Citrus Sinensis ID: 008466

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560----
MATAVLPQDAKKLPRPGRGGFQAHGLTEEEARVRAIAEIVNSMVELSRKNETVDLNAIKSAACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTREAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCPELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVISGVGTRHYYRKLGYELEGPYMVKYLE
cccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccHHHHHHcccHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccEEccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHccccEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHcccccccEEEEEEEEEEcccHHHHHHHccccccccHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEEEEEcccEEEEEEEEcccccEEEEEcccccccccccccccccccccEEEEEEccccEEccccccccHHHccHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHcccEEcccccccccc
cccEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccHHHHHHHccHHHHHHHHHHHHcccccEEccEEEEEEEccccccccEEccccEEEEccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEEEEEccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHccccEEEEEEEEEcccccccHHHHHHHHHccccEEEEEEEcHHHHHHHHHcccccHHHHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHccccccccccEEEcEEEEcccHHHHHHHccccccccHHHHHHHHHHHHHHccccEEEEEEEcccccHHHccccccccHHHHHHHHHHHccccccEEEEEEEcHHHcccccccccEEEEEEEEEccccEEEEEEEccccccEEEEEEEEcccccccccHHHccccEEEEEEEEcccccEcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHcccccccccHEEccc
matavlpqdakklprpgrggfqahgltEEEARVRAIAEIVNSMVELSRKNETVDLNAIKSAACRKYGLARAPKLVEMIAALPetdreallpklrakpvrtaSGIAVVAVmskphrcphiattgnicvycpggpdsdfeystqsytgyeptsmRAIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMggtfmslpadyRDYFIRNLHDalsghtsanvEEAVTysehgatkcigmtietrpdyclgphlrqMLSYGCTRLEIGVQSTYEDvardtnrghtvAAVADCFCLAKDAGFKVVAHmmpdlpnvgveRDLESFREFfesplfradglkiyptlvirgtglyelwktgryrnyppeqLVDIVARILAmvppwtrvyrvqrdipmplvtsgvekgNLRELALARMDDLGLKCRDVRTREAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLrkcgrnvtcpelmgkcsivrelhvygtavpvhgreadklqhqgYGTLLMEEAERIALGEHRSRKMAVISGVGTRHYYRKLGYELEGPYMVKYLE
matavlpqdakklprpgrggfqahglteeEARVRAIAEIVNSMVELSRKNETVDLNAIKSAACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLESFREFFesplfradglkiyptlvIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVyrvqrdipmplvtsgvekgnlRELALARMDDLGLKCRDVRTReagiqdihhqikpeevelVRRDYVANEGwetflsyedtRQDILVGLLRLRKCGRNVTCPELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIAlgehrsrkmavisgvgtrhyyrklgyelegpymvkyle
MATAVLPQDAKKLPRPGRGGFQAHGLTeeearvraiaeivNSMVELSRKNETVDLNAIKSAACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTREAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCPELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVISGVGTRHYYRKLGYELEGPYMVKYLE
*******************************RVRAIAEIVNSMVELSRKNETVDLNAIKSAACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTREAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCPELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVISGVGTRHYYRKLGYELEGPYMVKY**
*********************************RAIAEIVNSMV***********NAIKSAACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTREAGIQD*HHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCPELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVISGVGTRHYYRKLGYELEGPYMVKYL*
MATAVLPQDAKKLPRPGRGGFQAHGLTEEEARVRAIAEIVNSMVELSRKNETVDLNAIKSAACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTREAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCPELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVISGVGTRHYYRKLGYELEGPYMVKYLE
*************************LTEEEARVRAIAEIVNSMVELSRKNETVDLNAIKSAACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTREAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCPELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVISGVGTRHYYRKLGYELEGPYMVKYLE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATAVLPQDAKKLPRPGRGGFQAHGLTEEEARVRAIAEIVNSMVELSRKNETVDLNAIKSAACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTREAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCPELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVISGVGTRHYYRKLGYELEGPYMVKYLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query564 2.2.26 [Sep-21-2011]
Q93ZR1565 Elongator complex protein yes no 0.998 0.996 0.920 0.0
Q7X7L3573 Elongator complex protein yes no 0.985 0.970 0.919 0.0
Q5ZHS1546 Elongator complex protein yes no 0.966 0.998 0.741 0.0
Q5RIC0548 Elongator complex protein yes no 0.953 0.981 0.741 0.0
Q5HZM6549 Elongator complex protein N/A no 0.971 0.998 0.721 0.0
Q9VQZ6552 Probable elongator comple yes no 0.957 0.978 0.735 0.0
Q6NVL5549 Elongator complex protein yes no 0.953 0.979 0.737 0.0
Q1ZXC6559 Probable elongator comple yes no 0.939 0.948 0.735 0.0
Q9H9T3547 Elongator complex protein yes no 0.955 0.985 0.730 0.0
Q2KJ61547 Elongator complex protein yes no 0.955 0.985 0.729 0.0
>sp|Q93ZR1|ELP3_ARATH Elongator complex protein 3 OS=Arabidopsis thaliana GN=HAG3 PE=1 SV=1 Back     alignment and function desciption
 Score = 1084 bits (2803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/564 (92%), Positives = 544/564 (96%), Gaps = 1/564 (0%)

Query: 1   MATAVLPQ-DAKKLPRPGRGGFQAHGLTEEEARVRAIAEIVNSMVELSRKNETVDLNAIK 59
           MATAV+   + KK PRPG+GG+Q  GLTEEEARVRAI+EIV++M+E S +NE VDLNAIK
Sbjct: 1   MATAVVMNGELKKQPRPGKGGYQGRGLTEEEARVRAISEIVSTMIERSHRNENVDLNAIK 60

Query: 60  SAACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHI 119
           +AACRKYGLARAPKLVEMIAALP+++RE LLPKLRAKPVRTASGIAVVAVMSKPHRCPHI
Sbjct: 61  TAACRKYGLARAPKLVEMIAALPDSERETLLPKLRAKPVRTASGIAVVAVMSKPHRCPHI 120

Query: 120 ATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSV 179
           ATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSV
Sbjct: 121 ATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSV 180

Query: 180 DKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIET 239
           DKVEFILMGGTFMSLPA+YRD+FIRNLHDALSGHTSANVEEAV YSEH ATKCIGMTIET
Sbjct: 181 DKVEFILMGGTFMSLPAEYRDFFIRNLHDALSGHTSANVEEAVAYSEHSATKCIGMTIET 240

Query: 240 RPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVV 299
           RPDYCLGPHLRQML YGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVV
Sbjct: 241 RPDYCLGPHLRQMLIYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVV 300

Query: 300 AHMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPP 359
           AHMMPDLPNVGVERD+ESF+EFFESP FRADGLKIYPTLVIRGTGLYELWKTGRYRNYPP
Sbjct: 301 AHMMPDLPNVGVERDMESFKEFFESPSFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPP 360

Query: 360 EQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVR 419
           EQLVDIVARIL+MVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVR
Sbjct: 361 EQLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVR 420

Query: 420 TREAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTC 479
           TREAGIQDIHH+IKPE+VELVRRDY ANEGWETFLSYEDTRQDILVGLLRLRKCG+NVTC
Sbjct: 421 TREAGIQDIHHKIKPEQVELVRRDYTANEGWETFLSYEDTRQDILVGLLRLRKCGKNVTC 480

Query: 480 PELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVIS 539
           PELMGKCS+VRELHVYGTAVPVHGR+ADKLQHQGYGTLLMEEAERIA  EHRS K+ VIS
Sbjct: 481 PELMGKCSVVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARREHRSNKIGVIS 540

Query: 540 GVGTRHYYRKLGYELEGPYMVKYL 563
           GVGTRHYYRKLGYELEGPYMVK+L
Sbjct: 541 GVGTRHYYRKLGYELEGPYMVKHL 564
Histone acetyltransferase component of the large multiprotein complex Elongator that is involved in the regulation of transcription initiation and elongation. May also have a methyltransferase activity. Promotes organs development by modulating cell division rate. Required for auxin distribution or signaling. Involved in tRNA wobble uridine modification. Mediates the establishment of leaf polarity independently of AS2 and the ta-siRNA-related pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q7X7L3|ELP3_ORYSJ Elongator complex protein 3 OS=Oryza sativa subsp. japonica GN=ELP3 PE=2 SV=2 Back     alignment and function description
>sp|Q5ZHS1|ELP3_CHICK Elongator complex protein 3 OS=Gallus gallus GN=ELP3 PE=2 SV=1 Back     alignment and function description
>sp|Q5RIC0|ELP3_DANRE Elongator complex protein 3 OS=Danio rerio GN=elp3 PE=2 SV=3 Back     alignment and function description
>sp|Q5HZM6|ELP3_XENLA Elongator complex protein 3 OS=Xenopus laevis GN=elp3 PE=2 SV=1 Back     alignment and function description
>sp|Q9VQZ6|ELP3_DROME Probable elongator complex protein 3 OS=Drosophila melanogaster GN=Elp3 PE=2 SV=1 Back     alignment and function description
>sp|Q6NVL5|ELP3_XENTR Elongator complex protein 3 OS=Xenopus tropicalis GN=elp3 PE=2 SV=1 Back     alignment and function description
>sp|Q1ZXC6|ELP3_DICDI Probable elongator complex protein 3 OS=Dictyostelium discoideum GN=elp3 PE=3 SV=1 Back     alignment and function description
>sp|Q9H9T3|ELP3_HUMAN Elongator complex protein 3 OS=Homo sapiens GN=ELP3 PE=1 SV=2 Back     alignment and function description
>sp|Q2KJ61|ELP3_BOVIN Elongator complex protein 3 OS=Bos taurus GN=ELP3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query564
255540377563 Elongator complex protein, putative [Ric 0.996 0.998 0.959 0.0
224136043563 histone acetyltransferase [Populus trich 0.996 0.998 0.952 0.0
224119572563 histone acetyltransferase [Populus trich 0.996 0.998 0.953 0.0
449440592564 PREDICTED: elongator complex protein 3-l 1.0 1.0 0.932 0.0
356508774564 PREDICTED: elongator complex protein 3-l 0.996 0.996 0.936 0.0
356516591564 PREDICTED: elongator complex protein 3-l 0.992 0.992 0.932 0.0
225457433563 PREDICTED: elongator complex protein 3 [ 0.996 0.998 0.928 0.0
297795799565 hypothetical protein ARALYDRAFT_495092 [ 0.998 0.996 0.921 0.0
18423134565 Elongator complex protein 3 [Arabidopsis 0.998 0.996 0.920 0.0
9758914559 histone acetyltransferase [Arabidopsis t 0.984 0.992 0.926 0.0
>gi|255540377|ref|XP_002511253.1| Elongator complex protein, putative [Ricinus communis] gi|223550368|gb|EEF51855.1| Elongator complex protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1116 bits (2886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/563 (95%), Positives = 551/563 (97%), Gaps = 1/563 (0%)

Query: 1   MATAVLPQDAKKLPRPGRGGFQAHGLTEEEARVRAIAEIVNSMVELSRKNETVDLNAIKS 60
           MATAV+  D+KKLPRPGRGG+QAHGLTEEEARVRAIAEIVNSMVELSRKN+TVDLNAIKS
Sbjct: 1   MATAVM-SDSKKLPRPGRGGYQAHGLTEEEARVRAIAEIVNSMVELSRKNQTVDLNAIKS 59

Query: 61  AACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIA 120
           AACRKYGLARAPKLVEMIAALPE+DRE+LLPKLRAKPVRTASGIAVVAVMSKPHRCPHIA
Sbjct: 60  AACRKYGLARAPKLVEMIAALPESDRESLLPKLRAKPVRTASGIAVVAVMSKPHRCPHIA 119

Query: 121 TTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVD 180
           TTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYN YVQARSRIDQLKRLGHSVD
Sbjct: 120 TTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNSYVQARSRIDQLKRLGHSVD 179

Query: 181 KVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETR 240
           KVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAV YSEHGA KCIGMTIETR
Sbjct: 180 KVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVAYSEHGAVKCIGMTIETR 239

Query: 241 PDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVA 300
           PDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVA
Sbjct: 240 PDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVA 299

Query: 301 HMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPE 360
           HMMPDLPNVGVERD+ESFREFFESP FRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPE
Sbjct: 300 HMMPDLPNVGVERDMESFREFFESPSFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPE 359

Query: 361 QLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRT 420
           QLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRT
Sbjct: 360 QLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRT 419

Query: 421 REAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCP 480
           REAGIQDIHH+I+PEEVELVRRDY ANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCP
Sbjct: 420 REAGIQDIHHKIRPEEVELVRRDYTANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCP 479

Query: 481 ELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVISG 540
           ELMGKCSIVRELHVYGTAVPVHGR+ADKLQHQGYGTLLMEEAERIA  EHRS K+AVISG
Sbjct: 480 ELMGKCSIVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARCEHRSTKIAVISG 539

Query: 541 VGTRHYYRKLGYELEGPYMVKYL 563
           VGTRHYYRKLGY LEGPYMVK L
Sbjct: 540 VGTRHYYRKLGYGLEGPYMVKCL 562

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224136043|ref|XP_002322225.1| histone acetyltransferase [Populus trichocarpa] gi|222869221|gb|EEF06352.1| histone acetyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224119572|ref|XP_002318107.1| histone acetyltransferase [Populus trichocarpa] gi|222858780|gb|EEE96327.1| histone acetyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449440592|ref|XP_004138068.1| PREDICTED: elongator complex protein 3-like [Cucumis sativus] gi|449501374|ref|XP_004161350.1| PREDICTED: elongator complex protein 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356508774|ref|XP_003523129.1| PREDICTED: elongator complex protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356516591|ref|XP_003526977.1| PREDICTED: elongator complex protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|225457433|ref|XP_002262701.1| PREDICTED: elongator complex protein 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297795799|ref|XP_002865784.1| hypothetical protein ARALYDRAFT_495092 [Arabidopsis lyrata subsp. lyrata] gi|297311619|gb|EFH42043.1| hypothetical protein ARALYDRAFT_495092 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18423134|ref|NP_568725.1| Elongator complex protein 3 [Arabidopsis thaliana] gi|75305923|sp|Q93ZR1.1|ELP3_ARATH RecName: Full=Elongator complex protein 3; Short=AtELP3; AltName: Full=Elongator component 3; AltName: Full=Protein ELONGATA 3; AltName: Full=Protein ENHANCER-OF-ASYMMETRIC-LEAVES-TWO1 gi|15810569|gb|AAL07172.1| putative histone acetyltransferase [Arabidopsis thaliana] gi|66841024|emb|CAI79647.1| elongator component [Arabidopsis thaliana] gi|332008542|gb|AED95925.1| Elongator complex protein 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9758914|dbj|BAB09451.1| histone acetyltransferase [Arabidopsis thaliana] gi|15810049|gb|AAL06951.1| AT5g50320/MXI22_3 [Arabidopsis thaliana] gi|22137026|gb|AAM91358.1| At5g50320/MXI22_3 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query564
TAIR|locus:2177477565 ELO3 "ELONGATA 3" [Arabidopsis 0.998 0.996 0.898 6.5e-280
UNIPROTKB|Q5ZHS1546 ELP3 "Elongator complex protei 0.925 0.956 0.762 2.6e-221
FB|FBgn0031604552 Elp3 "Elongator complex protei 0.921 0.942 0.751 2.9e-220
UNIPROTKB|E1C2M5548 ELP3 "Elongator complex protei 0.925 0.952 0.759 3.8e-220
ZFIN|ZDB-GENE-050327-35548 elp3 "elongation protein 3 hom 0.923 0.950 0.758 7.9e-220
UNIPROTKB|Q2KJ61547 ELP3 "Elongator complex protei 0.925 0.954 0.749 1.5e-218
UNIPROTKB|Q6NVL5549 elp3 "Elongator complex protei 0.925 0.950 0.756 1.5e-218
UNIPROTKB|Q5HZM6549 elp3 "Elongator complex protei 0.925 0.950 0.750 2.4e-218
RGD|2324506566 Elp3 "elongator acetyltransfer 0.925 0.922 0.750 3.9e-218
UNIPROTKB|Q9H9T3547 ELP3 "Elongator complex protei 0.925 0.954 0.749 5e-218
TAIR|locus:2177477 ELO3 "ELONGATA 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2690 (952.0 bits), Expect = 6.5e-280, P = 6.5e-280
 Identities = 507/564 (89%), Positives = 531/564 (94%)

Query:     1 MATAVLPQ-DAKKLPRPGRGGFQAHGLTXXXXXXXXXXXXXNSMVELSRKNETVDLNAIK 59
             MATAV+   + KK PRPG+GG+Q  GLT             ++M+E S +NE VDLNAIK
Sbjct:     1 MATAVVMNGELKKQPRPGKGGYQGRGLTEEEARVRAISEIVSTMIERSHRNENVDLNAIK 60

Query:    60 SAACRKYGLARAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHI 119
             +AACRKYGLARAPKLVEMIAALP+++RE LLPKLRAKPVRTASGIAVVAVMSKPHRCPHI
Sbjct:    61 TAACRKYGLARAPKLVEMIAALPDSERETLLPKLRAKPVRTASGIAVVAVMSKPHRCPHI 120

Query:   120 ATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSV 179
             ATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSV
Sbjct:   121 ATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSV 180

Query:   180 DKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIET 239
             DKVEFILMGGTFMSLPA+YRD+FIRNLHDALSGHTSANVEEAV YSEH ATKCIGMTIET
Sbjct:   181 DKVEFILMGGTFMSLPAEYRDFFIRNLHDALSGHTSANVEEAVAYSEHSATKCIGMTIET 240

Query:   240 RPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVV 299
             RPDYCLGPHLRQML YGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVV
Sbjct:   241 RPDYCLGPHLRQMLIYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVV 300

Query:   300 AHMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPP 359
             AHMMPDLPNVGVERD+ESF+EFFESP FRADGLKIYPTLVIRGTGLYELWKTGRYRNYPP
Sbjct:   301 AHMMPDLPNVGVERDMESFKEFFESPSFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPP 360

Query:   360 EQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVR 419
             EQLVDIVARIL+MVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVR
Sbjct:   361 EQLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVR 420

Query:   420 TREAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTC 479
             TREAGIQDIHH+IKPE+VELVRRDY ANEGWETFLSYEDTRQDILVGLLRLRKCG+NVTC
Sbjct:   421 TREAGIQDIHHKIKPEQVELVRRDYTANEGWETFLSYEDTRQDILVGLLRLRKCGKNVTC 480

Query:   480 PELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVIS 539
             PELMGKCS+VRELHVYGTAVPVHGR+ADKLQHQGYGTLLMEEAERIA  EHRS K+ VIS
Sbjct:   481 PELMGKCSVVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARREHRSNKIGVIS 540

Query:   540 GVGTRHYYRKLGYELEGPYMVKYL 563
             GVGTRHYYRKLGYELEGPYMVK+L
Sbjct:   541 GVGTRHYYRKLGYELEGPYMVKHL 564
GO:0003824 "catalytic activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008080 "N-acetyltransferase activity" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0004402 "histone acetyltransferase activity" evidence=ISS
GO:0008283 "cell proliferation" evidence=IMP
GO:0035265 "organ growth" evidence=IMP
GO:0009294 "DNA mediated transformation" evidence=IMP
GO:0005719 "nuclear euchromatin" evidence=IDA
GO:0010928 "regulation of auxin mediated signaling pathway" evidence=IMP
GO:0033588 "Elongator holoenzyme complex" evidence=IDA
GO:0002098 "tRNA wobble uridine modification" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0010084 "specification of organ axis polarity" evidence=IMP
GO:2000025 "regulation of leaf formation" evidence=IMP
GO:0051604 "protein maturation" evidence=RCA
UNIPROTKB|Q5ZHS1 ELP3 "Elongator complex protein 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0031604 Elp3 "Elongator complex protein 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2M5 ELP3 "Elongator complex protein 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050327-35 elp3 "elongation protein 3 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ61 ELP3 "Elongator complex protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NVL5 elp3 "Elongator complex protein 3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q5HZM6 elp3 "Elongator complex protein 3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
RGD|2324506 Elp3 "elongator acetyltransferase complex subunit 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H9T3 ELP3 "Elongator complex protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q23651ELP3_CAEEL2, ., 3, ., 1, ., 4, 80.73630.94140.9707yesno
Q5HZM6ELP3_XENLA2, ., 3, ., 1, ., 4, 80.72180.97160.9981N/Ano
Q1ZXC6ELP3_DICDI2, ., 3, ., 1, ., 4, 80.73580.93970.9481yesno
Q02908ELP3_YEAST2, ., 3, ., 1, ., 4, 80.68020.94680.9587yesno
Q6NVL5ELP3_XENTR2, ., 3, ., 1, ., 4, 80.73790.95390.9799yesno
Q9CZX0ELP3_MOUSE2, ., 3, ., 1, ., 4, 80.72720.95560.9853yesno
Q7X7L3ELP3_ORYSJ2, ., 3, ., 1, ., 4, 80.91920.98580.9703yesno
Q9VQZ6ELP3_DROME2, ., 3, ., 1, ., 4, 80.73510.95740.9782yesno
Q5ZHS1ELP3_CHICK2, ., 3, ., 1, ., 4, 80.74120.96630.9981yesno
Q58536Y1136_METJANo assigned EC number0.42580.92190.9611yesno
Q2KJ61ELP3_BOVIN2, ., 3, ., 1, ., 4, 80.72910.95560.9853yesno
Q93ZR1ELP3_ARATH2, ., 3, ., 1, ., 4, 80.92020.99820.9964yesno
Q9H9T3ELP3_HUMAN2, ., 3, ., 1, ., 4, 80.73090.95560.9853yesno
Q60LW7ELP3_CAEBR2, ., 3, ., 1, ., 4, 80.73250.94140.9689N/Ano
Q5RIC0ELP3_DANRE2, ., 3, ., 1, ., 4, 80.74160.95390.9817yesno
O14023ELP3_SCHPO2, ., 3, ., 1, ., 4, 80.69710.94320.9779yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.998
3rd Layer2.3.1.480.993
4th Layer4.1.99.14LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
HAG905
histone acetyltransferase (563 aa)
(Populus trichocarpa)
Predicted Functional Partners:
grail3.0001095301
hypothetical protein (414 aa)
  ••    0.503
gw1.V.3068.1
hypothetical protein (353 aa)
   •• • 0.471
grail3.0001051301
hypothetical protein (85 aa)
    • • 0.461
estExt_Genewise1_v1.C_LG_VII2715
hypothetical protein (380 aa)
   •    0.458
estExt_Genewise1_v1.C_LG_XIII0788
hypothetical protein (118 aa)
  ••    0.449
estExt_fgenesh4_pm.C_1070023
hypothetical protein (554 aa)
   •    0.440
gw1.I.4832.1
hypothetical protein (422 aa)
   •    0.435
gw1.86.17.1
hypothetical protein (573 aa)
   •    0.433
fgenesh4_pm.C_LG_V000540
hypothetical protein (491 aa)
   ••   0.415
estExt_Genewise1_v1.C_LG_IV0024
SubName- Full=Putative uncharacterized protein; (604 aa)
   •    0.408

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query564
COG1243515 COG1243, ELP3, Histone acetyltransferase [Transcri 0.0
TIGR01211522 TIGR01211, ELP3, histone acetyltransferase, ELP3 f 0.0
smart00729216 smart00729, Elp3, Elongator protein 3, MiaB family 1e-23
COG1242312 COG1242, COG1242, Predicted Fe-S oxidoreductase [G 5e-20
TIGR01212302 TIGR01212, TIGR01212, radical SAM protein, TIGR012 1e-19
pfam04055165 pfam04055, Radical_SAM, Radical SAM superfamily 9e-11
TIGR03994401 TIGR03994, rSAM_HemZ, coproporphyrinogen dehydroge 2e-05
COG0635416 COG0635, HemN, Coproporphyrinogen III oxidase and 3e-05
cd01335204 cd01335, Radical_SAM, Radical SAM superfamily 3e-05
PRK05799374 PRK05799, PRK05799, coproporphyrinogen III oxidase 4e-05
PRK08207488 PRK08207, PRK08207, coproporphyrinogen III oxidase 1e-04
PRK08208430 PRK08208, PRK08208, coproporphyrinogen III oxidase 2e-04
COG1244358 COG1244, COG1244, Predicted Fe-S oxidoreductase [G 3e-04
TIGR00539360 TIGR00539, hemN_rel, putative oxygen-independent c 3e-04
PRK08599377 PRK08599, PRK08599, coproporphyrinogen III oxidase 4e-04
TIGR01210313 TIGR01210, TIGR01210, TIGR01210 family protein 9e-04
PRK08446350 PRK08446, PRK08446, coproporphyrinogen III oxidase 0.001
>gnl|CDD|224164 COG1243, ELP3, Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information 
 Score =  722 bits (1865), Expect = 0.0
 Identities = 273/530 (51%), Positives = 354/530 (66%), Gaps = 17/530 (3%)

Query: 36  IAEIVNSMVELSRKNETVDLNAIKSAACRKYGLARAPKLVEMIAALPETDREALLPKLRA 95
             EIV  +  LS + +  +L  +K    RKYGL++ P+  +++ A P  +R  L   LR 
Sbjct: 1   CEEIVEEL--LSGEIKKKELEDLKLEVSRKYGLSKVPRNSDILNAAPPEER--LREILRR 56

Query: 96  KPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAI 155
           KPVRT SG+AVVAVM+ PH CPH       CV+CPGGPD   + S QSYTG EP ++RAI
Sbjct: 57  KPVRTISGVAVVAVMTSPHGCPH-----GRCVFCPGGPD---KDSPQSYTGEEPAALRAI 108

Query: 156 RARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTS 215
           + RY+PY Q R+R+ QL+ +GH+ DKVE I+MGGTF +L  +Y+++F++    A++    
Sbjct: 109 KNRYDPYEQVRARLKQLETIGHTSDKVELIIMGGTFTALSLEYQEWFLKVALKAMNDF-G 167

Query: 216 ANVEEAVTYSEHGATKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDT 275
            ++EEA   +E    +C+G+TIETRPDY    HL QML YG TR+E+GVQS Y+DV   T
Sbjct: 168 YDLEEAQRKNETAELRCVGITIETRPDYIDEEHLDQMLKYGVTRVELGVQSIYDDVLERT 227

Query: 276 NRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLESFREFFESPLFRADGLKIY 335
            RGHTV  V +   L KDAGFKV  H+MP LP    ERDLESFRE FE P FR D LKIY
Sbjct: 228 KRGHTVEDVVEATRLLKDAGFKVGYHIMPGLPGSDFERDLESFREIFEDPRFRPDMLKIY 287

Query: 336 PTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGV 395
           PTLVI GT LYE+WK G Y+ Y  E+ V+++  I  + P W RV R+QRDIP  L+  GV
Sbjct: 288 PTLVIEGTELYEMWKRGLYKPYTTEEAVELIVEIYRLEPKWVRVIRIQRDIPAELIVDGV 347

Query: 396 EKGNLRELALARMDDLGLKCRDVRTREAGIQDIHHQIKP--EEVELVRRDYVANEGWETF 453
           +K NLREL   RM + G+KCR +R RE GI  + + + P  E++ L R +Y A+ G E F
Sbjct: 348 KKSNLRELVENRMREEGIKCRCIRCREVGIVVVKNVVIPPVEQILLKREEYEASGGTEIF 407

Query: 454 LSYEDTRQDILVGLLRLRKCGRNVTCPELMGKCSIVRELHVYGTAVPVHGREADKLQHQG 513
           LSYED + DIL+G LRLR+        E+  K +IVRELHVYG+ VP+  RE D+ QH+G
Sbjct: 408 LSYEDPKNDILIGFLRLREPSEGAHREEIDDKTAIVRELHVYGSEVPIGKRE-DEWQHRG 466

Query: 514 YGTLLMEEAERIALGEHRSRKMAVISGVGTRHYYRKLGYELEGPYMVKYL 563
           YG  L+EEAERIA  E  ++K+ VISG+G R YYRKLGYEL+GPYM K L
Sbjct: 467 YGRELLEEAERIAREEG-AKKILVISGIGVREYYRKLGYELDGPYMSKRL 515

Length = 515
>gnl|CDD|233314 TIGR01211, ELP3, histone acetyltransferase, ELP3 family Back     alignment and domain information
>gnl|CDD|214792 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>gnl|CDD|224163 COG1242, COG1242, Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|130279 TIGR01212, TIGR01212, radical SAM protein, TIGR01212 family Back     alignment and domain information
>gnl|CDD|217866 pfam04055, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|234435 TIGR03994, rSAM_HemZ, coproporphyrinogen dehydrogenase HemZ Back     alignment and domain information
>gnl|CDD|223708 COG0635, HemN, Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|100105 cd01335, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|180263 PRK05799, PRK05799, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236187 PRK08207, PRK08207, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181292 PRK08208, PRK08208, coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>gnl|CDD|224165 COG1244, COG1244, Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|129630 TIGR00539, hemN_rel, putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>gnl|CDD|236309 PRK08599, PRK08599, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|233313 TIGR01210, TIGR01210, TIGR01210 family protein Back     alignment and domain information
>gnl|CDD|181428 PRK08446, PRK08446, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 564
KOG2535554 consensus RNA polymerase II elongator complex, sub 100.0
COG1243515 ELP3 Histone acetyltransferase [Transcription / Ch 100.0
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 100.0
PRK08207488 coproporphyrinogen III oxidase; Provisional 100.0
PRK06582390 coproporphyrinogen III oxidase; Provisional 100.0
PRK09057380 coproporphyrinogen III oxidase; Provisional 100.0
PRK07379400 coproporphyrinogen III oxidase; Provisional 100.0
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe 100.0
PRK06294370 coproporphyrinogen III oxidase; Provisional 100.0
PRK05628375 coproporphyrinogen III oxidase; Validated 100.0
PRK09058449 coproporphyrinogen III oxidase; Provisional 100.0
PRK08446350 coproporphyrinogen III oxidase; Provisional 100.0
PRK05904353 coproporphyrinogen III oxidase; Provisional 100.0
PRK05799374 coproporphyrinogen III oxidase; Provisional 100.0
TIGR00539360 hemN_rel putative oxygen-independent coproporphyri 100.0
PRK05660378 HemN family oxidoreductase; Provisional 100.0
PRK08898394 coproporphyrinogen III oxidase; Provisional 100.0
PRK08599377 coproporphyrinogen III oxidase; Provisional 100.0
PRK08208430 coproporphyrinogen III oxidase; Validated 100.0
PRK13347453 coproporphyrinogen III oxidase; Provisional 100.0
TIGR01212302 radical SAM protein, TIGR01212 family. This unchar 100.0
COG1242312 Predicted Fe-S oxidoreductase [General function pr 100.0
TIGR00538455 hemN oxygen-independent coproporphyrinogen III oxi 100.0
PRK09249453 coproporphyrinogen III oxidase; Provisional 100.0
PRK08629433 coproporphyrinogen III oxidase; Provisional 100.0
TIGR01210313 conserved hypothetical protein TIGR01210. This fam 99.95
TIGR02026497 BchE magnesium-protoporphyrin IX monomethyl ester 99.91
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM 99.91
TIGR01579414 MiaB-like-C MiaB-like tRNA modifying enzyme. This 99.9
PRK14329467 (dimethylallyl)adenosine tRNA methylthiotransferas 99.9
PRK14334440 (dimethylallyl)adenosine tRNA methylthiotransferas 99.89
PRK14340445 (dimethylallyl)adenosine tRNA methylthiotransferas 99.89
PRK07094323 biotin synthase; Provisional 99.89
PRK14327509 (dimethylallyl)adenosine tRNA methylthiotransferas 99.89
PRK14331437 (dimethylallyl)adenosine tRNA methylthiotransferas 99.88
PRK14332449 (dimethylallyl)adenosine tRNA methylthiotransferas 99.88
PRK14333448 (dimethylallyl)adenosine tRNA methylthiotransferas 99.88
PRK14330434 (dimethylallyl)adenosine tRNA methylthiotransferas 99.88
PRK14326502 (dimethylallyl)adenosine tRNA methylthiotransferas 99.88
PRK14325444 (dimethylallyl)adenosine tRNA methylthiotransferas 99.88
PRK14335455 (dimethylallyl)adenosine tRNA methylthiotransferas 99.88
PRK14336418 (dimethylallyl)adenosine tRNA methylthiotransferas 99.88
TIGR00089429 RNA modification enzyme, MiaB family. This subfami 99.87
PRK14339420 (dimethylallyl)adenosine tRNA methylthiotransferas 99.87
PRK14338459 (dimethylallyl)adenosine tRNA methylthiotransferas 99.87
PRK14328439 (dimethylallyl)adenosine tRNA methylthiotransferas 99.87
TIGR01574438 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-3 99.87
TIGR01125430 MiaB-like tRNA modifying enzyme YliG, TIGR01125. T 99.85
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM 99.85
PRK14337446 (dimethylallyl)adenosine tRNA methylthiotransferas 99.85
TIGR01578420 MiaB-like-B MiaB-like tRNA modifying enzyme, archa 99.83
PRK06256336 biotin synthase; Validated 99.83
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 99.82
COG0621437 MiaB 2-methylthioadenine synthetase [Translation, 99.79
PRK14862440 rimO ribosomal protein S12 methylthiotransferase; 99.79
COG1244358 Predicted Fe-S oxidoreductase [General function pr 99.76
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 99.75
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 99.75
TIGR02351366 thiH thiazole biosynthesis protein ThiH. Members t 99.74
PRK08508279 biotin synthase; Provisional 99.71
PLN02389379 biotin synthase 99.7
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of th 99.7
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme 99.7
TIGR00423309 radical SAM domain protein, CofH subfamily. This p 99.69
TIGR03699340 mena_SCO4550 menaquinone biosynthesis protein, SCO 99.69
PRK15108345 biotin synthase; Provisional 99.68
COG1032490 Fe-S oxidoreductase [Energy production and convers 99.66
PRK08445348 hypothetical protein; Provisional 99.66
PRK09613469 thiH thiamine biosynthesis protein ThiH; Reviewed 99.65
TIGR03700351 mena_SCO4494 putative menaquinone biosynthesis pro 99.64
PRK06245336 cofG FO synthase subunit 1; Reviewed 99.64
PRK06267350 hypothetical protein; Provisional 99.64
TIGR03550322 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflav 99.62
PF04055166 Radical_SAM: Radical SAM superfamily; InterPro: IP 99.6
TIGR00510302 lipA lipoate synthase. The family shows strong seq 99.56
PRK12928290 lipoyl synthase; Provisional 99.56
PRK00955620 hypothetical protein; Provisional 99.51
PRK07360371 FO synthase subunit 2; Reviewed 99.51
PRK08444353 hypothetical protein; Provisional 99.49
PRK05481289 lipoyl synthase; Provisional 99.49
PLN02428349 lipoic acid synthase 99.44
PRK01254707 hypothetical protein; Provisional 99.42
PRK05926370 hypothetical protein; Provisional 99.4
TIGR03822321 AblA_like_2 lysine-2,3-aminomutase-related protein 99.39
PRK05927350 hypothetical protein; Provisional 99.37
COG1031560 Uncharacterized Fe-S oxidoreductase [Energy produc 99.35
PRK13361329 molybdenum cofactor biosynthesis protein A; Provis 99.33
COG1856275 Uncharacterized homolog of biotin synthetase [Func 99.29
PRK09234 843 fbiC FO synthase; Reviewed 99.28
PRK09234843 fbiC FO synthase; Reviewed 99.22
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 99.21
TIGR02666334 moaA molybdenum cofactor biosynthesis protein A, b 99.19
PTZ00413398 lipoate synthase; Provisional 99.16
PLN02951373 Molybderin biosynthesis protein CNX2 99.15
TIGR02668302 moaA_archaeal probable molybdenum cofactor biosynt 99.09
PRK05301378 pyrroloquinoline quinone biosynthesis protein PqqE 99.08
PRK10314153 putative acyltransferase; Provisional 99.07
KOG2492552 consensus CDK5 activator-binding protein [Signal t 99.05
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 99.01
KOG4355547 consensus Predicted Fe-S oxidoreductase [General f 99.0
TIGR02109358 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E. 98.99
PTZ00330147 acetyltransferase; Provisional 98.99
TIGR02493235 PFLA pyruvate formate-lyase 1-activating enzyme. A 98.98
TIGR00238331 KamA family protein. Note that the E. coli homolog 98.97
TIGR01290442 nifB nitrogenase cofactor biosynthesis protein Nif 98.95
PHA00673154 acetyltransferase domain containing protein 98.95
TIGR03820417 lys_2_3_AblA lysine-2,3-aminomutase. This model de 98.93
COG1060370 ThiH Thiamine biosynthesis enzyme ThiH and related 98.92
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 98.92
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 98.88
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coen 98.86
KOG2900380 consensus Biotin synthase [Coenzyme transport and 98.83
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 98.82
PRK14456368 ribosomal RNA large subunit methyltransferase N; P 98.79
PRK14460354 ribosomal RNA large subunit methyltransferase N; P 98.76
TIGR03821321 AblA_like_1 lysine-2,3-aminomutase-related protein 98.74
PRK11145246 pflA pyruvate formate lyase-activating enzyme 1; P 98.72
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 98.69
PRK13762322 tRNA-modifying enzyme; Provisional 98.68
COG2100414 Predicted Fe-S oxidoreductase [General function pr 98.67
PRK03624140 putative acetyltransferase; Provisional 98.65
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM 98.63
PRK13745412 anaerobic sulfatase-maturase; Provisional 98.63
PRK14469343 ribosomal RNA large subunit methyltransferase N; P 98.63
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 98.62
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 98.59
PRK10140162 putative acetyltransferase YhhY; Provisional 98.58
KOG3139165 consensus N-acetyltransferase [General function pr 98.56
TIGR02495191 NrdG2 anaerobic ribonucleoside-triphosphate reduct 98.56
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 98.55
TIGR03278404 methan_mark_10 putative methanogenesis marker prot 98.55
cd02169 297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 98.55
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 98.54
PRK07922169 N-acetylglutamate synthase; Validated 98.53
COG0641378 AslB Arylsulfatase regulator (Fe-S oxidoreductase) 98.52
PRK14455356 ribosomal RNA large subunit methyltransferase N; P 98.52
PRK14470336 ribosomal RNA large subunit methyltransferase N; P 98.52
PRK14457345 ribosomal RNA large subunit methyltransferase N; P 98.5
TIGR00048355 radical SAM enzyme, Cfr family. A Staphylococcus s 98.49
KOG3397225 consensus Acetyltransferases [General function pre 98.49
COG0320306 LipA Lipoate synthase [Coenzyme metabolism] 98.48
PRK14463349 ribosomal RNA large subunit methyltransferase N; P 98.48
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 98.48
PRK14468343 ribosomal RNA large subunit methyltransferase N; P 98.48
PRK14459373 ribosomal RNA large subunit methyltransferase N; P 98.47
PRK09831147 putative acyltransferase; Provisional 98.43
PHA01807153 hypothetical protein 98.43
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 98.41
PRK07757152 acetyltransferase; Provisional 98.41
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 98.41
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 98.41
PRK13688156 hypothetical protein; Provisional 98.4
PLN02825515 amino-acid N-acetyltransferase 98.38
PRK14466345 ribosomal RNA large subunit methyltransferase N; P 98.37
PRK15130186 spermidine N1-acetyltransferase; Provisional 98.34
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 98.33
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 98.32
PRK13758370 anaerobic sulfatase-maturase; Provisional 98.32
PRK05279441 N-acetylglutamate synthase; Validated 98.32
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 98.32
COG0456177 RimI Acetyltransferases [General function predicti 98.31
COG2153155 ElaA Predicted acyltransferase [General function p 98.28
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 98.25
COG3153171 Predicted acetyltransferase [General function pred 98.24
COG1509369 KamA Lysine 2,3-aminomutase [Amino acid transport 98.23
KOG3396150 consensus Glucosamine-phosphate N-acetyltransferas 98.23
COG2516339 Biotin synthase-related enzyme [General function p 98.23
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 98.22
COG1533297 SplB DNA repair photolyase [DNA replication, recom 98.21
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 98.21
PRK14462356 ribosomal RNA large subunit methyltransferase N; P 98.19
PRK10514145 putative acetyltransferase; Provisional 98.18
COG0535347 Predicted Fe-S oxidoreductases [General function p 98.18
COG2108353 Uncharacterized conserved protein related to pyruv 98.15
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 98.14
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransf 98.13
PRK14467348 ribosomal RNA large subunit methyltransferase N; P 98.13
PRK14465342 ribosomal RNA large subunit methyltransferase N; P 98.12
KOG2488202 consensus Acetyltransferase (GNAT) domain-containi 98.1
PRK14453347 chloramphenicol/florfenicol resistance protein; Pr 98.1
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 98.09
KOG3216163 consensus Diamine acetyltransferase [Amino acid tr 98.07
TIGR00124 332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 98.04
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 98.0
PRK10562145 putative acetyltransferase; Provisional 97.97
PRK01346 411 hypothetical protein; Provisional 97.91
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 97.9
PRK14464344 ribosomal RNA large subunit methyltransferase N; P 97.89
TIGR03279433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.81
COG0731296 Fe-S oxidoreductases [Energy production and conver 97.8
TIGR02494295 PFLE_PFLC glycyl-radical enzyme activating protein 97.77
PRK14454342 ribosomal RNA large subunit methyltransferase N; P 97.77
PRK11194372 ribosomal RNA large subunit methyltransferase N; P 97.76
COG1247169 Sortase and related acyltransferases [Cell envelop 97.71
COG4277404 Predicted DNA-binding protein with the Helix-hairp 97.66
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 97.63
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 97.49
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Pos 97.48
KOG3138187 consensus Predicted N-acetyltransferase [General f 97.46
KOG3235193 consensus Subunit of the major N alpha-acetyltrans 97.27
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 97.17
KOG3234173 consensus Acetyltransferase, (GNAT) family [Genera 97.17
PRK14461371 ribosomal RNA large subunit methyltransferase N; P 97.08
COG1670187 RimL Acetyltransferases, including N-acetylases of 97.06
PRK10076213 pyruvate formate lyase II activase; Provisional 97.02
KOG2672360 consensus Lipoate synthase [Coenzyme transport and 96.95
COG1625414 Fe-S oxidoreductase, related to NifB/MoaA family [ 96.91
TIGR03365238 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosyn 96.79
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 96.76
COG3981174 Predicted acetyltransferase [General function pred 96.71
COG0820349 Predicted Fe-S-cluster redox enzyme [General funct 96.44
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 96.43
PF13394119 Fer4_14: 4Fe-4S single cluster domain; PDB: 1TV8_B 96.41
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 96.25
COG3393268 Predicted acetyltransferase [General function pred 96.25
KOG4144190 consensus Arylalkylamine N-acetyltransferase [Gene 96.15
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 95.55
COG5014228 Predicted Fe-S oxidoreductase [General function pr 95.01
COG238899 Predicted acetyltransferase [General function pred 94.94
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 94.88
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 94.73
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 93.71
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 93.67
PF13353139 Fer4_12: 4Fe-4S single cluster domain; PDB: 3C8F_A 93.15
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 92.65
PRK09282 592 pyruvate carboxylase subunit B; Validated 92.56
COG1313335 PflX Uncharacterized Fe-S protein PflX, homolog of 92.56
PF00682237 HMGL-like: HMGL-like of this family is not conserv 92.22
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 91.83
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 91.82
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 91.35
TIGR02826147 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosph 91.22
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 90.86
COG5628143 Predicted acetyltransferase [General function pred 90.76
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 90.48
PRK14040 593 oxaloacetate decarboxylase; Provisional 90.35
PF12746265 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S 90.27
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 89.98
PLN02746347 hydroxymethylglutaryl-CoA lyase 89.89
COG1809258 (2R)-phospho-3-sulfolactate synthase (PSL synthase 89.79
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 89.59
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 89.53
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 89.4
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 89.36
KOG4135185 consensus Predicted phosphoglucosamine acetyltrans 89.31
PRK12330 499 oxaloacetate decarboxylase; Provisional 89.26
PRK14041467 oxaloacetate decarboxylase; Provisional 89.18
PRK07535261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 89.09
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 89.04
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 88.94
TIGR02491154 NrdG anaerobic ribonucleoside-triphosphate reducta 88.84
KOG2876323 consensus Molybdenum cofactor biosynthesis pathway 88.74
PRK12331448 oxaloacetate decarboxylase; Provisional 88.52
PF12568128 DUF3749: Acetyltransferase (GNAT) domain; InterPro 88.38
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 88.33
PRK08005210 epimerase; Validated 87.73
PRK15452 443 putative protease; Provisional 87.06
PRK08091228 ribulose-phosphate 3-epimerase; Validated 87.05
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 86.56
COG4552 389 Eis Predicted acetyltransferase involved in intrac 86.22
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 85.79
PRK11121154 nrdG anaerobic ribonucleotide reductase-activating 84.77
PRK11613282 folP dihydropteroate synthase; Provisional 83.79
PRK09389 488 (R)-citramalate synthase; Provisional 83.64
TIGR03827 266 GNAT_ablB putative beta-lysine N-acetyltransferase 83.61
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 83.56
COG1964475 Predicted Fe-S oxidoreductases [General function p 82.8
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 82.2
COG0602212 NrdG Organic radical activating enzymes [Posttrans 82.13
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 82.1
PF13480142 Acetyltransf_6: Acetyltransferase (GNAT) domain 81.9
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 81.76
>KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] Back     alignment and domain information 
Probab=100.00  E-value=6.6e-149  Score=1107.72  Aligned_cols=553  Identities=77%  Similarity=1.257  Sum_probs=545.0

Q ss_pred             cCCCCCCCCcccCCCCHHHHHHHHHHHHHHHHHhhccCCCccCHHHHHHHHHHHhCCCCCCCHHHHHHhCChhhHHHhhh
Q 008466           12 KLPRPGRGGFQAHGLTEEEARVRAIAEIVNSMVELSRKNETVDLNAIKSAACRKYGLARAPKLVEMIAALPETDREALLP   91 (564)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~p~~~~i~~~~~~~~~~~l~~   91 (564)
                      +.+++|.++.+..+.+..+.+.++|++|+.+|++.+..+++.+|+.+|..+++||.++..|+..||++++|+.+++.|++
T Consensus         2 ~~~~kg~~~~~~~~~~~~e~~~~~~~ei~~elie~~~~~k~i~ln~~k~~~~~Ky~L~~~PrlvdiIa~vP~~~k~~Llp   81 (554)
T KOG2535|consen    2 KQKRKGPKELIRPSLSPRELFVLAIGEIVKELIEAHEQNKDIDLNALKTKVARKYGLSAQPRLVDIIAAVPPQYKKSLLP   81 (554)
T ss_pred             CCCCCCCcccccCCCCHHHHHHHHHHHHHHHHHHHHhccccccHHHHHHHHHHHhCCccCchHHHHHhhCChHHHHhhhH
Confidence            45678888888888899889999999999999999988999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCCccCCceeEEeecCCCCCccccCCCCCCcCCCCCCCCCCCcccccccCCCcchHHHHhhhcchHHHHHHHHHH
Q 008466           92 KLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQ  171 (564)
Q Consensus        92 ~l~~kp~rt~sgv~vvavmt~p~~cphIPfC~~~C~YC~~~~~~~F~~s~~sy~g~ep~~~ra~~~~~~~y~~~l~r~~~  171 (564)
                      .|++||+||+|||+||||||+||.||||.|.++.|.||||||||||.+|+|||||+||+||||++.+|+||+|+..|+.|
T Consensus        82 kLrAKPvRTASGiAVVAVMcKPHRCPHIa~TGNiCVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRaRYdP~~QaR~Rv~Q  161 (554)
T KOG2535|consen   82 KLRAKPVRTASGIAVVAVMCKPHRCPHIAFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQARGRVEQ  161 (554)
T ss_pred             HhccCccccccceEEEEEecCCCCCCceeccCCEEEECCCCCCccceeecccccCcCcchHHHHHHhcCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHcCCCCCcEEEEEEcCCCCCCCHHHHHHHHHHHHHHhcCCCchhhHHHhhhcccCCcccEEEEEEeeCCCCCHHHHHH
Q 008466          172 LKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETRPDYCLGPHLRQ  251 (564)
Q Consensus       172 l~~~g~~~~kve~I~~GGTpt~l~~~~l~~ll~~l~~~~~~~~~~~l~e~~~~~~~~~~~~~eitiEtrPd~i~~e~L~~  251 (564)
                      |+++||++|||+.|+|||||++||.+|.+.|++.+++++.++.+.+++||++++|.|..+|++||||||||+|...+|+.
T Consensus       162 Lk~LGHsvDKVE~i~MGGTFMsLPe~YRd~FI~nLHdALSGhts~~v~EAv~yse~s~tKCiGiTIETRPDyC~~~Hl~~  241 (554)
T KOG2535|consen  162 LKQLGHSVDKVEFIVMGGTFMSLPEEYRDYFIRNLHDALSGHTSANVEEAVKYSERSLTKCIGITIETRPDYCLKRHLSD  241 (554)
T ss_pred             HHHhCCccceeEEEEecceeecChHHHHHHHHHHHHHHhcCCCccCHHHHHHhhhhccceeeeEEeecCcccchhhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHcCCCeEEEccCCCCHHHHHhcCCCCCHHHHHHHHHHHHHcCCcEEEEEecCCCCCCHHHHHHHHHHHhcCCCCCCCe
Q 008466          252 MLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLESFREFFESPLFRADG  331 (564)
Q Consensus       252 L~~~G~~rvsiGvQS~~d~vL~~i~Rght~~~~~~ai~~lr~~G~~v~~~lI~GLPget~e~~~~t~~~~~~~~~l~pd~  331 (564)
                      |..+||+|++|||||.++++.+..|||||+..+.+++.+++++||+|+.|||+.||+-..|.+++.|.+.|++++|++|+
T Consensus       242 ML~YGCTRlEiGVQS~YEDVARDTNRGHTV~aVce~F~laKDaG~KvV~HMMPdLPNVg~eRDieqF~E~FenP~FR~DG  321 (554)
T KOG2535|consen  242 MLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNVGMERDIEQFKEYFENPAFRPDG  321 (554)
T ss_pred             HHhcCCceEEeccchhHHHhhhcccCCccHHHHHHHhhhhhccCceeehhhCCCCCCCchhhhHHHHHHHhcCcCcCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeeeeecCCChhHHHHHcCCCCCCCHHHHHHHHHHHHHhCCCceEEeeeecCCChhHHHhCCCcchHHHHHHhhcccc
Q 008466          332 LKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDL  411 (564)
Q Consensus       332 i~iy~l~v~~GT~L~~~~~~G~~~~~~~ee~~~~~~~~~~~lp~~iri~Ri~rdip~~l~~~G~~~~~~~~~a~~~~~~~  411 (564)
                      +++||+++++||.||++|+.|+|+.++++.++++++.+++++|||+|++|+|||||++|+.+|++|+|+|++|+.+|++.
T Consensus       322 LKiYPTLVIrGTGLyELWKtgrYk~Y~p~~LvdlvArILalVPPWtRvYRvQRDIPMpLVsSGVe~GNlRElAlarMkdl  401 (554)
T KOG2535|consen  322 LKIYPTLVIRGTGLYELWKTGRYKSYSPSALVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDL  401 (554)
T ss_pred             ceecceEEEecccHHHHHhcCCcccCCHHHHHHHHHHHHhhCCchhheeeeccCCCccccccccccCCHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcccceeeEEeccccccccCCCcceEEEEEEEeeCCCeEEEEEEeecCCCeEEEEEEEEecCCCCCccccCCccceeee
Q 008466          412 GLKCRDVRTREAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCPELMGKCSIVRE  491 (564)
Q Consensus       412 g~~c~~ir~re~~~~~~~~~~~~~~~e~~~~~y~a~gg~e~fls~~d~~~~~lvG~lrlr~~~~~~~~~el~~~~~~~re  491 (564)
                      |.+||++|+||+|++++|+++.|+++|+.++||.||||||+|||||||++|+|||.||||.++...+++|+.+..++|||
T Consensus       402 g~~CRDvRtREvGiqeiH~kv~PeqvELvRRDY~ANgGWETFlSYEDpkqDILiGLLRLRkcs~~~~~~el~g~~SivRE  481 (554)
T KOG2535|consen  402 GTKCRDVRTREVGIQEIHHKVRPEQVELVRRDYVANGGWETFLSYEDPKQDILIGLLRLRKCSKKTTRPELFGSQSIVRE  481 (554)
T ss_pred             CccchhhhhhhccHHHHhhccCHHHhhhhhhhhcccCChheeecccCcchhHHHHHHHHhhcccccccchhcCccchhee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988999999


Q ss_pred             eeeecccccccCCCchhhhhcCHHHHHHHHHHHHHHhcCCCcEEEEecCCCcHHHHhhCCCeeeCceEeeecC
Q 008466          492 LHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALGEHRSRKMAVISGVGTRHYYRKLGYELEGPYMVKYLE  564 (564)
Q Consensus       492 lhvyg~~~~v~~~~~~~~q~~GiG~~Lm~~aE~~A~~~~g~~~i~~~s~~~a~~fY~klGy~~~g~~m~K~l~  564 (564)
                      |||||++|||+.+|+..|||||+|+.||++||++|+++||..+|.++|++++++||+|+||+.+||||+|.|.
T Consensus       482 LHVYGs~vpv~~rDp~KfQHQG~GtLLmeEAERIAr~EHgS~KiavISGVGtR~YY~klGY~LdGPYM~K~l~  554 (554)
T KOG2535|consen  482 LHVYGSVVPVHSRDPTKFQHQGFGTLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKLGYELDGPYMVKMLK  554 (554)
T ss_pred             eeecceeeecccCCchhhhhcchhhHHHHHHHHHHHHhcCCCceEEEeccchHHHHHhhCeeecChhHhhhcC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999874

>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>PRK05660 HemN family oxidoreductase; Provisional Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR01212 radical SAM protein, TIGR01212 family Back     alignment and domain information
>COG1242 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08629 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR01210 conserved hypothetical protein TIGR01210 Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme Back     alignment and domain information
>PRK14329 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14334 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14340 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PRK14327 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14331 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14332 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14333 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14330 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14326 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14325 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14335 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14336 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR00089 RNA modification enzyme, MiaB family Back     alignment and domain information
>PRK14339 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14338 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14328 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR01574 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB Back     alignment and domain information
>TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125 Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>PRK14337 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14862 rimO ribosomal protein S12 methylthiotransferase; Provisional Back     alignment and domain information
>COG1244 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PLN02389 biotin synthase Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR00423 radical SAM domain protein, CofH subfamily Back     alignment and domain information
>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>COG1032 Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family Back     alignment and domain information
>PRK06245 cofG FO synthase subunit 1; Reviewed Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation Back     alignment and domain information
>TIGR00510 lipA lipoate synthase Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>PRK00955 hypothetical protein; Provisional Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>PLN02428 lipoic acid synthase Back     alignment and domain information
>PRK01254 hypothetical protein; Provisional Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03822 AblA_like_2 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>COG1031 Uncharacterized Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial Back     alignment and domain information
>PTZ00413 lipoate synthase; Provisional Back     alignment and domain information
>PLN02951 Molybderin biosynthesis protein CNX2 Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>KOG2492 consensus CDK5 activator-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>KOG4355 consensus Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme Back     alignment and domain information
>TIGR00238 KamA family protein Back     alignment and domain information
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>TIGR03820 lys_2_3_AblA lysine-2,3-aminomutase Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>KOG2900 consensus Biotin synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>PRK14456 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14460 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR03821 AblA_like_1 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PRK13762 tRNA-modifying enzyme; Provisional Back     alignment and domain information
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>PRK13745 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>PRK14469 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>KOG3139 consensus N-acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10 Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>COG0641 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [General function prediction only] Back     alignment and domain information
>PRK14455 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14470 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14457 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR00048 radical SAM enzyme, Cfr family Back     alignment and domain information
>KOG3397 consensus Acetyltransferases [General function prediction only] Back     alignment and domain information
>COG0320 LipA Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK14463 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PRK14468 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14459 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PRK14466 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PRK13758 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG1509 KamA Lysine 2,3-aminomutase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG2516 Biotin synthase-related enzyme [General function prediction only] Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PRK14462 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK14467 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14465 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK14453 chloramphenicol/florfenicol resistance protein; Provisional Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>PRK14464 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family Back     alignment and domain information
>PRK14454 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK11194 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif [General function prediction only] Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] Back     alignment and domain information
>PRK14461 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>KOG2672 consensus Lipoate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1625 Fe-S oxidoreductase, related to NifB/MoaA family [Energy production and conversion] Back     alignment and domain information
>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only] Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information
>PF13394 Fer4_14: 4Fe-4S single cluster domain; PDB: 1TV8_B 1TV7_A 2FB2_A 2FB3_A Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>COG5014 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PF13353 Fer4_12: 4Fe-4S single cluster domain; PDB: 3C8F_A 3CB8_A 3T7V_A 2YX0_A 3CAN_A Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>COG1313 PflX Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only] Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>TIGR02826 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate reductase activating protein Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>COG1809 (2R)-phospho-3-sulfolactate synthase (PSL synthase, CoM biosynthesis) [Coenzyme transport and metabolism] Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>TIGR02491 NrdG anaerobic ribonucleoside-triphosphate reductase activating protein Back     alignment and domain information
>KOG2876 consensus Molybdenum cofactor biosynthesis pathway protein [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK11121 nrdG anaerobic ribonucleotide reductase-activating protein; Provisional Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>COG1964 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query564
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1olt_A457 Oxygen-independent coproporphyrinogen III oxidase; 2e-06
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 3e-06
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 1e-05
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 7e-05
2aj6_A159 Hypothetical protein MW0638; structural genomics, 8e-05
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 2e-04
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 3e-04
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 3e-04
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 4e-04
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 5e-04
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 7e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 59.1 bits (142), Expect = 3e-09
 Identities = 65/467 (13%), Positives = 118/467 (25%), Gaps = 146/467 (31%)

Query: 136 DFEYSTQSYTGYE---PTSMRAIRARYN-PYVQARSRIDQLKRLGHSVDKVEFILMGGTF 191
           DFE     Y  Y+        A    ++   VQ     D  K +  S ++++ I+M    
Sbjct: 8   DFETGEHQYQ-YKDILSVFEDAFVDNFDCKDVQ-----DMPKSI-LSKEEIDHIIMSKD- 59

Query: 192 MSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETRPDY-------- 243
                         L   L       V++ V                 R +Y        
Sbjct: 60  -------AVSGTLRLFWTLLSKQEEMVQKFVEEVL-------------RINYKFLMSPIK 99

Query: 244 --CLGPHLRQMLSYGCTRLEIGVQSTYEDVA----RDTNRGHTVAAVADCFCLAKDAGFK 297
                P +     Y   R        Y D       + +R      +       + A   
Sbjct: 100 TEQRQPSMM-TRMYIEQR-----DRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKN- 152

Query: 298 VVAHMMPDLPNVG---------VERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYEL 348
           V+   +      G         V       +   +  +F                     
Sbjct: 153 VLIDGVL-----GSGKTWVALDVCLS-YKVQCKMDFKIF--------------------- 185

Query: 349 W-KTGRYRNYPPEQLVDIVARILA-MVPPWTRVYRVQRDIPMPLVTSGVEKGNLREL--- 403
           W       +  PE +++++ ++L  + P WT       +I + + +    +  LR L   
Sbjct: 186 WLNLKNCNS--PETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHS---IQAELRRLLKS 240

Query: 404 -----ALARMDD---------LGLKCRD-VRTREAGIQDIHHQIKPEEVELVRRD--YVA 446
                 L  + +           L C+  + TR   + D         + L         
Sbjct: 241 KPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTP 300

Query: 447 NEGWETFLSYEDTR-QDILVGLLRLRKCGRNVTCPELMGKCSIVRELHVYGTAVPVHGRE 505
           +E     L Y D R QD     L       N   P  +    I   +             
Sbjct: 301 DEVKSLLLKYLDCRPQD-----LPREVLTTN---PRRLS--IIAESIR------------ 338

Query: 506 ADKLQH-QGYGTLLMEEAERIALGEHRSRKMAVISGVGTRHYYRKLG 551
            D L     +  +  ++   I         + V+     R  + +L 
Sbjct: 339 -DGLATWDNWKHVNCDKLTTI-----IESSLNVLEPAEYRKMFDRLS 379
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Length = 457 Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Length = 149 Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Length = 165 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Length = 207 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190 Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Length = 166 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Length = 184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query564
1olt_A457 Oxygen-independent coproporphyrinogen III oxidase; 100.0
2qgq_A304 Protein TM_1862; alpha-beta protein, structural ge 99.9
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 99.87
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 99.85
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 99.84
3c8f_A245 Pyruvate formate-lyase 1-activating enzyme; adoMet 99.48
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; 99.45
2yx0_A342 Radical SAM enzyme; predicted tRNA modification en 99.4
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 99.27
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 99.22
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 99.18
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 99.14
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 99.12
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 99.11
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 99.1
3mgd_A157 Predicted acetyltransferase; structural genomics, 99.09
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 99.08
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 99.07
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 99.07
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 99.07
1tiq_A180 Protease synthase and sporulation negative regulat 99.06
3efa_A147 Putative acetyltransferase; structural genom 2, pr 99.05
1wwz_A159 Hypothetical protein PH1933; structural genomics, 99.05
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 99.04
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 99.01
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 99.0
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 99.0
1xeb_A150 Hypothetical protein PA0115; midwest center for st 99.0
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 98.99
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 98.98
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 98.97
2a5h_A416 L-lysine 2,3-aminomutase; radical SAM, four-iron-f 98.97
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 98.97
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 98.96
2aj6_A159 Hypothetical protein MW0638; structural genomics, 98.94
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 98.94
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 98.94
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 98.93
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 98.92
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 98.92
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 98.92
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 98.92
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 98.91
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 98.91
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 98.9
1vkc_A158 Putative acetyl transferase; structural genomics, 98.9
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 98.9
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 98.9
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 98.89
2z2u_A311 UPF0026 protein MJ0257; metal binding protein; 2.4 98.89
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 98.89
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 98.89
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 98.89
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 98.88
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 98.88
2fl4_A149 Spermine/spermidine acetyltransferase; structural 98.88
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 98.88
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 98.88
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 98.86
3kkw_A182 Putative uncharacterized protein; acetyltransferas 98.85
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 98.85
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 98.85
2i6c_A160 Putative acetyltransferase; GNAT family, structura 98.84
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 98.84
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 98.84
1z4r_A168 General control of amino acid synthesis protein 5- 98.84
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 98.83
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 98.82
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 98.82
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 98.82
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 98.82
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 98.82
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 98.82
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 98.82
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 98.81
1y7r_A133 Hypothetical protein SA2161; structural genomics, 98.81
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 98.81
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 98.8
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 98.8
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 98.79
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 98.79
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 98.79
2fe7_A166 Probable N-acetyltransferase; structural genomics, 98.78
2eui_A153 Probable acetyltransferase; dimer, structural geno 98.78
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 98.77
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 98.77
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 98.76
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 98.75
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 98.75
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 98.75
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 98.75
3juw_A175 Probable GNAT-family acetyltransferase; structural 98.75
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 98.74
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 98.74
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 98.73
1nsl_A184 Probable acetyltransferase; structural genomics, h 98.73
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 98.73
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 98.73
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 98.73
3owc_A188 Probable acetyltransferase; structural genomics, P 98.73
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 98.72
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 98.72
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 98.72
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 98.72
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 98.71
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 98.7
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 98.7
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 98.69
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 98.69
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 98.68
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 98.67
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 98.67
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 98.67
2gan_A190 182AA long hypothetical protein; alpha-beta protei 98.66
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 98.65
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 98.65
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 98.65
3frm_A254 Uncharacterized conserved protein; APC61048, staph 98.65
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 98.64
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 98.63
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 98.63
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 98.61
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 98.6
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 98.59
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 98.59
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 98.59
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 98.57
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 98.57
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 98.57
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 98.56
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 98.56
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 98.56
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 98.55
2qml_A198 BH2621 protein; structural genomics, joint center 98.55
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 98.54
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 98.54
3rfa_A404 Ribosomal RNA large subunit methyltransferase N; r 98.53
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 98.53
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 98.52
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 98.51
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 98.49
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 98.46
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 98.43
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 98.4
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 98.4
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 98.37
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 98.37
3c26_A 266 Putative acetyltransferase TA0821; NP_394282.1, A 98.34
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 98.31
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 98.29
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 98.29
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 98.29
3can_A182 Pyruvate-formate lyase-activating enzyme; structur 98.27
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 98.27
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 98.26
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 98.24
2zw5_A 301 Bleomycin acetyltransferase; dimer, two domains; H 98.23
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 98.19
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 98.19
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 98.18
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 98.11
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 97.97
3tt2_A 330 GCN5-related N-acetyltransferase; structural genom 97.97
4fhd_A368 Spore photoproduct lyase; partial TIM-barrel, DNA 97.89
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 97.82
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alp 97.81
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltran 97.79
1xmt_A103 Putative acetyltransferase; structural genomics, p 97.72
3p2h_A201 AHL synthase; acyl-ACP binding, SAM binding, signa 97.42
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, 97.24
3shp_A176 Putative acetyltransferase STHE_0691; PSI-biology, 97.04
1bob_A320 HAT1, histone acetyltransferase; histone modificat 96.8
3dns_A135 Ribosomal-protein-alanine acetyltransferase; N-ter 96.26
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 92.1
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 90.59
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 88.54
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 87.3
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 87.11
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 85.35
3ble_A337 Citramalate synthase from leptospira interrogans; 85.26
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 84.97
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 84.08
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 82.27
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 81.86
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 81.77
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 81.53
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 81.15
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 80.82
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure
Probab=100.00  E-value=9.5e-37  Score=331.23  Aligned_cols=266  Identities=18%  Similarity=0.206  Sum_probs=212.1

Q ss_pred             CCCCHHHHHHhCChhhHHHhhhHHhcCCCCccCCceeEEeecCCCCCccccCCCCCCcCCCCCCCCCCCcccccccCCCc
Q 008466           70 RAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEP  149 (564)
Q Consensus        70 ~~p~~~~i~~~~~~~~~~~l~~~l~~kp~rt~sgv~vvavmt~p~~cphIPfC~~~C~YC~~~~~~~F~~s~~sy~g~ep  149 (564)
                      +||....+-..+.....+   ..|...|-.+.            ++|+|||||+.+|.||      +|.    +..+.. 
T Consensus        25 syp~~~~~~~~~~~~~~~---~~l~~~p~~~~------------~lYihIpfC~~~C~yC------~~~----~~~~~~-   78 (457)
T 1olt_A           25 SYPTALEFSEDFGEQAFL---QAVARYPERPL------------SLYVHIPFCHKLCYFC------GCN----KIVTRQ-   78 (457)
T ss_dssp             SSSCGGGCBTTCCHHHHH---HHHTTCTTSCE------------EEEEEECEESSCCTTC------CSS----CEECSC-
T ss_pred             CCCCHhHcCCCCCHHHHH---HHHHhCCCCce------------EEEEEcCCCCCCCCCC------CCc----eeccCC-
Confidence            577766666556554332   23333342222            2599999999999999      664    221111 


Q ss_pred             chHHHHhhhcchHHHHHHHHHHHH-HcCCCCCcEEEE-EEcCCCCCCCHHHHHHHHHHHHHHhcCCCchhhHHHhhhccc
Q 008466          150 TSMRAIRARYNPYVQARSRIDQLK-RLGHSVDKVEFI-LMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEH  227 (564)
Q Consensus       150 ~~~ra~~~~~~~y~~~l~r~~~l~-~~g~~~~kve~I-~~GGTpt~l~~~~l~~ll~~l~~~~~~~~~~~l~e~~~~~~~  227 (564)
                            ......|.+.+.++++.. ..+.. ..+..| |+||||+.++.+++.++++.+.+.++                
T Consensus        79 ------~~~~~~~~~~l~~Ei~~~~~~~~~-~~i~~i~fgGGtpt~l~~~~l~~ll~~i~~~~~----------------  135 (457)
T 1olt_A           79 ------QHKADQYLDALEQEIVHRAPLFAG-RHVSQLHWGGGTPTYLNKAQISRLMKLLRENFQ----------------  135 (457)
T ss_dssp             ------THHHHHHHHHHHHHHHHHGGGGTT-CCEEEEEEEESCGGGSCHHHHHHHHHHHHHHSC----------------
T ss_pred             ------cchHHHHHHHHHHHHHHHHHhcCC-CceEEEEEeCCCcccCCHHHHHHHHHHHHHhCC----------------
Confidence                  012356777777666533 32222 347777 68999999999999999999988764                


Q ss_pred             CCcccEEEEEEeeCCCCCHHHHHHHHHcCCCeEEEccCCCCHHHHHhcCCCCCHHHHHHHHHHHHHcCCc-EEEEEecCC
Q 008466          228 GATKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFK-VVAHMMPDL  306 (564)
Q Consensus       228 ~~~~~~eitiEtrPd~i~~e~L~~L~~~G~~rvsiGvQS~~d~vL~~i~Rght~~~~~~ai~~lr~~G~~-v~~~lI~GL  306 (564)
                       .....+|++|+||++++++.++.|+++|++||+|||||+++++|+.|||+|+.+++.++++.++++||. +++|+|+||
T Consensus       136 -~~~~~eitie~~p~~l~~e~l~~L~~~G~~rislGvQS~~~~~l~~i~R~~~~~~~~~ai~~~r~~G~~~v~~dlI~Gl  214 (457)
T 1olt_A          136 -FNADAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREIGFTSTNIDLIYGL  214 (457)
T ss_dssp             -EEEEEEEEEEECSSSCCTHHHHHHHHTTCCEEEEEEECCCHHHHHHHTCCCCHHHHHHHHHHHHHTTCCSCEEEEEESC
T ss_pred             -CCCCcEEEEEEccCcCCHHHHHHHHHcCCCEEEEeeccCCHHHHHHhCCCCCHHHHHHHHHHHHHcCCCcEEEEEEcCC
Confidence             124579999999999999999999999999999999999999999999999999999999999999998 999999999


Q ss_pred             CCCCHHHHHHHHHHHhcCCCCCCCeEEEeeeeecCCChhHHHHHcCCCCCCCHHHHHHHHHHHHHhCCCceEEeeeecCC
Q 008466          307 PNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDI  386 (564)
Q Consensus       307 Pget~e~~~~t~~~~~~~~~l~pd~i~iy~l~v~~GT~L~~~~~~G~~~~~~~ee~~~~~~~~~~~lp~~iri~Ri~rdi  386 (564)
                      ||||.+++.++++.+.   +++|++|++|++.+.|||++++.. .+....+++++.++++..+.+.              
T Consensus       215 Pget~e~~~~tl~~~~---~l~~~~i~~y~l~~~p~t~~~~~~-~~~~~lp~~~~~~~~~~~~~~~--------------  276 (457)
T 1olt_A          215 PKQTPESFAFTLKRVA---ELNPDRLSVFNYAHLPTIFAAQRK-IKDADLPSPQQKLDILQETIAF--------------  276 (457)
T ss_dssp             TTCCHHHHHHHHHHHH---HHCCSEEEEEECCCCTTTSGGGGG-SCGGGSCCHHHHHHHHHHHHHH--------------
T ss_pred             CCCCHHHHHHHHHHHH---hcCcCEEEeecCcCCcCchhHhhc-cccCCCcCHHHHHHHHHHHHHH--------------
Confidence            9999999999999998   578999999999999999877633 2445678899999999888776              


Q ss_pred             ChhHHHhCCCcchHHHHHHh
Q 008466          387 PMPLVTSGVEKGNLRELALA  406 (564)
Q Consensus       387 p~~l~~~G~~~~~~~~~a~~  406 (564)
                         +..+|+.+|++++||++
T Consensus       277 ---L~~~Gy~~yeis~fa~~  293 (457)
T 1olt_A          277 ---LTQSGYQFIGMDHFARP  293 (457)
T ss_dssp             ---HHHTTCEEEETTEEECT
T ss_pred             ---HHHCCCeEEEechhcCC
Confidence               46789999999999865
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>3rfa_A Ribosomal RNA large subunit methyltransferase N; radical SAM, S-adenosylmethionine, iron sulfur cluster, oxidoreductase; HET: SAM; 2.05A {Escherichia coli} PDB: 3rf9_A* Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, pyruvate-formate lyase-activating enzym MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>4fhd_A Spore photoproduct lyase; partial TIM-barrel, DNA repair, damaged DNA; HET: EEM 0TT; 2.00A {Geobacillus thermodenitrificans} PDB: 4fhc_A* 4fhg_A* 4fhe_A* 4fhf_A* Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* Back     alignment and structure
>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A Back     alignment and structure
>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query564
d1olta_441 Oxygen-independent coproporphyrinogen III oxidase 100.0
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 99.76
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 99.4
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 99.28
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 99.28
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 99.28
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 99.26
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 99.26
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 99.24
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 99.2
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 99.18
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 99.18
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 99.15
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 99.13
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 99.12
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 99.09
d1tiqa_173 Protease synthase and sporulation negative regulat 99.08
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 99.06
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 99.06
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 99.05
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 99.03
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 99.02
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 99.01
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 99.01
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 99.0
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 99.0
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 98.97
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 98.96
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 98.91
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 98.9
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 98.9
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 98.87
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 98.86
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 98.84
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 98.84
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 98.84
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 98.84
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 98.83
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 98.82
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 98.78
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 98.7
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 98.69
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 98.69
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 98.65
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 98.47
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 98.43
d1tv8a_327 Molybdenum cofactor biosynthesis protein A MoaA {S 98.29
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 98.27
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 98.17
d2hv2a2 285 Hypothetical protein EF1021 {Enterococcus faecalis 98.16
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 98.13
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 98.11
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 98.07
d2i00a2 291 Putative acetyltransferase EF2353 {Enterococcus fa 98.06
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 97.98
d2ozga2 283 Putative acetyltransferase Ava4977 {Anabaena varia 97.97
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 97.78
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 97.76
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 97.39
d1ro5a_197 Autoinducer synthesis protein LasI {Pseudomonas ae 96.4
d1p0ha_ 308 Mycothiol synthase MshD {Mycobacterium tuberculosi 96.2
d1xmta_95 Hypothetical protein AT1g77540 {Thale cress (Arabi 94.74
d1kzfa_210 Acyl-homoserinelactone synthase EsaI {Pantoea stew 88.53
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 87.63
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 82.74
d1qwga_251 (2r)-phospho-3-sulfolactate synthase ComA {Archaeo 81.25
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Oxygen-independent coproporphyrinogen III oxidase HemN
domain: Oxygen-independent coproporphyrinogen III oxidase HemN
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.7e-42  Score=372.04  Aligned_cols=268  Identities=19%  Similarity=0.222  Sum_probs=227.7

Q ss_pred             CCCCHHHHHHhCChhhHHHhhhHHhcCCCCccCCceeEEeecCCCCCccccCCCCCCcCCCCCCCCCCCcccccccCCCc
Q 008466           70 RAPKLVEMIAALPETDREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEP  149 (564)
Q Consensus        70 ~~p~~~~i~~~~~~~~~~~l~~~l~~kp~rt~sgv~vvavmt~p~~cphIPfC~~~C~YC~~~~~~~F~~s~~sy~g~ep  149 (564)
                      +||...++-..+....   ++..|.+.|-++.|            +|+|||||+++|.||      +|.    ++.... 
T Consensus        22 syp~~~~f~~~~~~~~---~~~~l~~~~~~pls------------LYiHiPFC~~~C~yC------~~~----~~~~~~-   75 (441)
T d1olta_          22 SYPTALEFSEDFGEQA---FLQAVARYPERPLS------------LYVHIPFCHKLCYFC------GCN----KIVTRQ-   75 (441)
T ss_dssp             SSSCGGGCBTTCCHHH---HHHHHTTCTTSCEE------------EEEEECEESSCCTTC------CSS----CEECSC-
T ss_pred             CCCCcccccCCCCHHH---HHHHHhhCCCCceE------------EEEEeCCCCCCCCCC------cCe----eecCCC-
Confidence            6899888877666553   23455555544443            699999999999999      775    222222 


Q ss_pred             chHHHHhhhcchHHHHHHHHHHHHHcCCCCCcEEEE-EEcCCCCCCCHHHHHHHHHHHHHHhcCCCchhhHHHhhhcccC
Q 008466          150 TSMRAIRARYNPYVQARSRIDQLKRLGHSVDKVEFI-LMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHG  228 (564)
Q Consensus       150 ~~~ra~~~~~~~y~~~l~r~~~l~~~g~~~~kve~I-~~GGTpt~l~~~~l~~ll~~l~~~~~~~~~~~l~e~~~~~~~~  228 (564)
                            ....++|++.+.+|+++........+|.+| |||||||.|+++.+.++++.|.+.++                 
T Consensus        76 ------~~~~~~Y~~~L~~Ei~~~~~~~~~~~v~~i~~GGGTPt~L~~~~l~~ll~~l~~~~~-----------------  132 (441)
T d1olta_          76 ------QHKADQYLDALEQEIVHRAPLFAGRHVSQLHWGGGTPTYLNKAQISRLMKLLRENFQ-----------------  132 (441)
T ss_dssp             ------THHHHHHHHHHHHHHHHHGGGGTTCCEEEEEEEESCGGGSCHHHHHHHHHHHHHHSC-----------------
T ss_pred             ------cchHHHHHHHHHHHHHHhhHhcCCCccceeEecCCCcCCCCHHHHHHHHHHHhhhcc-----------------
Confidence                  245688999999999877655556679999 69999999999999999999998876                 


Q ss_pred             CcccEEEEEEeeCCCCCHHHHHHHHHcCCCeEEEccCCCCHHHHHhcCCCCCHHHHHHHHHHHHHcCCc-EEEEEecCCC
Q 008466          229 ATKCIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFK-VVAHMMPDLP  307 (564)
Q Consensus       229 ~~~~~eitiEtrPd~i~~e~L~~L~~~G~~rvsiGvQS~~d~vL~~i~Rght~~~~~~ai~~lr~~G~~-v~~~lI~GLP  307 (564)
                      ...+.++|+|++|++++++.|..|+++|||||||||||+|+++|+.|||.|+.+++.++++.++++||. +++|||+|||
T Consensus       133 ~~~~~e~t~E~~P~~~~~~~l~~l~~~G~nRiSlGvQs~~~~vl~~i~R~~~~~~~~~~~~~~r~~g~~~vn~DLI~GlP  212 (441)
T d1olta_         133 FNADAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLP  212 (441)
T ss_dssp             EEEEEEEEEEECSSSCCTHHHHHHHHTTCCEEEEEEECCCHHHHHHHTCCCCHHHHHHHHHHHHHTTCCSCEEEEEESCT
T ss_pred             ccchhcccccccccccchHHHHHHHHhCCceEEecchhcchhhhhhhhcCCCHHHHHHHHHHHHhcccceeecccccccC
Confidence            135689999999999999999999999999999999999999999999999999999999999999997 8999999999


Q ss_pred             CCCHHHHHHHHHHHhcCCCCCCCeEEEeeeeecCCChhHHHHHcCCCCCCCHHHHHHHHHHHHHhCCCceEEeeeecCCC
Q 008466          308 NVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILAMVPPWTRVYRVQRDIP  387 (564)
Q Consensus       308 get~e~~~~t~~~~~~~~~l~pd~i~iy~l~v~~GT~L~~~~~~G~~~~~~~ee~~~~~~~~~~~lp~~iri~Ri~rdip  387 (564)
                      |||.+++.++++.++   +++||+|++|++.+.|+|..+. ...++...+++++..+++..+.+.               
T Consensus       213 gqT~~~~~~tl~~~~---~l~pd~is~y~~~~~p~~~~~q-~~~~~~~lp~~~~~~~~~~~~~~~---------------  273 (441)
T d1olta_         213 KQTPESFAFTLKRVA---ELNPDRLSVFNYAHLPTIFAAQ-RKIKDADLPSPQQKLDILQETIAF---------------  273 (441)
T ss_dssp             TCCHHHHHHHHHHHH---HHCCSEEEEEECCCCTTTSGGG-GGSCGGGSCCHHHHHHHHHHHHHH---------------
T ss_pred             CcchHHHHHHHHHHH---hhCCCccccccceeccchhHhh-hhccccchhhhHHHHHHHHHHHHH---------------
Confidence            999999999999998   5789999999999999886654 455666678999999998877765               


Q ss_pred             hhHHHhCCCcchHHHHHHhh
Q 008466          388 MPLVTSGVEKGNLRELALAR  407 (564)
Q Consensus       388 ~~l~~~G~~~~~~~~~a~~~  407 (564)
                        |..+|+.++++++||++.
T Consensus       274 --L~~~GY~~~~~~~far~~  291 (441)
T d1olta_         274 --LTQSGYQFIGMDHFARPD  291 (441)
T ss_dssp             --HHHTTCEEEETTEEECTT
T ss_pred             --HHHcCchhhhHHHhhhcc
Confidence              588999999999998653
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure