (566)
                      ++.+.....+.+..+.+.+.+ +  .......++..+.+|+.|.|.+|. .+. ...+..   ..... .|+++.++.+.
T Consensus       683 ~e~l~~~~~L~~~~~~l~~~~-~--~~~~~~~~~~~l~~L~~L~i~~~~~~e~-~~~~~~---~~~~~~~f~~l~~~~~~  755 (889)
T KOG4658|consen  683 LEDLLGMTRLRSLLQSLSIEG-C--SKRTLISSLGSLGNLEELSILDCGISEI-VIEWEE---SLIVLLCFPNLSKVSIL  755 (889)
T ss_pred             HhhhhhhHHHHHHhHhhhhcc-c--ccceeecccccccCcceEEEEcCCCchh-hccccc---ccchhhhHHHHHHHHhh
Confidence            233332222222333333322 1  123334567888999999999999 442 222221   01112 27789999999


Q ss_pred             cCcCCCCCchhhccCCcceEeEecccCcccccccccccccccccCCCCcccccccee-eccccccccccCCCCCCCCCcc
Q 008415          432 YCRKAKDLTWLVFVQNLKVLRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYL-SISWGTNLKSVYPNPLPFPKLK  510 (566)
Q Consensus       432 ~c~~l~~l~~l~~l~~L~~L~L~~~~~l~~i~~~~~~~~~~~~l~~~~~~f~~L~~L-~L~~~~~L~~l~~~~~~~p~L~  510 (566)
                      +|...+++.|....|+|+.|.+..|..++.+++.......   .......|+++..+ .+.+.+.+.++......++.|+
T Consensus       756 ~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~---l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l~~~~l~  832 (889)
T KOG4658|consen  756 NCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALLE---LKELILPFNKLEGLRMLCSLGGLPQLYWLPLSFLKLE  832 (889)
T ss_pred             ccccccccchhhccCcccEEEEecccccccCCCHHHHhhh---cccEEecccccccceeeecCCCCceeEecccCccchh
Confidence            9999999999889999999999999999987753322110   11124567777888 5888888888877778889999


Q ss_pred             EEeecCCCCCCCCCCCCcccc---CCcEEEechhhhhhcccccchhhhhhc
Q 008415          511 KIDVCHCPQLKKLPLNSSSAK---ERRVVIEGEKKWWEELQWEDQATQNAF  558 (566)
Q Consensus       511 ~L~i~~C~~L~~lP~~~~~~l---~~L~i~~~~~~~~~~l~~~~~~~~~~~  558 (566)
                      .+.+..||++..+|.......   ....+..-+.+|.+.+.|++++++..|
T Consensus       833 ~~~ve~~p~l~~~P~~~~~~i~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~  883 (889)
T KOG4658|consen  833 ELIVEECPKLGKLPLLSTLTIVGCEEKLKEYPDGEWLEGVYWEDELTKLRF  883 (889)
T ss_pred             heehhcCcccccCccccccceeccccceeecCCccceeeEEehhhhhhhhc
Confidence            999999999999998765541   133444445668899999999999888



>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 8e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 9e-04
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure

Iteration: 1

Score = 42.0 bits (97), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 8/87 (9%) Query: 223 LVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKALEKLRYLN 282 L L LGGN+++ + +G F +++L L+L N L+ LP+G+ L +L+ L Sbjct: 54 LTQLYLGGNKLQSLPNGVFNKLTSLTYLNLSTN-QLQSLPNGV------FDKLTQLKELA 106 Query: 283 LDYTRFLSIIPHQLISGFSKLEVLRLF 309 L+ T L +P + ++L+ LRL+ Sbjct: 107 LN-TNQLQSLPDGVFDKLTQLKDLRLY 132
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-05
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 5e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-04
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
 Score = 70.8 bits (174), Expect = 5e-14
 Identities = 21/114 (18%), Positives = 46/114 (40%), Gaps = 10/114 (8%)

Query: 200 GAKRVSLMGNGIRSLSEIPTCPRLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLR 259
             +   +    I+ +  +P  P   TL L    +  I    F ++  +  + + I+++L+
Sbjct: 12  QEEDFRVTCKDIQRIPSLP--PSTQTLKLIETHLRTIPSHAFSNLPNISRIYVSIDVTLQ 69

Query: 260 KLPSGI-RGLPQELKALEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCG 312
           +L S     L +       + ++ +  TR L+ I    +     L+ L +F  G
Sbjct: 70  QLESHSFYNLSK-------VTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTG 116


>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query566
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.86
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.85
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.85
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.85
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.85
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.84
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.84
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.84
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.84
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.83
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.82
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.82
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.81
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.8
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.8
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.8
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.79
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.79
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.79
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.79
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.79
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.75
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.74
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.73
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.72
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.71
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.71
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.68
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.67
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.67
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.67
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.65
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.64
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.64
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.63
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.6
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.59
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.58
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.57
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.57
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.55
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.55
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.54
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.53
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.51
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.51
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.51
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.5
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.48
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.47
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.46
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.45
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.45
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.44
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.44
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.44
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.43
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.42
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.42
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.41
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.4
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.39
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.39
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.39
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.38
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.37
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.37
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.33
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.32
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.3
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.29
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.28
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.26
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.25
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.25
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.23
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.21
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.21
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.2
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.04
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.03
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.03
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.02
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.01
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.98
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.95
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.91
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.9
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.9
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.87
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.79
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.69
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.54
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.51
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.03
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.96
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.78
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.71
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.69
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.68
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.42
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.4
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.35
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.94
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.84
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.56
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.92
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 84.83
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
Probab=99.90  E-value=4.7e-23  Score=210.99  Aligned_cols=278  Identities=19%  Similarity=0.193  Sum_probs=174.8

Q ss_pred             ccccccEEEeecCCcccccC--CCCCCCccEEEecCCcccccchHHHhcCccCCEEecCCCCCCccccccccccCcchhc
Q 008415          197 EWEGAKRVSLMGNGIRSLSE--IPTCPRLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKLPSGIRGLPQELKA  274 (566)
Q Consensus       197 ~~~~lr~Lsl~~~~~~~l~~--~~~~~~Lr~L~l~~~~l~~lp~~~~~~l~~Lr~L~L~~~~~i~~lp~~i~~LP~~i~~  274 (566)
                      ...+++++++.++.+..+|.  +..+++|++|++++|.+..++...|+.+++|++|++++| .++.+|...      +++
T Consensus        43 ~l~~l~~l~l~~~~l~~l~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n-~l~~~~~~~------~~~  115 (390)
T 3o6n_A           43 TLNNQKIVTFKNSTMRKLPAALLDSFRQVELLNLNDLQIEEIDTYAFAYAHTIQKLYMGFN-AIRYLPPHV------FQN  115 (390)
T ss_dssp             GGCCCSEEEEESCEESEECTHHHHHCCCCSEEECTTSCCCEECTTTTTTCTTCCEEECCSS-CCCCCCTTT------TTT
T ss_pred             ccCCceEEEecCCchhhCChhHhcccccCcEEECCCCcccccChhhccCCCCcCEEECCCC-CCCcCCHHH------hcC
Confidence            45788999999998888876  467899999999999888887756889999999999999 888766443      788


Q ss_pred             cccCcEecccCcccCCccchhhhcCCCCCcEEEecCCCCcccccccccccccCccchHhhhcCCCCCceEEEEEcCccch
Q 008415          275 LEKLRYLNLDYTRFLSIIPHQLISGFSKLEVLRLFGCGFWVVTEEEGNVLCEDAEPLMKELLGSKHLNVLSWTFRSSLGV  354 (566)
Q Consensus       275 L~~L~~L~L~~~~~l~~lP~~~i~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~~L~i~~~~~~~~  354 (566)
                      +++|++|++++| .++.+|.++++++++|++|++++|.+..              .....++.+++|+.|+++.+.....
T Consensus       116 l~~L~~L~L~~n-~l~~l~~~~~~~l~~L~~L~L~~n~l~~--------------~~~~~~~~l~~L~~L~l~~n~l~~~  180 (390)
T 3o6n_A          116 VPLLTVLVLERN-DLSSLPRGIFHNTPKLTTLSMSNNNLER--------------IEDDTFQATTSLQNLQLSSNRLTHV  180 (390)
T ss_dssp             CTTCCEEECCSS-CCCCCCTTTTTTCTTCCEEECCSSCCCB--------------CCTTTTSSCTTCCEEECCSSCCSBC
T ss_pred             CCCCCEEECCCC-ccCcCCHHHhcCCCCCcEEECCCCccCc--------------cChhhccCCCCCCEEECCCCcCCcc
Confidence            999999999999 7889988756889999999999887754              3445577888888888886543332


Q ss_pred             hccccCCcccccceEEEEecccCCCCCeeeeccccccCcceEEEeccccceeeecccc-----------cccccCccCCC
Q 008415          355 QNFLKYPKLVSITQSVLVKSGVHTSPPFNVLHLAYMENLQKFELESCNLEEMKIDSTE-----------EVKKLFQSGFR  423 (566)
Q Consensus       355 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~l~~~~~~-----------~~~~~~~~~l~  423 (566)
                      .     ....++|+.|.+++ ..    .  ..+...++|+.|++++|.+..++.....           .........++
T Consensus       181 ~-----~~~l~~L~~L~l~~-n~----l--~~~~~~~~L~~L~l~~n~l~~~~~~~~~~L~~L~l~~n~l~~~~~l~~l~  248 (390)
T 3o6n_A          181 D-----LSLIPSLFHANVSY-NL----L--STLAIPIAVEELDASHNSINVVRGPVNVELTILKLQHNNLTDTAWLLNYP  248 (390)
T ss_dssp             C-----GGGCTTCSEEECCS-SC----C--SEEECCSSCSEEECCSSCCCEEECCCCSSCCEEECCSSCCCCCGGGGGCT
T ss_pred             c-----cccccccceeeccc-cc----c--cccCCCCcceEEECCCCeeeeccccccccccEEECCCCCCcccHHHcCCC
Confidence            1     22235666666665 21    1  1122334566666655553332211000           00001112344


Q ss_pred             cccEEecccCcCCCCC-c-hhhccCCcceEeEecccCcccccccccccccccccCCCCccccccceeeccccccccccCC
Q 008415          424 SLNTVSVHYCRKAKDL-T-WLVFVQNLKVLRIGDCYDMEEIISVDKLRDISVIIGSEHNFFAQLEYLSISWGTNLKSVYP  501 (566)
Q Consensus       424 ~L~~L~L~~c~~l~~l-~-~l~~l~~L~~L~L~~~~~l~~i~~~~~~~~~~~~l~~~~~~f~~L~~L~L~~~~~L~~l~~  501 (566)
                      +|+.|+++++. +..+ + .+..+++|++|++++|.. +.+             +.....+|+|+.|+++++ .++.++.
T Consensus       249 ~L~~L~Ls~n~-l~~~~~~~~~~l~~L~~L~L~~n~l-~~~-------------~~~~~~l~~L~~L~L~~n-~l~~~~~  312 (390)
T 3o6n_A          249 GLVEVDLSYNE-LEKIMYHPFVKMQRLERLYISNNRL-VAL-------------NLYGQPIPTLKVLDLSHN-HLLHVER  312 (390)
T ss_dssp             TCSEEECCSSC-CCEEESGGGTTCSSCCEEECCSSCC-CEE-------------ECSSSCCTTCCEEECCSS-CCCCCGG
T ss_pred             CccEEECCCCc-CCCcChhHccccccCCEEECCCCcC-ccc-------------CcccCCCCCCCEEECCCC-cceecCc
Confidence            45555554432 2222 1 244445555555544422 111             123455677777777765 4555554


Q ss_pred             CCCCCCCccEEeecCCCCCCCCCC
Q 008415          502 NPLPFPKLKKIDVCHCPQLKKLPL  525 (566)
Q Consensus       502 ~~~~~p~L~~L~i~~C~~L~~lP~  525 (566)
                      ....+++|+.|++.+| .++.+|.
T Consensus       313 ~~~~l~~L~~L~L~~N-~i~~~~~  335 (390)
T 3o6n_A          313 NQPQFDRLENLYLDHN-SIVTLKL  335 (390)
T ss_dssp             GHHHHTTCSEEECCSS-CCCCCCC
T ss_pred             cccccCcCCEEECCCC-ccceeCc
Confidence            4455677777777775 4666663



>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 566
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 46.5 bits (109), Expect = 6e-06
 Identities = 21/127 (16%), Positives = 45/127 (35%), Gaps = 14/127 (11%)

Query: 182 LVHAGVELTEAPKFEEWEGAKRVSLMGNGIRSLSEIPTCPRLVTLLLGGNRIEEITDGFF 241
           L     +++             + L  N +  +S I     L  L L  N I +I+    
Sbjct: 268 LKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP--V 325

Query: 242 QSMSTLRVLSLRINISLRKLPSGIRGLPQELKALEKLRYLNLDYTRFLSIIPHQLISGFS 301
            S++ L+ L    N         +  +   L  L  + +L+  + +   + P   ++  +
Sbjct: 326 SSLTKLQRLFFANN--------KVSDVS-SLANLTNINWLSAGHNQISDLTP---LANLT 373

Query: 302 KLEVLRL 308
           ++  L L
Sbjct: 374 RITQLGL 380


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query566
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.77
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.71
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.61
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.59
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.57
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.48
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.4
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.32
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.28
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.26
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.05
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.92
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.9
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.75
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.71
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.31
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.25
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.02
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.97
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.69
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.05
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.84
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.66
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.47
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.80  E-value=1.6e-18  Score=174.14  Aligned_cols=75  Identities=17%  Similarity=0.344  Sum_probs=45.4

Q ss_pred             ecCCccccCCCccccccccEEEeecCCcccccCCCCCCCccEEEecCCcccccchHHHhcCccCCEEecCCCCCCccc
Q 008415          184 HAGVELTEAPKFEEWEGAKRVSLMGNGIRSLSEIPTCPRLVTLLLGGNRIEEITDGFFQSMSTLRVLSLRINISLRKL  261 (566)
Q Consensus       184 ~~~~~~~~~~~~~~~~~lr~Lsl~~~~~~~l~~~~~~~~Lr~L~l~~~~l~~lp~~~~~~l~~Lr~L~L~~~~~i~~l  261 (566)
                      ..+.++..+..+..++++++|++++|++++++.+..+++|+.|++++|.+..+++  ++++++|++|+++++ .++.+
T Consensus        51 l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~~--l~~l~~L~~L~~~~~-~~~~~  125 (384)
T d2omza2          51 ADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITP--LANLTNLTGLTLFNN-QITDI  125 (384)
T ss_dssp             CCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSS-CCCCC
T ss_pred             CCCCCCCCccccccCCCCCEEeCcCCcCCCCccccCCcccccccccccccccccc--ccccccccccccccc-ccccc
Confidence            3344444444455556666666666666666666666666666666666665553  566666666666665 54443



>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure