Citrus Sinensis ID: 008587


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560
MESHGSITLKLFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGDVETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCILMNAKRGKPVSALSVAAKTPGEAMNALVVEIFCISGTMIPA
cccccccHHHHHHHHHHHHHHHcccEEEEEEEcccEEEEcccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccEEEcEEEEcHHHHHHHHHHHHcccEEEEEEEcccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccHHcHHHHHHHccccHHHHHccccccccccccHHHHHHHHHHHcccccccEEEccEEEEccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccEEccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccEEcc
ccccccHHHHHHHHHHHHHHHccccccEEEEEcccEEEEccHHHHccHHHHHHcccccccccEEEEEEEEccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccEEEcEEEEEccHHHHHHHHHHcccEEEEEEEcccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccEEEccEEEEEEccccccccHHHHHHccccccEcccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHccccHHHHHHHHHHccccHHHHHHHccccccccccHHHHHHHHHHHcccccccEEEEEEEEEEccEEcccccHHHHHHHHHHcccccccccHcccccccccHHHcccccccccccccccEEcccccccEEEccccccEEEEccccEEEEEcccccEEEcccccccccccccEcEEEccccccccEccccccccccccccccHHccccccccccccccccHHHHHEEEEEEEEEccccccc
MESHGSITLKLFLGFLILSLNVHTSVSRFVVEknslmvtspekikgshdsaignfgipqyggsmagavtypkenrkgcrefgdfgisfkakpgalpnfvlvdrGDCFFALKVWNAQKAGASAVLVADDIEEALitmdtpeedissakyienitipsalidKSFGETLKKALsggemvnvnldwreavphpddrveyelwtnsndecgvKCDMLMAFVKEfrgpaqilekggytqftphyitwycpmtftlsrqCKSQcinhgrycapdpeqdfssgyegkdvVLENLRQLCVFKVAkeskkpwvwwdYVTDfqircpmkdkkynKECAAAVIKSLGLDAKKIEkcmgdpdadadnpvlkeeqdaqvgkgsrgdvtilptlvvnnrqyrgklekGAVLKAICSgfeettepavclsgdvetnecldnnggcwqdktanvtackdtfrgrvcecplvdgvqfkgdgyshcevsgpgkckinnggcwheskdghtysacldsengkcqcppgfkgdgvkSCILmnakrgkpvsalsvaaktPGEAMNALVVEIFCISGTMIPA
MESHGSITLKLFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITmdtpeedissaKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKvakeskkpwvwwdYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEqdaqvgkgsrgdvtilptlvvnnrqyrgkleKGAVLKAICSGFEETTEPAVCLSGDVETNECLDnnggcwqdktANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCILMNAKRGKPVSALSVAAKTPGEAMNALVVEIFCISGTMIPA
MESHGSITlklflgflilslNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGDVETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCILMNAKRGKPVSALSVAAKTPGEAMNALVVEIFCISGTMIPA
******ITLKLFLGFLILSLNVHTSVSRFVVEKNSLMVT**********SAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIE*****************************DVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGDVETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCILMNAKRGKPVSALSVAAKTPGEAMNALVVEIFCISGT****
***********FLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGDVETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCILMNAKRGKPVSALSVAAKTPGEAMNALVVEIFCISGTMIP*
MESHGSITLKLFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLK**********SRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGDVETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCILMNAKRGKPVSALSVAAKTPGEAMNALVVEIFCISGTMIPA
*****SITLKLFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGDVETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCILMNAKRGKPVSALSVAAKTPGEAMNALVVEIFCISGTMIPA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESHGSITLKLFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGDVETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCILMNAKRGKPVSALSVAAKTPGEAMNALVVEIFCISGTMIPA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query560 2.2.26 [Sep-21-2011]
O80977628 Vacuolar-sorting receptor yes no 0.885 0.789 0.846 0.0
Q56ZQ3628 Vacuolar-sorting receptor yes no 0.885 0.789 0.836 0.0
P93484623 Vacuolar-sorting receptor N/A no 0.894 0.804 0.832 0.0
P93026623 Vacuolar-sorting receptor no no 0.910 0.818 0.707 0.0
O22925625 Vacuolar-sorting receptor no no 0.919 0.824 0.664 0.0
Q9FYH7631 Vacuolar-sorting receptor no no 0.903 0.801 0.635 0.0
Q8L7E3625 Vacuolar-sorting receptor no no 0.905 0.811 0.617 0.0
O64758618 Vacuolar-sorting receptor no no 0.903 0.818 0.591 0.0
Q66HG0380 E3 ubiquitin-protein liga yes no 0.137 0.202 0.364 0.0003
O54965381 E3 ubiquitin-protein liga yes no 0.137 0.202 0.376 0.0006
>sp|O80977|VSR3_ARATH Vacuolar-sorting receptor 3 OS=Arabidopsis thaliana GN=VSR3 PE=2 SV=1 Back     alignment and function desciption
 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/496 (84%), Positives = 461/496 (92%)

Query: 27  SRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGI 86
           +RFVVEKNSL VTSPE IKG+HDSAIGNFGIPQYGGSMAG V YPKEN+K C+EF DF I
Sbjct: 24  ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI 83

Query: 87  SFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSA 146
           SFK++PGALP F+LVDRGDCFFALKVWNAQKAGASAVLVAD+++E LITMDTPEED+SSA
Sbjct: 84  SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA 143

Query: 147 KYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC 206
           KYIENITIPSAL+ K FGE LKKA+SGG+MVN+NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct: 144 KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC 203

Query: 207 GVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCA 266
           GVKCDMLM FVK+F+G AQILEKGG+TQF PHYITWYCP  FTLSRQCKSQCIN GRYCA
Sbjct: 204 GVKCDMLMEFVKDFKGAAQILEKGGFTQFRPHYITWYCPHAFTLSRQCKSQCINKGRYCA 263

Query: 267 PDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKE 326
           PDPEQDFSSGY+GKDVV+ENLRQLCV+KVA E+ KPWVWWDYVTDFQIRCPMK+KKYNKE
Sbjct: 264 PDPEQDFSSGYDGKDVVVENLRQLCVYKVANETGKPWVWWDYVTDFQIRCPMKEKKYNKE 323

Query: 327 CAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ 386
           CA +VIKSLG+D+KK++KCMGDPDAD DNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ
Sbjct: 324 CADSVIKSLGIDSKKLDKCMGDPDADLDNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ 383

Query: 387 YRGKLEKGAVLKAICSGFEETTEPAVCLSGDVETNECLDNNGGCWQDKTANVTACKDTFR 446
           YRGKLEK AVLKA+CSGFEETTEPA+CLS DVE+NECLDNNGGCWQDK+AN+TACKDTFR
Sbjct: 384 YRGKLEKSAVLKALCSGFEETTEPAICLSTDVESNECLDNNGGCWQDKSANITACKDTFR 443

Query: 447 GRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQC 506
           GRVCECP VDGVQFKGDGYSHCE SGPG+C INNGGCWHE +DGH +SAC+D ++ KC+C
Sbjct: 444 GRVCECPTVDGVQFKGDGYSHCEPSGPGRCTINNGGCWHEERDGHAFSACVDKDSVKCEC 503

Query: 507 PPGFKGDGVKSCILMN 522
           PPGFKGDG K C  +N
Sbjct: 504 PPGFKGDGTKKCEDIN 519




Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles.
Arabidopsis thaliana (taxid: 3702)
>sp|Q56ZQ3|VSR4_ARATH Vacuolar-sorting receptor 4 OS=Arabidopsis thaliana GN=VSR4 PE=2 SV=2 Back     alignment and function description
>sp|P93484|VSR1_PEA Vacuolar-sorting receptor 1 OS=Pisum sativum GN=BP80 PE=1 SV=1 Back     alignment and function description
>sp|P93026|VSR1_ARATH Vacuolar-sorting receptor 1 OS=Arabidopsis thaliana GN=VSR1 PE=1 SV=2 Back     alignment and function description
>sp|O22925|VSR2_ARATH Vacuolar-sorting receptor 2 OS=Arabidopsis thaliana GN=VSR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FYH7|VSR6_ARATH Vacuolar-sorting receptor 6 OS=Arabidopsis thaliana GN=VSR6 PE=2 SV=3 Back     alignment and function description
>sp|Q8L7E3|VSR7_ARATH Vacuolar-sorting receptor 7 OS=Arabidopsis thaliana GN=VSR7 PE=2 SV=2 Back     alignment and function description
>sp|O64758|VSR5_ARATH Vacuolar-sorting receptor 5 OS=Arabidopsis thaliana GN=VSR5 PE=2 SV=1 Back     alignment and function description
>sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 Back     alignment and function description
>sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query560
224056244630 predicted protein [Populus trichocarpa] 0.914 0.812 0.878 0.0
224105715630 predicted protein [Populus trichocarpa] 0.894 0.795 0.896 0.0
255573159633 zinc finger protein, putative [Ricinus c 0.925 0.818 0.855 0.0
356575734631 PREDICTED: vacuolar-sorting receptor 1-l 0.912 0.809 0.839 0.0
356575738621 PREDICTED: vacuolar-sorting receptor 1-l 0.912 0.822 0.839 0.0
356536097631 PREDICTED: vacuolar-sorting receptor 1-l 0.912 0.809 0.839 0.0
356536101621 PREDICTED: vacuolar-sorting receptor 1-l 0.912 0.822 0.839 0.0
297831944627 hypothetical protein ARALYDRAFT_899691 [ 0.885 0.791 0.846 0.0
356575736636 PREDICTED: vacuolar-sorting receptor 1-l 0.912 0.803 0.827 0.0
296083057631 unnamed protein product [Vitis vinifera] 0.912 0.809 0.841 0.0
>gi|224056244|ref|XP_002298772.1| predicted protein [Populus trichocarpa] gi|222846030|gb|EEE83577.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/512 (87%), Positives = 484/512 (94%)

Query: 8   TLKLFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGA 67
           +L LFLGFL++SL    S++RFVVEKNSL VTSP+KIKG++DSAIGNFGIPQYGGSMAGA
Sbjct: 7   SLNLFLGFLVISLIAPRSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGA 66

Query: 68  VTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVAD 127
           V YPK+N+KGC+EF  FGISF++KPGALP FVLVDRGDCFFALKVWNAQKAGASAVLVAD
Sbjct: 67  VVYPKDNKKGCKEFDGFGISFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVAD 126

Query: 128 DIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAV 187
           D+EE LITMDTP ED SSA+YIENITIPSALI+KSF ETLKKALS G+MVNVNLDWREAV
Sbjct: 127 DMEEPLITMDTPAEDASSAQYIENITIPSALIEKSFSETLKKALSNGDMVNVNLDWREAV 186

Query: 188 PHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMT 247
           PHPDDRVEYELWTNSNDECGVKCDMLM FVK+FRG AQILEKGGYTQFTPHYITWYCP  
Sbjct: 187 PHPDDRVEYELWTNSNDECGVKCDMLMEFVKDFRGAAQILEKGGYTQFTPHYITWYCPQA 246

Query: 248 FTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWD 307
           FTLSRQCKSQCINHGRYCAPDPEQDFSSGY+GKDVVLENLRQLCVFKVA E+KKPWVWWD
Sbjct: 247 FTLSRQCKSQCINHGRYCAPDPEQDFSSGYDGKDVVLENLRQLCVFKVANETKKPWVWWD 306

Query: 308 YVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVG 367
           YVTDFQIRCPMK+KKYNKECA AVIKSLGLD KKI+KCMGDP A++DNPVLKEEQDAQVG
Sbjct: 307 YVTDFQIRCPMKEKKYNKECADAVIKSLGLDGKKIDKCMGDPKANSDNPVLKEEQDAQVG 366

Query: 368 KGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGDVETNECLDNN 427
           KG+RGDVTILPTLVVNNRQYRGKLEKGAVLKA+CSGFEETTEPAVCLSGDVETNECLDNN
Sbjct: 367 KGTRGDVTILPTLVVNNRQYRGKLEKGAVLKALCSGFEETTEPAVCLSGDVETNECLDNN 426

Query: 428 GGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHES 487
           GGCWQDK AN+TAC+DTFRGRVCECPLVDGVQFKGDGY +CEVSG G+CKINNGGCWHES
Sbjct: 427 GGCWQDKIANITACRDTFRGRVCECPLVDGVQFKGDGYKNCEVSGSGRCKINNGGCWHES 486

Query: 488 KDGHTYSACLDSENGKCQCPPGFKGDGVKSCI 519
           +DGHT+SACLD + GKCQCPPGFKGDGVKSC+
Sbjct: 487 QDGHTFSACLDVDGGKCQCPPGFKGDGVKSCL 518




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224105715|ref|XP_002313909.1| predicted protein [Populus trichocarpa] gi|222850317|gb|EEE87864.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255573159|ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis] gi|223533149|gb|EEF34907.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356575734|ref|XP_003555992.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356575738|ref|XP_003555994.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 3 [Glycine max] Back     alignment and taxonomy information
>gi|356536097|ref|XP_003536576.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356536101|ref|XP_003536578.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 3 [Glycine max] Back     alignment and taxonomy information
>gi|297831944|ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. lyrata] gi|297329694|gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356575736|ref|XP_003555993.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|296083057|emb|CBI22461.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query560
TAIR|locus:2046911628 VSR3 "vaculolar sorting recept 0.894 0.797 0.840 6.6e-248
TAIR|locus:2046931628 VSR4 "vacuolar sorting recepto 0.894 0.797 0.830 3.3e-246
TAIR|locus:2085136623 VSR1 "vacuolar sorting recepto 0.887 0.797 0.716 4e-216
TAIR|locus:2015726631 VSR6 "VACUOLAR SORTING RECEPTO 0.866 0.768 0.650 4.9e-188
TAIR|locus:2044782618 VSR5 "VACUOLAR SORTING RECEPTO 0.864 0.783 0.610 2.3e-174
UNIPROTKB|E1BGE0 1572 E1BGE0 "Uncharacterized protei 0.175 0.062 0.309 9.7e-06
TIGR_CMR|SO_3800 1215 SO_3800 "serine protease, subt 0.164 0.075 0.339 5.3e-05
UNIPROTKB|F1LRJ5 909 Scube1 "Protein Scube1" [Rattu 0.125 0.077 0.380 7.9e-05
UNIPROTKB|Q7NC92 1054 glr3087 "Glr3087 protein" [Glo 0.155 0.082 0.364 0.00016
UNIPROTKB|Q29RU2 547 OIT3 "Oncoprotein-induced tran 0.189 0.193 0.333 0.0003
TAIR|locus:2046911 VSR3 "vaculolar sorting receptor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2388 (845.7 bits), Expect = 6.6e-248, P = 6.6e-248
 Identities = 421/501 (84%), Positives = 463/501 (92%)

Query:    27 SRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGI 86
             +RFVVEKNSL VTSPE IKG+HDSAIGNFGIPQYGGSMAG V YPKEN+K C+EF DF I
Sbjct:    24 ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI 83

Query:    87 SFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSA 146
             SFK++PGALP F+LVDRGDCFFALKVWNAQKAGASAVLVAD+++E LITMDTPEED+SSA
Sbjct:    84 SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA 143

Query:   147 KYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC 206
             KYIENITIPSAL+ K FGE LKKA+SGG+MVN+NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct:   144 KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC 203

Query:   207 GVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCA 266
             GVKCDMLM FVK+F+G AQILEKGG+TQF PHYITWYCP  FTLSRQCKSQCIN GRYCA
Sbjct:   204 GVKCDMLMEFVKDFKGAAQILEKGGFTQFRPHYITWYCPHAFTLSRQCKSQCINKGRYCA 263

Query:   267 PDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKE 326
             PDPEQDFSSGY+GKDVV+ENLRQLCV+KVA E+ KPWVWWDYVTDFQIRCPMK+KKYNKE
Sbjct:   264 PDPEQDFSSGYDGKDVVVENLRQLCVYKVANETGKPWVWWDYVTDFQIRCPMKEKKYNKE 323

Query:   327 CAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ 386
             CA +VIKSLG+D+KK++KCMGDPDAD DNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ
Sbjct:   324 CADSVIKSLGIDSKKLDKCMGDPDADLDNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ 383

Query:   387 YRGKLEKGAVLKAICSGFEETTEPAVCLSGDVETNECLDNNGGCWQDKTANVTACKDTFR 446
             YRGKLEK AVLKA+CSGFEETTEPA+CLS DVE+NECLDNNGGCWQDK+AN+TACKDTFR
Sbjct:   384 YRGKLEKSAVLKALCSGFEETTEPAICLSTDVESNECLDNNGGCWQDKSANITACKDTFR 443

Query:   447 GRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQC 506
             GRVCECP VDGVQFKGDGYSHCE SGPG+C INNGGCWHE +DGH +SAC+D ++ KC+C
Sbjct:   444 GRVCECPTVDGVQFKGDGYSHCEPSGPGRCTINNGGCWHEERDGHAFSACVDKDSVKCEC 503

Query:   507 PPGFKGDGVKSCILMNAKRGK 527
             PPGFKGDG K C  +N  + K
Sbjct:   504 PPGFKGDGTKKCEDINECKEK 524




GO:0005509 "calcium ion binding" evidence=IEA
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0006623 "protein targeting to vacuole" evidence=ISS;IMP;TAS
GO:0006886 "intracellular protein transport" evidence=ISS
GO:0017119 "Golgi transport complex" evidence=IPI
GO:0016020 "membrane" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2046931 VSR4 "vacuolar sorting receptor 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085136 VSR1 "vacuolar sorting receptor homolog 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015726 VSR6 "VACUOLAR SORTING RECEPTOR 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044782 VSR5 "VACUOLAR SORTING RECEPTOR 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGE0 E1BGE0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3800 SO_3800 "serine protease, subtilase family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRJ5 Scube1 "Protein Scube1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q7NC92 glr3087 "Glr3087 protein" [Gloeobacter violaceus PCC 7421 (taxid:251221)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RU2 OIT3 "Oncoprotein-induced transcript 3 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P93484VSR1_PEANo assigned EC number0.83260.89460.8041N/Ano
Q56ZQ3VSR4_ARATHNo assigned EC number0.83660.88570.7898yesno
P93026VSR1_ARATHNo assigned EC number0.70700.91070.8186nono
O80977VSR3_ARATHNo assigned EC number0.84670.88570.7898yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_I4100
hypothetical protein (630 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
cd02125127 cd02125, PA_VSR, PA_VSR: Protease-associated (PA) 6e-70
cd02123153 cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-a 4e-17
cd04818118 cd04818, PA_subtilisin_1, PA_subtilisin_1: Proteas 1e-16
cd00538126 cd00538, PA, PA: Protease-associated (PA) domain 5e-16
cd04816122 cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease- 5e-11
cd02132139 cd02132, PA_GO-like, PA_GO-like: Protease-associat 2e-10
pfam0222596 pfam02225, PA, PA domain 3e-10
cd04813117 cd04813, PA_1, PA_1: Protease-associated (PA) doma 9e-09
cd02133143 cd02133, PA_C5a_like, PA_C5a_like: Protease-associ 2e-07
cd02130122 cd02130, PA_ScAPY_like, PA_ScAPY_like: Protease-as 8e-07
cd02127118 cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease- 1e-05
cd02129120 cd02129, PA_hSPPL_like, PA_hSPPL_like: Protease-as 1e-05
cd02126126 cd02126, PA_EDEM3_like, PA_EDEM3_like: protease as 2e-04
cd02124129 cd02124, PA_PoS1_like, PA_PoS1_like: Protease-asso 0.002
cd02122138 cd02122, PA_GRAIL_like, PA _GRAIL_like: Protease-a 0.003
>gnl|CDD|239040 cd02125, PA_VSR, PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR) Back     alignment and domain information
 Score =  220 bits (562), Expect = 6e-70
 Identities = 83/128 (64%), Positives = 100/128 (78%), Gaps = 1/128 (0%)

Query: 54  NFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVW 113
           NFG+PQYGG++ G V YPKENR GC+EF  F    K++PG  P  +L+DRG CFF LK W
Sbjct: 1   NFGLPQYGGTLTGVVVYPKENRTGCKEFDVFFKPKKSEPGRRPVILLLDRGGCFFTLKAW 60

Query: 114 NAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSG 173
           NAQ+AGA+AVLVAD+++E L+TMDTPEE   SA YIE ITIPSALI K+FGE LKKA+S 
Sbjct: 61  NAQQAGAAAVLVADNVDEPLLTMDTPEES-GSADYIEKITIPSALITKAFGEKLKKAISN 119

Query: 174 GEMVNVNL 181
           GEMV + L
Sbjct: 120 GEMVVIKL 127


This group includes various PA domain-containing VSRs such as garden pea BP-80, pumpkin PV72, and various Arabidopsis VSRs including AtVSR1. In contrast to most eukaryotes, which only have one or two VSRs, plants have several. This may in part be a reflection of having a more complex vacuolar system with both lytic vacuoles and storage vacuoles. The lytic vacuole is thought to be equivalent to the mammalian lysosome and the yeast vacuole. Pea BP-80 is a type 1 transmembrane protein, involved in the targeting of proteins to the lytic vacuole; it has been suggested that this protein also mediates targeting to the storage vacuole. PV72 and AtVSR1 may mediate transport of seed storage proteins to protein storage vacuoles. The significance of the PA domain to VSRs has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Length = 127

>gnl|CDD|239038 cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like Back     alignment and domain information
>gnl|CDD|240122 cd04818, PA_subtilisin_1, PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1 Back     alignment and domain information
>gnl|CDD|238300 cd00538, PA, PA: Protease-associated (PA) domain Back     alignment and domain information
>gnl|CDD|240120 cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH) Back     alignment and domain information
>gnl|CDD|239047 cd02132, PA_GO-like, PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10 Back     alignment and domain information
>gnl|CDD|216938 pfam02225, PA, PA domain Back     alignment and domain information
>gnl|CDD|240117 cd04813, PA_1, PA_1: Protease-associated (PA) domain subgroup 1 Back     alignment and domain information
>gnl|CDD|239048 cd02133, PA_C5a_like, PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase Back     alignment and domain information
>gnl|CDD|239045 cd02130, PA_ScAPY_like, PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY) Back     alignment and domain information
>gnl|CDD|239042 cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa) Back     alignment and domain information
>gnl|CDD|239044 cd02129, PA_hSPPL_like, PA_hSPPL_like: Protease-associated domain containing human signal peptide peptidase-like (hSPPL)-like Back     alignment and domain information
>gnl|CDD|239041 cd02126, PA_EDEM3_like, PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins Back     alignment and domain information
>gnl|CDD|239039 cd02124, PA_PoS1_like, PA_PoS1_like: Protease-associated (PA) domain PoS1-like Back     alignment and domain information
>gnl|CDD|239037 cd02122, PA_GRAIL_like, PA _GRAIL_like: Protease-associated (PA) domain GRAIL-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 560
cd02125127 PA_VSR PA_VSR: Protease-associated (PA) domain-con 99.95
cd02122138 PA_GRAIL_like PA _GRAIL_like: Protease-associated 99.87
cd02123153 PA_C_RZF_like PA_C-RZF_ like: Protease-associated 99.87
cd02126126 PA_EDEM3_like PA_EDEM3_like: protease associated d 99.86
cd02127118 PA_hPAP21_like PA_hPAP21_like: Protease-associated 99.85
cd02132139 PA_GO-like PA_GO-like: Protease-associated domain 99.84
cd04813117 PA_1 PA_1: Protease-associated (PA) domain subgrou 99.8
cd02129120 PA_hSPPL_like PA_hSPPL_like: Protease-associated d 99.76
cd04816122 PA_SaNapH_like PA_SaNapH_like: Protease-associated 99.75
cd02130122 PA_ScAPY_like PA_ScAPY_like: Protease-associated d 99.73
cd04818118 PA_subtilisin_1 PA_subtilisin_1: Protease-associat 99.7
KOG3920193 consensus Uncharacterized conserved protein, conta 99.65
cd02124129 PA_PoS1_like PA_PoS1_like: Protease-associated (PA 99.64
cd04817139 PA_VapT_like PA_VapT_like: Protease-associated dom 99.62
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.62
PF02225101 PA: PA domain; InterPro: IPR003137 The PA (Proteas 99.47
cd00538126 PA PA: Protease-associated (PA) domain. The PA dom 99.44
cd02133143 PA_C5a_like PA_C5a_like: Protease-associated domai 99.38
KOG2442541 consensus Uncharacterized conserved protein, conta 99.35
cd04819127 PA_2 PA_2: Protease-associated (PA) domain subgrou 99.34
KOG1214 1289 consensus Nidogen and related basement membrane pr 99.27
cd04815134 PA_M28_2 PA_M28_2: Protease-associated (PA) domain 99.18
cd02120126 PA_subtilisin_like PA_subtilisin_like: Protease-as 99.04
cd02128183 PA_TfR PA_TfR: Protease-associated domain containi 98.88
KOG1214 1289 consensus Nidogen and related basement membrane pr 98.52
cd02121220 PA_GCPII_like PA_GCPII_like: Protease-associated d 98.43
KOG1219 4289 consensus Uncharacterized conserved protein, conta 98.4
cd04822151 PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) do 98.31
cd04814142 PA_M28_1 PA_M28_1: Protease-associated (PA) domain 98.21
cd02131153 PA_hNAALADL2_like PA_hNAALADL2_like: Protease-asso 98.11
cd04820137 PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) do 98.08
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.94
PF1266224 cEGF: Complement Clr-like EGF-like 97.74
KOG1219 4289 consensus Uncharacterized conserved protein, conta 97.73
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 97.5
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.44
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.43
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.36
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.23
KOG4260350 consensus Uncharacterized conserved protein [Funct 97.1
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 96.91
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 96.67
smart0017939 EGF_CA Calcium-binding EGF-like domain. 96.14
KOG4260350 consensus Uncharacterized conserved protein [Funct 95.95
PF1266224 cEGF: Complement Clr-like EGF-like 95.72
KOG1217 487 consensus Fibrillins and related proteins containi 95.68
KOG1217487 consensus Fibrillins and related proteins containi 95.67
smart0017939 EGF_CA Calcium-binding EGF-like domain. 95.56
PF0000832 EGF: EGF-like domain This is a sub-family of the P 95.43
cd04821157 PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) do 94.34
KOG2195702 consensus Transferrin receptor and related protein 94.17
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 93.85
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 93.58
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 93.11
smart0018135 EGF Epidermal growth factor-like domain. 92.71
cd0005336 EGF Epidermal growth factor domain, found in epide 92.24
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 90.81
cd0005336 EGF Epidermal growth factor domain, found in epide 90.28
smart0018135 EGF Epidermal growth factor-like domain. 90.27
PF0000832 EGF: EGF-like domain This is a sub-family of the P 89.34
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 81.71
PF13462162 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV 80.76
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 80.73
>cd02125 PA_VSR PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR) Back     alignment and domain information
Probab=99.95  E-value=3.3e-27  Score=212.41  Aligned_cols=127  Identities=65%  Similarity=1.100  Sum_probs=106.4

Q ss_pred             cCCCCCCCCceeEEEEccCCCcCCCCCCCCCCcccccCCCCCCcEEEEecCCCCHHHHHHHHHHcCCcEEEEEecCCCce
Q 008587           54 NFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEAL  133 (560)
Q Consensus        54 ~FG~~~~g~~~~G~lv~~~~~~~gC~~~~~~~~~~~~~~~~~~~IvLV~RG~CsF~~Kv~nAq~aGA~avIV~n~~~~~l  133 (560)
                      |||.|+||++++|.|+|++.+.+||++++......+.++..+++||||+||+|+|.+|++|||++||++|||||+.++++
T Consensus         1 ~FG~~~yg~~~~G~l~~~~~~~~gC~~~~~~~~~~~~~~~~~~~IvLv~RG~C~F~~K~~~Aq~aGA~avII~n~~~~~~   80 (127)
T cd02125           1 NFGLPQYGGTLTGVVVYPKENRTGCKEFDVFFKPKKSEPGRRPVILLLDRGGCFFTLKAWNAQQAGAAAVLVADNVDEPL   80 (127)
T ss_pred             CCCCCCcCCeeEEEEEecCCccccCCCCcccccccccccCCCceEEEEECCCcCHHHHHHHHHHCCCcEEEEEECCCCcc
Confidence            79999999999999999988999999997642122223467789999999999999999999999999999999988777


Q ss_pred             eecCCCccccccccccCccceeEEEEcHHHHHHHHHHHhCCCeEEEEE
Q 008587          134 ITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNL  181 (560)
Q Consensus       134 ~~m~~~~~~~~~~~~~~~i~IPsv~Is~~~G~~L~~~l~~~~~V~v~l  181 (560)
                      +.|..+.++. ..++..+++||++||++++|+.|++.|++|..|+|+|
T Consensus        81 ~~m~~~~~~~-~~~~~~~i~IP~v~Is~~~G~~L~~~l~~g~~V~v~~  127 (127)
T cd02125          81 LTMDTPEESG-SADYIEKITIPSALITKAFGEKLKKAISNGEMVVIKL  127 (127)
T ss_pred             ccccCccccc-ccccCCCceEeEEEECHHHHHHHHHHHhcCCeEEEeC
Confidence            7886544311 1134467899999999999999999999999999875



This group includes various PA domain-containing VSRs such as garden pea BP-80, pumpkin PV72, and various Arabidopsis VSRs including AtVSR1. In contrast to most eukaryotes, which only have one or two VSRs, plants have several. This may in part be a reflection of having a more complex vacuolar system with both lytic vacuoles and storage vacuoles. The lytic vacuole is thought to be equivalent to the mammalian lysosome and the yeast vacuole. Pea BP-80 is a type 1 transmembrane protein, involved in the targeting of proteins to the lytic vacuole; it has been suggested that this protein also mediates targeting to the storage vacuole. PV72 and AtVSR1 may mediate transport of seed storage proteins to protein storage vacuoles. The significance of the PA domain to VSRs has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may partic

>cd02122 PA_GRAIL_like PA _GRAIL_like: Protease-associated (PA) domain GRAIL-like Back     alignment and domain information
>cd02123 PA_C_RZF_like PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like Back     alignment and domain information
>cd02126 PA_EDEM3_like PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins Back     alignment and domain information
>cd02127 PA_hPAP21_like PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa) Back     alignment and domain information
>cd02132 PA_GO-like PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10 Back     alignment and domain information
>cd04813 PA_1 PA_1: Protease-associated (PA) domain subgroup 1 Back     alignment and domain information
>cd02129 PA_hSPPL_like PA_hSPPL_like: Protease-associated domain containing human signal peptide peptidase-like (hSPPL)-like Back     alignment and domain information
>cd04816 PA_SaNapH_like PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH) Back     alignment and domain information
>cd02130 PA_ScAPY_like PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY) Back     alignment and domain information
>cd04818 PA_subtilisin_1 PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1 Back     alignment and domain information
>KOG3920 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only] Back     alignment and domain information
>cd02124 PA_PoS1_like PA_PoS1_like: Protease-associated (PA) domain PoS1-like Back     alignment and domain information
>cd04817 PA_VapT_like PA_VapT_like: Protease-associated domain containing proteins like VapT from Vibrio metschnikovii strain RH530 Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02225 PA: PA domain; InterPro: IPR003137 The PA (Protease associated) domain is found as an insert domain in diverse proteases, which include the MEROPS peptidase families A22B, M28, and S8A [] Back     alignment and domain information
>cd00538 PA PA: Protease-associated (PA) domain Back     alignment and domain information
>cd02133 PA_C5a_like PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase Back     alignment and domain information
>KOG2442 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only] Back     alignment and domain information
>cd04819 PA_2 PA_2: Protease-associated (PA) domain subgroup 2 Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>cd04815 PA_M28_2 PA_M28_2: Protease-associated (PA) domain, peptidase family M28, subfamily-2 Back     alignment and domain information
>cd02120 PA_subtilisin_like PA_subtilisin_like: Protease-associated domain containing subtilisin-like proteases Back     alignment and domain information
>cd02128 PA_TfR PA_TfR: Protease-associated domain containing proteins like transferrin receptor (TfR) Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>cd02121 PA_GCPII_like PA_GCPII_like: Protease-associated domain containing protein, glutamate carboxypeptidase II (GCPII)-like Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>cd04822 PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 3 Back     alignment and domain information
>cd04814 PA_M28_1 PA_M28_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1 Back     alignment and domain information
>cd02131 PA_hNAALADL2_like PA_hNAALADL2_like: Protease-associated domain containing proteins like human N-acetylated alpha-linked acidic dipeptidase-like 2 protein (hNAALADL2) Back     alignment and domain information
>cd04820 PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 1 Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd04821 PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 2 Back     alignment and domain information
>KOG2195 consensus Transferrin receptor and related proteins containing the protease-associated (PA) domain [Posttranslational modification, protein turnover, chaperones; Inorganic ion transport and metabolism; General function prediction only] Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
3icu_A194 E3 ubiquitin-protein ligase RNF128; E3 ligase, ene 1e-20
2vh0_B134 Activated factor XA light chain; serine protease, 8e-07
1xf1_A 926 C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St 2e-06
3v65_B 386 Low-density lipoprotein receptor-related protein; 5e-06
1aut_L114 Activated protein C; serine proteinase, plasma cal 6e-06
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 8e-06
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 8e-06
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-05
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-05
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-05
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-05
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 2e-05
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 1e-04
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 3e-04
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 1e-04
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-04
2wph_E59 Coagulation factor IXA light chain; serine proteas 2e-04
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-04
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 3e-04
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 3e-04
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 4e-04
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 5e-04
3gmf_A205 Protein-disulfide isomerase; oxidoreductase, PSI-2 6e-04
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidored 9e-04
>3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens} Length = 194 Back     alignment and structure
 Score = 89.1 bits (220), Expect = 1e-20
 Identities = 24/141 (17%), Positives = 50/141 (35%), Gaps = 12/141 (8%)

Query: 46  GSHDSAIGNFGIPQYGGSMAGAVTYPKE--NRKGCREFGDFGISFKAKPGALPNFV-LVD 102
               S  G +G       +AG +  P        C    +F +          +++ L+ 
Sbjct: 52  VWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQ 111

Query: 103 RGD-CFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDK 161
           RG  C FA K+  A + GAS  ++ +        +           +   + I + +I  
Sbjct: 112 RGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVI--------PMSHPGAVDIVAIMIGN 163

Query: 162 SFGETLKKALSGGEMVNVNLD 182
             G  + +++  G  V + ++
Sbjct: 164 LKGTKILQSIQRGIQVTMVIE 184


>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Length = 926 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Length = 175 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} Length = 205 Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Length = 186 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query560
3icu_A194 E3 ubiquitin-protein ligase RNF128; E3 ligase, ene 99.9
3iib_A444 Peptidase M28; YP_926796.1, structural genomics, J 99.26
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.21
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.2
2ek8_A421 Aminopeptidase; metalloproteinase, hydrolase; 1.80 99.17
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.15
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.14
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.1
2bou_A143 EGF-like module containing mucin-like hormone rece 99.09
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.07
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.02
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.99
2bou_A143 EGF-like module containing mucin-like hormone rece 98.99
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.97
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.97
3fed_A707 Glutamate carboxypeptidase III; metallopeptidase, 98.96
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.94
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.89
3kas_A640 Transferrin receptor protein 1; transferrin recept 98.86
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.81
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.79
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.78
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.78
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.78
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.77
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.7
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.7
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.66
2vh0_B134 Activated factor XA light chain; serine protease, 98.64
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.55
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.54
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.47
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.42
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.36
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.36
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.35
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 98.29
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.22
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.17
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.12
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.09
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.07
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.99
3i6s_A649 Subtilisin-like protease; PA-domain, FN3-domain, h 97.99
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.97
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.94
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.91
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.89
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.87
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.81
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.8
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.7
1xf1_A 926 C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St 97.64
1y9z_A441 Alkaline serine protease; subtilisin-like alpha/be 97.63
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.54
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.45
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.45
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.42
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.41
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 97.23
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 97.22
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.19
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.17
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.17
1aut_L114 Activated protein C; serine proteinase, plasma cal 97.1
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.09
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.01
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.99
1ob1_C99 Major merozoite surface protein; immune system, im 96.95
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.9
2vh0_B134 Activated factor XA light chain; serine protease, 96.82
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 96.78
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 96.61
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 96.5
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.39
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 96.38
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 96.22
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 96.18
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.04
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 95.93
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 95.8
1szb_A170 Mannose binding lectin-associated serine protease- 95.73
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 95.7
1szb_A170 Mannose binding lectin-associated serine protease- 95.7
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 95.34
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 95.24
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 95.02
1a3p_A45 Epidermal growth factor; disulfide connectivities, 94.93
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 94.91
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 94.84
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 94.57
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 94.31
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 94.15
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 94.06
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 93.92
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 93.52
1a3p_A45 Epidermal growth factor; disulfide connectivities, 93.35
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 93.33
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 93.18
1nzi_A159 Complement C1S component; calcium, innate immunity 92.56
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 92.54
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 92.3
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-lik 92.22
1nzi_A159 Complement C1S component; calcium, innate immunity 92.18
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 91.68
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidored 90.61
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 90.54
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 90.44
1nql_B53 Epidermal growth factor; cell surface receptor, ty 89.59
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 89.3
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 89.29
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 89.26
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 89.14
3vta_A621 Cucumisin; subtilisin-like fold, serine protease, 88.25
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 87.55
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 87.19
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 86.02
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 85.44
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 84.91
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 84.56
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 84.17
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 83.76
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 82.44
1nql_B53 Epidermal growth factor; cell surface receptor, ty 81.88
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 81.02
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 80.59
>3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
Probab=99.90  E-value=4.3e-23  Score=196.31  Aligned_cols=149  Identities=20%  Similarity=0.246  Sum_probs=117.2

Q ss_pred             ccceEEEEeceEEEEcc--Cc---ccceeeeeeccCCCCCCCCceeEEEEccC--CCcCCCCCCCCCCcccc-cCCCCCC
Q 008587           25 SVSRFVVEKNSLMVTSP--EK---IKGSHDSAIGNFGIPQYGGSMAGAVTYPK--ENRKGCREFGDFGISFK-AKPGALP   96 (560)
Q Consensus        25 ~~~~~~ve~~~l~V~~P--~~---l~~~~~~~~a~FG~~~~g~~~~G~lv~~~--~~~~gC~~~~~~~~~~~-~~~~~~~   96 (560)
                      ...+....++.+.|..-  ..   ....+....|+||.+.+.+.+.|.|+++.  ++.+||++++++..... +.+..++
T Consensus        26 ~~~~~~~~~A~vn~sy~d~~~~~n~t~~~~~e~a~FG~~~p~~~v~G~lv~~~~~~~~~GC~~~~~~~~~~~~~~~~~~g  105 (194)
T 3icu_A           26 MDGAEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVS  105 (194)
T ss_dssp             CCCSSCEEEEEEEEEEECCSSCTTCEEEEEEEEEEECTTSCCSCEEEEEECBSSTTCTTCCSTTCCBCCCBCTTSSCBCC
T ss_pred             cccceeEEEEEEEEEEECCCCCccceeeecccccccCCCCCCCCcEEEEEecCCCCCcCCCCCCccccCCcccccccCCC
Confidence            33445567777777664  32   22347789999999999999999999985  47899999876431111 1123468


Q ss_pred             cEEEEecCC-CCHHHHHHHHHHcCCcEEEEEecCC--CceeecCCCccccccccccCccceeEEEEcHHHHHHHHHHHhC
Q 008587           97 NFVLVDRGD-CFFALKVWNAQKAGASAVLVADDIE--EALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSG  173 (560)
Q Consensus        97 ~IvLV~RG~-CsF~~Kv~nAq~aGA~avIV~n~~~--~~l~~m~~~~~~~~~~~~~~~i~IPsv~Is~~~G~~L~~~l~~  173 (560)
                      +||||+||+ |+|.+|++|||++||+||||||+..  +.+.+|..+.          ..+||++||++++|+.|+++|++
T Consensus       106 kIaLV~RG~~CsF~~Kv~nAq~aGA~avIIyNn~~~g~~~~~m~~~~----------~~~IPsv~Is~~~G~~L~~~L~~  175 (194)
T 3icu_A          106 WLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPG----------AVDIVAIMIGNLKGTKILQSIQR  175 (194)
T ss_dssp             EEEEEESCTTCCHHHHHHHHHHTTCSEEEEECCTTCTTCCCCCCCTT----------CCSSEEEEECHHHHHHHHHHHHT
T ss_pred             eEEEEECCCCcCHHHHHHHHHHCCCcEEEEEeCCCCCCceeeecCCC----------CCceeEEEECHHHHHHHHHHHHC
Confidence            999999999 9999999999999999999999852  3456775321          35799999999999999999999


Q ss_pred             CCeEEEEEEe
Q 008587          174 GEMVNVNLDW  183 (560)
Q Consensus       174 ~~~V~v~l~~  183 (560)
                      |.+|+++|.+
T Consensus       176 G~~Vtvti~v  185 (194)
T 3icu_A          176 GIQVTMVIEV  185 (194)
T ss_dssp             TCCEEEEEEE
T ss_pred             CCeEEEEEEC
Confidence            9999999988



>3iib_A Peptidase M28; YP_926796.1, structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.70A {Shewanella amazonensis SB2B} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3fed_A Glutamate carboxypeptidase III; metallopeptidase, bimetallic active site, N-glycosylation, C cation, chloride anion, zinc IONS, dipept glycoprotein; HET: NAG BIX; 1.29A {Homo sapiens} PDB: 3fec_A* 3fee_A* 3ff3_A* 2c6c_A* 2c6g_A* 2c6p_A* 2cij_A* 2jbj_A* 2jbk_A* 3rbu_A* 3bi1_A* 2oot_A* 2pvv_A* 2pvw_A* 2xei_A* 2or4_A* 3bi0_A* 3bhx_A* 3d7d_A* 3d7f_A* ... Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3kas_A Transferrin receptor protein 1; transferrin receptor 1, arenavirus, cell MEMB disulfide bond, endocytosis, HOST-virus inter receptor, secreted, transmembrane; HET: NAG FUC BMA MAN; 2.40A {Homo sapiens} PDB: 1de4_C* 3s9l_A* 3s9m_A* 3s9n_A* 1cx8_A* 1suv_A 2nsu_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Back     alignment and structure
>1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 560
d1de4c2193 c.8.4.1 (C:190-382) Transferrin receptor ectodomai 5e-04
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 7e-04
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 8e-04
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 0.002
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 0.003
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 0.002
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 0.003
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 0.003
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 0.004
>d1de4c2 c.8.4.1 (C:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]} Length = 193 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: The "swivelling" beta/beta/alpha domain
superfamily: PA domain
family: PA domain
domain: Transferrin receptor ectodomain, apical domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 39.2 bits (91), Expect = 5e-04
 Identities = 19/68 (27%), Positives = 24/68 (35%), Gaps = 8/68 (11%)

Query: 63  SMAGAVTYPKENRKGCRE--FGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGA 120
           S A  VT    +     +  F D               V+V  G   FA KV NA+   A
Sbjct: 34  SKAATVTGKLVHANFGTKKDFEDLYTPVNGS------IVIVRAGKITFAEKVANAESLNA 87

Query: 121 SAVLVADD 128
             VL+  D
Sbjct: 88  IGVLIYMD 95


>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query560
d1de4c2193 Transferrin receptor ectodomain, apical domain {Hu 98.72
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d3bi1a2233 Glutamate carboxypeptidase II {Human (Homo sapiens 98.37
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.35
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.27
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1nt0a345 Mannose-binding protein associated serine protease 98.11
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1szba245 Mannose-binding protein associated serine protease 98.05
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.05
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.93
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.91
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.9
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.81
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.74
d1nt0a345 Mannose-binding protein associated serine protease 97.72
d1szba245 Mannose-binding protein associated serine protease 97.72
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.7
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.68
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.63
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.62
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.59
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.53
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.52
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.49
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.37
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.3
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.29
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.27
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.25
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.23
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.16
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.01
d1ijqa250 Low density lipoprotein (LDL) receptor, different 96.78
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 96.75
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.73
d1ijqa250 Low density lipoprotein (LDL) receptor, different 96.63
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.44
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 96.41
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.39
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.35
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 96.35
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.29
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 96.28
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 95.92
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 95.92
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 95.83
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 95.76
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 95.76
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 95.41
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 94.73
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 94.31
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 93.74
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 93.64
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 93.6
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 93.47
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 93.46
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 92.3
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 92.29
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 89.22
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 89.19
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 88.94
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 86.65
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 85.51
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 85.47
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 80.69
>d1de4c2 c.8.4.1 (C:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: The "swivelling" beta/beta/alpha domain
superfamily: PA domain
family: PA domain
domain: Transferrin receptor ectodomain, apical domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.72  E-value=9.9e-09  Score=94.74  Aligned_cols=104  Identities=20%  Similarity=0.185  Sum_probs=67.2

Q ss_pred             CCceeEEEEccCCCcCCCCCCCCCCcccccCCCCCCcEEEEecCCCCHHHHHHHHHHcCCcEEEEEecCCCc--------
Q 008587           61 GGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEA--------  132 (560)
Q Consensus        61 g~~~~G~lv~~~~~~~gC~~~~~~~~~~~~~~~~~~~IvLV~RG~CsF~~Kv~nAq~aGA~avIV~n~~~~~--------  132 (560)
                      .+.++|.|||..   .| ...++.  .+.  -+..++||||+||.++|.+|++|||++||+|||||.+..+.        
T Consensus        36 ~G~v~g~lVy~n---~G-~~~Df~--~L~--~~v~GkI~l~r~G~~~~~~Kv~~A~~~GA~gviiysDp~d~~~~~~~~~  107 (193)
T d1de4c2          36 AATVTGKLVHAN---FG-TKKDFE--DLY--TPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELS  107 (193)
T ss_dssp             CEEEEECEEECS---TT-CHHHHH--TCS--SCCTTSEEEEESCSSCHHHHHHHHHHTTCCCEEEECCTTTSCCSCTTCC
T ss_pred             CCceeEEEEEcc---CC-CHHHHH--Hhc--cccCceEEEEeCCCCCHHHHHHHHHHcCceEEEEecCccccCCcCcccc
Confidence            467999999952   22 211111  111  24458999999999999999999999999999999864310        


Q ss_pred             ---eeec--------CCCccccc---cccccCccceeEEEEcHHHHHHHHHHHh
Q 008587          133 ---LITM--------DTPEEDIS---SAKYIENITIPSALIDKSFGETLKKALS  172 (560)
Q Consensus       133 ---l~~m--------~~~~~~~~---~~~~~~~i~IPsv~Is~~~G~~L~~~l~  172 (560)
                         ...+        +.|..+..   ......-..||+.-|+..|++.|++.|.
T Consensus       108 ~~g~~~~~~GDPlTPg~ps~~~~~~~~~~~~~lP~IP~~PIS~~dA~~lL~~L~  161 (193)
T d1de4c2         108 FFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME  161 (193)
T ss_dssp             CCEECCSSSSCTTSTTSCCCGGGTCCSCCCTTSCSSCEEECCHHHHHHHHTTBC
T ss_pred             cccccccCCCCCCCCCcccccccccCccccCCCCcCCeeeCCHHHHHHHHHHcC
Confidence               0111        11100000   0000112379999999999999999985



>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bi1a2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure