Citrus Sinensis ID: 008604

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560
MMLTSKPVKGEEAHSLGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLGEAREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKSLVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRAITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQEDKRAGETTRKGFYLYDERRKASPDPEVKKFIEKARSMSGVAIDPKFAKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLAERAGKGATLSAPVEEAKSKL
cccccccccHHHHHHcccccEEccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccccEEEEEcccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHccccccEEEcccccccccccccEEEccccccHHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccccccccEEEEcccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccccccHHHHHHHHcHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccHHHHccc
cccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccHHHHHcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHccccccEEEEcccccHHHHHHHHHHHccccccccEEEEccccccHHHHHcccccHHHEEEEEcccccccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHccccccccccEEEEEccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHcHccEEEEEccccccccccHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccHcccc
mmltskpvkgeeahslgLVDAVVAPNQLVSTARQWALDILEHrrpwvatlyktdkieplgEAREIFKFARAQArkqapnlthpiVCIDVVeagvvsgpraglQKEAEDFQKLLRSETCKSLVHIFFAqrgtskvpgvtdlglaprRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGvldyesfkDVDMVIEAIIENVSLKQQIFADLekycpphcilasntstidlnligertyskdrivgahffspahvMPLLEIvrtnqtspQVIVDLLDIGkkikktpivvgnctgfavnrmffpYTQAAFLLVERGTDLYLIDRAItkfgmpmgpfrlADLVGFGVAIATGMQfienfpertyksMIIPIMqedkragettrkgfylyderrkaspdpeVKKFIEKARsmsgvaidpkfaklseKDIVEMIFFPVVNEACRVFAEGIAVKAADLDiasvmgmgfppyrggIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLAEragkgatlsapVEEAKSKL
mmltskpvkgeeahslglvDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLGEAREIFKFARAQArkqapnltHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKSLVHIFfaqrgtskvpgvtdlglaprRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGrvranlqsrvkkgkmtqekfEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQVIVDLLDIgkkikktpiVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRAITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPimqedkragettrkgfylyderrkaspdpevKKFIEkarsmsgvaidpkfaKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLAERAGKgatlsapveeakskl
MMLTSKPVKGEEAHSLGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLGEAREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKSLVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRAITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQEDKRAGETTRKGFYLYDERRKASPDPEVKKFIEKARSMSGVAIDPKFAKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLAERAGKGATLSAPVEEAKSKL
***************LGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLGEAREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKSLVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANLQSRV******QEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRAITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQ*********RKGFYLY************************VAIDPKFAKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLAER******************
MMLTS**VKGEEAHSLGLVDAVVAPNQLVSTARQWALDILE********************AREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKSLVHIFFAQRGT*************RRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANL*******************LLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRAITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQEDKRAGETTRKGFYLYDERRKASPDPEVKKFIEKARSM***********LSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLAERAGKGA*************
*************HSLGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLGEAREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKSLVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANLQS*********EKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRAITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQEDKRAGETTRKGFYLYDERRKASPDPEVKKFIEKARSMSGVAIDPKFAKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLAERAGKGA*************
****SKPVKGEEAHSLGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLGEAREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKSLVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRAITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQEDKRAGETTRKGFYLYDERRKASPDPEVKKFIEKARSMSGVAIDPKFAKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLAERAGKGAT************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMLTSKPVKGEEAHSLGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLGEAREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKSLVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRAITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQEDKRAGETTRKGFYLYDERRKASPDPEVKKFIEKARSMSGVAIDPKFAKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLAERAGKGATLSAPVEEAKSKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query560 2.2.26 [Sep-21-2011]
Q9ZPI5725 Peroxisomal fatty acid be yes no 1.0 0.772 0.8 0.0
O49809725 Glyoxysomal fatty acid be N/A no 1.0 0.772 0.785 0.0
Q39659725 Glyoxysomal fatty acid be N/A no 1.0 0.772 0.789 0.0
Q9ZPI6721 Peroxisomal fatty acid be no no 0.998 0.775 0.566 0.0
Q8W1L6726 Peroxisomal fatty acid be no no 0.998 0.769 0.554 0.0
A8A2L0714 Fatty acid oxidation comp yes no 0.942 0.739 0.330 8e-76
Q0HKD1709 Fatty acid oxidation comp yes no 0.95 0.750 0.347 2e-75
Q0HWN3709 Fatty acid oxidation comp yes no 0.95 0.750 0.347 3e-75
Q48GW3721 Fatty acid oxidation comp yes no 0.935 0.726 0.318 3e-74
Q6NYL3718 Peroxisomal bifunctional yes no 0.964 0.752 0.323 4e-74
>sp|Q9ZPI5|MFP2_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 OS=Arabidopsis thaliana GN=MFP2 PE=1 SV=1 Back     alignment and function desciption
 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/560 (80%), Positives = 506/560 (90%)

Query: 1   MMLTSKPVKGEEAHSLGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLG 60
           M+LTSKPVK EE HSLGL+DAVV P +LV+TAR+WALDI+  R+PWV+++ KTDK+ PLG
Sbjct: 166 MILTSKPVKAEEGHSLGLIDAVVPPAELVTTARRWALDIVGRRKPWVSSVSKTDKLPPLG 225

Query: 61  EAREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKS 120
           EAREI  FA+AQ  K+APN+ HP++C+D +E G+VSGPRAGL+KEAE   ++++ +T K 
Sbjct: 226 EAREILTFAKAQTLKRAPNMKHPLMCLDAIEVGIVSGPRAGLEKEAEVASQVVKLDTTKG 285

Query: 121 LVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNE 180
           L+H+FF+QRGT+KVPGVTD GL PR++KKVAI+GGGLMGSGIATALILSNYPVILKEVNE
Sbjct: 286 LIHVFFSQRGTAKVPGVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNE 345

Query: 181 KFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSL 240
           KFLEAGIGRV+ANLQSRV+KG M+QEKFEKT+SLL G LDYESF+DVDMVIEA+IEN+SL
Sbjct: 346 KFLEAGIGRVKANLQSRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISL 405

Query: 241 KQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRT 300
           KQQIFADLEKYCP HCILASNTSTIDLN IGERT S+DRIVGAHFFSPAH+MPLLEIVRT
Sbjct: 406 KQQIFADLEKYCPQHCILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRT 465

Query: 301 NQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRA 360
           N TS QVIVDLLD+GKKIKKTP+VVGNCTGFAVNRMFFPYTQAA  LVE G D YLIDRA
Sbjct: 466 NHTSAQVIVDLLDVGKKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVECGADPYLIDRA 525

Query: 361 ITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQEDKRAGETTRKGF 420
           I+KFGMPMGPFRL DLVGFGVAIAT  QFIENF ERTYKSMIIP+MQEDKRAGE TRKGF
Sbjct: 526 ISKFGMPMGPFRLCDLVGFGVAIATATQFIENFSERTYKSMIIPLMQEDKRAGEATRKGF 585

Query: 421 YLYDERRKASPDPEVKKFIEKARSMSGVAIDPKFAKLSEKDIVEMIFFPVVNEACRVFAE 480
           YLYD++RKA PDPE+KK+IEKARS+SGV +DPK A LSEKDI+EM FFPVVNEACRVFAE
Sbjct: 586 YLYDDKRKAKPDPELKKYIEKARSISGVKLDPKLANLSEKDIIEMTFFPVVNEACRVFAE 645

Query: 481 GIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLA 540
           GIAVKAADLDIA +MGMGFPPYRGGIMFWADS+GSKYIYSRL+EWS  YGEFFKPCAFLA
Sbjct: 646 GIAVKAADLDIAGIMGMGFPPYRGGIMFWADSIGSKYIYSRLDEWSKAYGEFFKPCAFLA 705

Query: 541 ERAGKGATLSAPVEEAKSKL 560
           ER  KG  LSAPV++A S+L
Sbjct: 706 ERGSKGVLLSAPVKQASSRL 725
Involved in peroxisomal fatty acid beta-oxidation during seed germination. Possesses enoyl-CoA hydratase activity against long chain substrates (C14-C18) and 3-hydroxyacyl-CoA dehydrogenase activity against chains of variable sizes (C6-C18).
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 5
>sp|O49809|MFPA_BRANA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Brassica napus PE=2 SV=2 Back     alignment and function description
>sp|Q39659|MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPI6|AIM1_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 OS=Arabidopsis thaliana GN=AIM1 PE=1 SV=1 Back     alignment and function description
>sp|Q8W1L6|MFP_ORYSJ Peroxisomal fatty acid beta-oxidation multifunctional protein OS=Oryza sativa subsp. japonica GN=MFP PE=1 SV=2 Back     alignment and function description
>sp|A8A2L0|FADJ_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadJ PE=3 SV=1 Back     alignment and function description
>sp|Q0HKD1|FADJ_SHESM Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadJ PE=3 SV=1 Back     alignment and function description
>sp|Q0HWN3|FADJ_SHESR Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadJ PE=3 SV=1 Back     alignment and function description
>sp|Q48GW3|FADB_PSE14 Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=fadB PE=3 SV=1 Back     alignment and function description
>sp|Q6NYL3|ECHP_DANRE Peroxisomal bifunctional enzyme OS=Danio rerio GN=ehhadh PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query560
224107106 726 predicted protein [Populus trichocarpa] 1.0 0.771 0.857 0.0
225431755 724 PREDICTED: glyoxysomal fatty acid beta-o 1.0 0.773 0.862 0.0
296083347 765 unnamed protein product [Vitis vinifera] 1.0 0.732 0.862 0.0
224130412 726 predicted protein [Populus trichocarpa] 1.0 0.771 0.851 0.0
356521845 724 PREDICTED: glyoxysomal fatty acid beta-o 1.0 0.773 0.830 0.0
351723429 723 peroxisomal fatty acid beta-oxidation mu 1.0 0.774 0.826 0.0
357478819 724 Glyoxysomal fatty acid beta-oxidation mu 1.0 0.773 0.812 0.0
171854673 725 putative glyoxysomal fatty acid beta-oxi 1.0 0.772 0.812 0.0
356564184 722 PREDICTED: peroxisomal fatty acid beta-o 1.0 0.775 0.803 0.0
297829230 723 hypothetical protein ARALYDRAFT_478006 [ 1.0 0.774 0.8 0.0
>gi|224107106|ref|XP_002314377.1| predicted protein [Populus trichocarpa] gi|222863417|gb|EEF00548.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/560 (85%), Positives = 528/560 (94%)

Query: 1   MMLTSKPVKGEEAHSLGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLG 60
           MMLTSKPVKGEEAH+LGLVDAVV+PN+LVSTARQWALDILE RRPW+A+LYKT+K++ LG
Sbjct: 167 MMLTSKPVKGEEAHALGLVDAVVSPNELVSTARQWALDILERRRPWIASLYKTEKLDSLG 226

Query: 61  EAREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKS 120
           EAREIFKFAR Q RK+APNLTHPIVCIDV+E G+VSGPR GL KE E F +L+RS+TCKS
Sbjct: 227 EAREIFKFAREQVRKRAPNLTHPIVCIDVIEHGIVSGPRDGLYKELESFHELVRSDTCKS 286

Query: 121 LVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNE 180
           L+HIFFAQRGT+KVPG+TDLGL PRRVKKVA+LGGGLMGSGIATAL+LSNYPVILKEVN 
Sbjct: 287 LIHIFFAQRGTTKVPGITDLGLVPRRVKKVAVLGGGLMGSGIATALVLSNYPVILKEVNN 346

Query: 181 KFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSL 240
           +FL+AGIGRVRANLQSRVKKG+MTQEKFEKT+SLL G LDYESFKDVDMVIEA+IENVSL
Sbjct: 347 QFLQAGIGRVRANLQSRVKKGRMTQEKFEKTMSLLKGALDYESFKDVDMVIEAVIENVSL 406

Query: 241 KQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRT 300
           KQQIF+DLEKYCPPHCILASNTSTIDLNLIG++T S+DRI+GAHFFSPAHVMPLLEIVRT
Sbjct: 407 KQQIFSDLEKYCPPHCILASNTSTIDLNLIGKQTKSQDRIIGAHFFSPAHVMPLLEIVRT 466

Query: 301 NQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRA 360
            QTSPQVIVDLLD+GKKI+KTP+VVGNCTGFAVNRMFFPYTQAA LLVE G DLY ID+ 
Sbjct: 467 KQTSPQVIVDLLDVGKKIRKTPVVVGNCTGFAVNRMFFPYTQAALLLVEHGADLYQIDKV 526

Query: 361 ITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQEDKRAGETTRKGF 420
           ITKFGMPMGPFRL DLVGFGVAIATG QF+ NFPERTYKSM+IP+MQEDKRAGETTRKGF
Sbjct: 527 ITKFGMPMGPFRLVDLVGFGVAIATGTQFVVNFPERTYKSMLIPLMQEDKRAGETTRKGF 586

Query: 421 YLYDERRKASPDPEVKKFIEKARSMSGVAIDPKFAKLSEKDIVEMIFFPVVNEACRVFAE 480
           YLYD+RRKA PDPE++K+IEKAR++SGVA DPK AKL EKDIVEMIFFPVVNEACRVFAE
Sbjct: 587 YLYDDRRKAKPDPELRKYIEKARNISGVANDPKLAKLPEKDIVEMIFFPVVNEACRVFAE 646

Query: 481 GIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLA 540
           GIAVKAADLDI+S+MGMGFPPYRGGIMFWADSLGSKYIYSRLEEWS  YGEFFKPCAFLA
Sbjct: 647 GIAVKAADLDISSLMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSKTYGEFFKPCAFLA 706

Query: 541 ERAGKGATLSAPVEEAKSKL 560
           ERA KGA LS+PV++AKS+L
Sbjct: 707 ERAAKGAPLSSPVDQAKSRL 726

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225431755|ref|XP_002270067.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083347|emb|CBI22983.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130412|ref|XP_002328602.1| predicted protein [Populus trichocarpa] gi|222838584|gb|EEE76949.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356521845|ref|XP_003529561.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Glycine max] Back     alignment and taxonomy information
>gi|351723429|ref|NP_001234975.1| peroxisomal fatty acid beta-oxidation multifunctional protein [Glycine max] gi|167962162|dbj|BAG09370.1| peroxisomal fatty acid beta-oxidation multifunctional protein [Glycine max] Back     alignment and taxonomy information
>gi|357478819|ref|XP_003609695.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Medicago truncatula] gi|355510750|gb|AES91892.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Medicago truncatula] Back     alignment and taxonomy information
>gi|171854673|dbj|BAG16526.1| putative glyoxysomal fatty acid beta-oxidation multifunctional protein [Capsicum chinense] Back     alignment and taxonomy information
>gi|356564184|ref|XP_003550336.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional protein MFP2-like [Glycine max] Back     alignment and taxonomy information
>gi|297829230|ref|XP_002882497.1| hypothetical protein ARALYDRAFT_478006 [Arabidopsis lyrata subsp. lyrata] gi|297328337|gb|EFH58756.1| hypothetical protein ARALYDRAFT_478006 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query560
TAIR|locus:2077542725 MFP2 "multifunctional protein 1.0 0.772 0.8 8.4e-248
UNIPROTKB|O49809725 O49809 "Glyoxysomal fatty acid 1.0 0.772 0.785 6.1e-245
UNIPROTKB|Q39659725 Q39659 "Glyoxysomal fatty acid 1.0 0.772 0.789 1.7e-242
TAIR|locus:2119891721 AIM1 "ABNORMAL INFLORESCENCE M 0.998 0.775 0.566 6.9e-173
UNIPROTKB|Q8W1L6726 MFP "Peroxisomal fatty acid be 0.998 0.769 0.554 2.7e-171
TIGR_CMR|SPO_0772698 SPO_0772 "enoyl-CoA hydratase/ 0.964 0.773 0.353 1.5e-81
UNIPROTKB|Q48GW3721 fadB "Fatty acid oxidation com 0.951 0.739 0.319 2.7e-77
TIGR_CMR|SO_3088707 SO_3088 "fatty oxidation compl 0.948 0.751 0.344 3.9e-76
TIGR_CMR|SO_0021716 SO_0021 "fatty oxidation compl 0.955 0.747 0.333 2.5e-74
UNIPROTKB|Q47ZB7787 fadJ "Fatty oxidation complex, 0.969 0.689 0.327 1.1e-73
TAIR|locus:2077542 MFP2 "multifunctional protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2387 (845.3 bits), Expect = 8.4e-248, P = 8.4e-248
 Identities = 448/560 (80%), Positives = 506/560 (90%)

Query:     1 MMLTSKPVKGEEAHSLGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLG 60
             M+LTSKPVK EE HSLGL+DAVV P +LV+TAR+WALDI+  R+PWV+++ KTDK+ PLG
Sbjct:   166 MILTSKPVKAEEGHSLGLIDAVVPPAELVTTARRWALDIVGRRKPWVSSVSKTDKLPPLG 225

Query:    61 EAREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKS 120
             EAREI  FA+AQ  K+APN+ HP++C+D +E G+VSGPRAGL+KEAE   ++++ +T K 
Sbjct:   226 EAREILTFAKAQTLKRAPNMKHPLMCLDAIEVGIVSGPRAGLEKEAEVASQVVKLDTTKG 285

Query:   121 LVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNE 180
             L+H+FF+QRGT+KVPGVTD GL PR++KKVAI+GGGLMGSGIATALILSNYPVILKEVNE
Sbjct:   286 LIHVFFSQRGTAKVPGVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNE 345

Query:   181 KFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSL 240
             KFLEAGIGRV+ANLQSRV+KG M+QEKFEKT+SLL G LDYESF+DVDMVIEA+IEN+SL
Sbjct:   346 KFLEAGIGRVKANLQSRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISL 405

Query:   241 KQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRT 300
             KQQIFADLEKYCP HCILASNTSTIDLN IGERT S+DRIVGAHFFSPAH+MPLLEIVRT
Sbjct:   406 KQQIFADLEKYCPQHCILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRT 465

Query:   301 NQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRA 360
             N TS QVIVDLLD+GKKIKKTP+VVGNCTGFAVNRMFFPYTQAA  LVE G D YLIDRA
Sbjct:   466 NHTSAQVIVDLLDVGKKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVECGADPYLIDRA 525

Query:   361 ITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQEDKRAGETTRKGF 420
             I+KFGMPMGPFRL DLVGFGVAIAT  QFIENF ERTYKSMIIP+MQEDKRAGE TRKGF
Sbjct:   526 ISKFGMPMGPFRLCDLVGFGVAIATATQFIENFSERTYKSMIIPLMQEDKRAGEATRKGF 585

Query:   421 YLYDERRKASPDPEVKKFIEKARSMSGVAIDPKFAKLSEKDIVEMIFFPVVNEACRVFAE 480
             YLYD++RKA PDPE+KK+IEKARS+SGV +DPK A LSEKDI+EM FFPVVNEACRVFAE
Sbjct:   586 YLYDDKRKAKPDPELKKYIEKARSISGVKLDPKLANLSEKDIIEMTFFPVVNEACRVFAE 645

Query:   481 GIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLA 540
             GIAVKAADLDIA +MGMGFPPYRGGIMFWADS+GSKYIYSRL+EWS  YGEFFKPCAFLA
Sbjct:   646 GIAVKAADLDIAGIMGMGFPPYRGGIMFWADSIGSKYIYSRLDEWSKAYGEFFKPCAFLA 705

Query:   541 ERAGKGATLSAPVEEAKSKL 560
             ER  KG  LSAPV++A S+L
Sbjct:   706 ERGSKGVLLSAPVKQASSRL 725
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0003857 "3-hydroxyacyl-CoA dehydrogenase activity" evidence=IEA;IDA;IMP
GO:0005737 "cytoplasm" evidence=ISM
GO:0006631 "fatty acid metabolic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004300 "enoyl-CoA hydratase activity" evidence=IMP
GO:0005777 "peroxisome" evidence=IDA;TAS
GO:0006635 "fatty acid beta-oxidation" evidence=IEP;RCA
GO:0005730 "nucleolus" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0016508 "long-chain-enoyl-CoA hydratase activity" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0009506 "plasmodesma" evidence=IDA
GO:0007031 "peroxisome organization" evidence=RCA
GO:0009062 "fatty acid catabolic process" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
UNIPROTKB|O49809 O49809 "Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a" [Brassica napus (taxid:3708)] Back     alignment and assigned GO terms
UNIPROTKB|Q39659 Q39659 "Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a" [Cucumis sativus (taxid:3659)] Back     alignment and assigned GO terms
TAIR|locus:2119891 AIM1 "ABNORMAL INFLORESCENCE MERISTEM" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8W1L6 MFP "Peroxisomal fatty acid beta-oxidation multifunctional protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0772 SPO_0772 "enoyl-CoA hydratase/isomerase/3-hydroxyacyl-CoA dehydrogenase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q48GW3 fadB "Fatty acid oxidation complex subunit alpha" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3088 SO_3088 "fatty oxidation complex, alpha subunit" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0021 SO_0021 "fatty oxidation complex, alpha subunit" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q47ZB7 fadJ "Fatty oxidation complex, alpha subunit" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O49809MFPA_BRANA1, ., 1, ., 1, ., 3, 50.78571.00.7724N/Ano
Q39659MFPA_CUCSA1, ., 1, ., 1, ., 3, 50.78921.00.7724N/Ano
Q9ZPI5MFP2_ARATH1, ., 1, ., 1, ., 3, 50.81.00.7724yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.976
3rd Layer5.1.2.30.991
3rd Layer1.1.1.350.991
3rd Layer5.1.20.976
3rd Layer5.3.3.80.991
3rd Layer4.2.10.976
4th Layer4.2.1.170.991
3rd Layer5.3.30.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_X3923
hypothetical protein (726 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pm.C_290034
acyl-CoA oxidase (EC-1.3.3.6) (664 aa)
     •• 0.908
estExt_Genewise1_v1.C_LG_XVI3692
acyl-CoA oxidase (EC-1.3.3.6) (437 aa)
     •• 0.908
estExt_Genewise1_v1.C_LG_VI1706
acyl-CoA oxidase (EC-1.3.3.6) (436 aa)
     •• 0.907
grail3.0096010101
acyl-CoA oxidase (EC-1.3.3.6) (639 aa)
     •• 0.906
fgenesh4_pg.C_LG_XIX000851
acyl-CoA oxidase (EC-1.3.3.6) (680 aa)
     •• 0.903
estExt_fgenesh4_pm.C_LG_VII0199
acyl-CoA oxidase (EC-1.3.3.6) (689 aa)
     •• 0.903
estExt_fgenesh4_pm.C_LG_V0077
acyl-CoA oxidase (EC-1.3.3.6) (691 aa)
     •• 0.902
fgenesh4_pg.C_scaffold_3547000001
annotation not avaliable (326 aa)
     •  0.899
eugene3.07970004
Predicted protein (395 aa)
•    •• 0.499
fgenesh4_pg.C_scaffold_17829000001
Predicted protein (327 aa)
•    •• 0.492

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
PRK11154708 PRK11154, fadJ, multifunctional fatty acid oxidati 1e-125
PRK11730715 PRK11730, fadB, multifunctional fatty acid oxidati 1e-117
TIGR02437714 TIGR02437, FadB, fatty oxidation complex, alpha su 1e-102
TIGR02440699 TIGR02440, FadJ, fatty oxidation complex, alpha su 1e-102
TIGR02441737 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c 8e-94
COG1250307 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Li 3e-92
pfam02737180 pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenas 6e-74
PRK05808282 PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydroge 2e-69
PLN02545295 PLN02545, PLN02545, 3-hydroxybutyryl-CoA dehydroge 8e-61
PRK07819286 PRK07819, PRK07819, 3-hydroxybutyryl-CoA dehydroge 5e-54
PRK06035291 PRK06035, PRK06035, 3-hydroxyacyl-CoA dehydrogenas 3e-51
PRK08268507 PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogena 3e-51
TIGR02279503 TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehy 6e-50
PRK09260288 PRK09260, PRK09260, 3-hydroxybutyryl-CoA dehydroge 1e-46
PRK07530292 PRK07530, PRK07530, 3-hydroxybutyryl-CoA dehydroge 1e-46
PRK06130311 PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydroge 6e-42
PRK08293287 PRK08293, PRK08293, 3-hydroxybutyryl-CoA dehydroge 1e-36
PRK08269314 PRK08269, PRK08269, 3-hydroxybutyryl-CoA dehydroge 6e-22
PRK06129308 PRK06129, PRK06129, 3-hydroxyacyl-CoA dehydrogenas 2e-20
pfam0072597 pfam00725, 3HCDH, 3-hydroxyacyl-CoA dehydrogenase, 2e-20
PRK07531495 PRK07531, PRK07531, bifunctional 3-hydroxyacyl-CoA 2e-13
PRK07066321 PRK07066, PRK07066, 3-hydroxybutyryl-CoA dehydroge 1e-07
cd06558195 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme 2e-07
PRK08268507 PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogena 1e-06
PRK06494259 PRK06494, PRK06494, enoyl-CoA hydratase; Provision 5e-05
TIGR02279503 TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehy 1e-04
COG1024257 COG1024, CaiD, Enoyl-CoA hydratase/carnithine race 4e-04
PRK07658257 PRK07658, PRK07658, enoyl-CoA hydratase; Provision 5e-04
pfam00378245 pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami 9e-04
pfam0072597 pfam00725, 3HCDH, 3-hydroxyacyl-CoA dehydrogenase, 0.001
PRK06688259 PRK06688, PRK06688, enoyl-CoA hydratase; Provision 0.001
PRK08259254 PRK08259, PRK08259, enoyl-CoA hydratase; Provision 0.002
PLN02888265 PLN02888, PLN02888, enoyl-CoA hydratase 0.002
>gnl|CDD|236864 PRK11154, fadJ, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information 
 Score =  382 bits (983), Expect = e-125
 Identities = 201/574 (35%), Positives = 294/574 (51%), Gaps = 62/574 (10%)

Query: 1   MMLTSKPVKGEEAHSLGLVDAVVAPNQLVSTARQWAL-DILEHRR-PWVATLYKTDKIEP 58
           M+LT K ++ ++A  LGLVD VV  + L+  A + A       R  P    L + +   P
Sbjct: 167 MILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAKKGKPARRPLPVRERLLEGN---P 223

Query: 59  LGEAREIFKFARAQARKQAP-NLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSET 117
           LG A  +FK AR +   +   N   P   +DVV  G+  G  +G + EA  F +L  +  
Sbjct: 224 LGRAL-LFKQARKKTLAKTQGNYPAPERILDVVRTGLEKGMSSGYEAEARAFGELAMTPE 282

Query: 118 CKSLVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIA--TALILSNYPVIL 175
             +L  IFFA     K  G       PR V KV +LGGGLMG GIA  TA   +  PV +
Sbjct: 283 SAALRSIFFATTEMKKDTGS---DAKPRPVNKVGVLGGGLMGGGIAYVTA-TKAGLPVRI 338

Query: 176 KEVNEKFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAII 235
           K++N + +   +      L  +VK+  +   + +K ++L++G  DY  FK  D+VIEA+ 
Sbjct: 339 KDINPQGINHALKYSWDLLDKKVKRRHLKPSERDKQMALISGTTDYRGFKHADVVIEAVF 398

Query: 236 ENVSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLL 295
           E+++LKQQ+ A++E+ C PH I ASNTS++ +  I       ++++G H+FSP   MPL+
Sbjct: 399 EDLALKQQMVAEVEQNCAPHTIFASNTSSLPIGQIAAAAARPEQVIGLHYFSPVEKMPLV 458

Query: 296 EIVRTNQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPY-TQAAFLLVERGTDL 354
           E++   +TS + I   + + KK  KTPIVV +  GF VNR+  PY  +AA LL+E G  +
Sbjct: 459 EVIPHAKTSAETIATTVALAKKQGKTPIVVRDGAGFYVNRILAPYINEAARLLLE-GEPI 517

Query: 355 YLIDRAITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQE------ 408
             ID A+ KFG P+GP  L D VG  V                  + IIPI++       
Sbjct: 518 EHIDAALVKFGFPVGPITLLDEVGIDVG-----------------TKIIPILEAALGERF 560

Query: 409 -----------DKRAGETTRKGFYLYDERRKAS---PDPEVKKFIEKARSMSGVAIDPKF 454
                      D R G    +GFYLY ++ K S    D  V   +          I P+ 
Sbjct: 561 SAPAAFDKLLNDDRKGRKNGRGFYLYGQKGKKSKKQVDESVYPLL---------GITPQ- 610

Query: 455 AKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLG 514
           ++LS  +I E     ++NEA R   EGI   A D DI +V G+GFPP+ GG   + DSLG
Sbjct: 611 SRLSANEIAERCVMLMLNEAVRCLDEGIIRSARDGDIGAVFGIGFPPFLGGPFRYMDSLG 670

Query: 515 SKYIYSRLEEWSSLYGEFFKPCAFLAERAGKGAT 548
           +  + + LE  ++ YG+ F PC  L E A +G +
Sbjct: 671 AGEVVAILERLAAQYGDRFTPCERLVEMAERGES 704

Length = 708
>gnl|CDD|183293 PRK11730, fadB, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>gnl|CDD|131493 TIGR02440, FadJ, fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>gnl|CDD|224170 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|202367 pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|180269 PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215300 PLN02545, PLN02545, 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|181133 PRK07819, PRK07819, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180361 PRK06035, PRK06035, 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236211 PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|188207 TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>gnl|CDD|236434 PRK09260, PRK09260, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181018 PRK07530, PRK07530, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235707 PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181359 PRK08293, PRK08293, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181340 PRK08269, PRK08269, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235706 PRK06129, PRK06129, 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|216084 pfam00725, 3HCDH, 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|236044 PRK07531, PRK07531, bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>gnl|CDD|168796 PRK07066, PRK07066, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>gnl|CDD|236211 PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|188207 TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>gnl|CDD|216084 pfam00725, 3HCDH, 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236205 PRK08259, PRK08259, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|215480 PLN02888, PLN02888, enoyl-CoA hydratase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 560
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 100.0
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 100.0
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 100.0
PRK11730715 fadB multifunctional fatty acid oxidation complex 100.0
PRK11154708 fadJ multifunctional fatty acid oxidation complex 100.0
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 100.0
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 100.0
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 100.0
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 100.0
KOG1683380 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA 100.0
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 100.0
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 100.0
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 100.0
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 100.0
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 100.0
KOG2305313 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 100.0
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.96
PF0072597 3HCDH: 3-hydroxyacyl-CoA dehydrogenase, C-terminal 99.92
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.89
PF0072597 3HCDH: 3-hydroxyacyl-CoA dehydrogenase, C-terminal 99.8
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.74
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 99.74
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.71
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.7
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.68
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 99.68
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.68
PRK07417279 arogenate dehydrogenase; Reviewed 99.66
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.66
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.63
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 99.61
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.6
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.6
KOG0409327 consensus Predicted dehydrogenase [General functio 99.59
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.57
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.56
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.52
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.52
PLN02688266 pyrroline-5-carboxylate reductase 99.5
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 99.48
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 99.47
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 99.47
PRK15059292 tartronate semialdehyde reductase; Provisional 99.47
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 99.46
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.46
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 99.44
PRK08507275 prephenate dehydrogenase; Validated 99.43
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 99.42
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.42
PRK06545359 prephenate dehydrogenase; Validated 99.4
PRK11730 715 fadB multifunctional fatty acid oxidation complex 99.38
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 99.38
PRK08655437 prephenate dehydrogenase; Provisional 99.37
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 99.36
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.36
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.35
PLN02858 1378 fructose-bisphosphate aldolase 99.35
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.35
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.35
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.35
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.35
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 99.34
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.33
PRK12478298 enoyl-CoA hydratase; Provisional 99.31
PLN02600251 enoyl-CoA hydratase 99.31
PRK08150255 enoyl-CoA hydratase; Provisional 99.31
PRK05862257 enoyl-CoA hydratase; Provisional 99.31
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 99.31
PLN02858 1378 fructose-bisphosphate aldolase 99.3
PLN02888265 enoyl-CoA hydratase 99.3
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.3
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 99.29
PRK07658257 enoyl-CoA hydratase; Provisional 99.29
PRK05980260 enoyl-CoA hydratase; Provisional 99.28
PRK08138261 enoyl-CoA hydratase; Provisional 99.28
PRK08258277 enoyl-CoA hydratase; Provisional 99.28
KOG1680290 consensus Enoyl-CoA hydratase [Lipid transport and 99.28
PRK08139266 enoyl-CoA hydratase; Validated 99.28
PRK07938249 enoyl-CoA hydratase; Provisional 99.27
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.27
PRK07799263 enoyl-CoA hydratase; Provisional 99.26
PRK08140262 enoyl-CoA hydratase; Provisional 99.26
PRK09076258 enoyl-CoA hydratase; Provisional 99.26
PRK06495257 enoyl-CoA hydratase; Provisional 99.26
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 99.25
PRK06127269 enoyl-CoA hydratase; Provisional 99.25
PLN02256304 arogenate dehydrogenase 99.25
PRK08252254 enoyl-CoA hydratase; Provisional 99.25
PRK06143256 enoyl-CoA hydratase; Provisional 99.24
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 99.24
PRK06563255 enoyl-CoA hydratase; Provisional 99.24
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.24
PRK05981266 enoyl-CoA hydratase; Provisional 99.23
PRK07468262 enoyl-CoA hydratase; Provisional 99.23
PRK07657260 enoyl-CoA hydratase; Provisional 99.23
PRK09245266 enoyl-CoA hydratase; Provisional 99.23
PRK05995262 enoyl-CoA hydratase; Provisional 99.22
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 99.22
PRK06494259 enoyl-CoA hydratase; Provisional 99.22
PRK06142272 enoyl-CoA hydratase; Provisional 99.22
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 99.21
PRK07511260 enoyl-CoA hydratase; Provisional 99.2
PRK06210272 enoyl-CoA hydratase; Provisional 99.2
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 99.19
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.19
PRK03580261 carnitinyl-CoA dehydratase; Provisional 99.19
PRK06688259 enoyl-CoA hydratase; Provisional 99.19
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 99.18
PTZ00082321 L-lactate dehydrogenase; Provisional 99.18
PRK08259254 enoyl-CoA hydratase; Provisional 99.17
PRK07659260 enoyl-CoA hydratase; Provisional 99.17
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 99.16
PRK08818370 prephenate dehydrogenase; Provisional 99.16
PRK07260255 enoyl-CoA hydratase; Provisional 99.15
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 99.15
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 99.15
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 99.14
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 99.14
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 99.14
PRK05864276 enoyl-CoA hydratase; Provisional 99.13
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 99.13
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.12
PRK05479330 ketol-acid reductoisomerase; Provisional 99.11
PLN02921327 naphthoate synthase 99.11
PRK07680273 late competence protein ComER; Validated 99.1
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 99.09
PRK08321302 naphthoate synthase; Validated 99.08
PTZ00117319 malate dehydrogenase; Provisional 99.07
PRK06144262 enoyl-CoA hydratase; Provisional 99.07
PRK06223307 malate dehydrogenase; Reviewed 99.06
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.05
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.05
PRK06023251 enoyl-CoA hydratase; Provisional 99.04
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.03
PRK08260296 enoyl-CoA hydratase; Provisional 99.03
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.03
PRK07509262 enoyl-CoA hydratase; Provisional 99.02
PRK06072248 enoyl-CoA hydratase; Provisional 99.02
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.02
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 99.01
PRK05870249 enoyl-CoA hydratase; Provisional 99.01
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 99.01
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.01
PRK07327268 enoyl-CoA hydratase; Provisional 98.99
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 98.98
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.97
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 98.97
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.97
PRK05617342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 98.96
PRK07827260 enoyl-CoA hydratase; Provisional 98.96
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 98.96
PLN02712667 arogenate dehydrogenase 98.96
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 98.96
PRK07854243 enoyl-CoA hydratase; Provisional 98.95
PRK08229341 2-dehydropantoate 2-reductase; Provisional 98.94
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.94
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 98.89
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.89
PRK09287459 6-phosphogluconate dehydrogenase; Validated 98.88
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 98.85
PLN02874379 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.84
PTZ00431260 pyrroline carboxylate reductase; Provisional 98.83
PLN02353473 probable UDP-glucose 6-dehydrogenase 98.83
PRK06190258 enoyl-CoA hydratase; Provisional 98.83
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 98.82
COG2085211 Predicted dinucleotide-binding enzymes [General fu 98.82
PLN02712 667 arogenate dehydrogenase 98.81
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 98.8
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 98.77
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.74
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 98.7
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 98.7
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 98.69
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 98.67
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 98.66
KOG1679291 consensus Enoyl-CoA hydratase [Lipid transport and 98.64
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 98.61
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.59
KOG1682287 consensus Enoyl-CoA isomerase [Lipid transport and 98.56
PRK08290288 enoyl-CoA hydratase; Provisional 98.5
PRK06444197 prephenate dehydrogenase; Provisional 98.45
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 98.43
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 98.43
PRK06213229 enoyl-CoA hydratase; Provisional 98.43
PRK06249313 2-dehydropantoate 2-reductase; Provisional 98.42
PRK08788287 enoyl-CoA hydratase; Validated 98.41
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 98.4
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.4
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 98.38
PRK12480330 D-lactate dehydrogenase; Provisional 98.37
PLN02157401 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.34
PRK12921305 2-dehydropantoate 2-reductase; Provisional 98.32
PRK08272302 enoyl-CoA hydratase; Provisional 98.32
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 98.32
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 98.31
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 98.28
PRK13243333 glyoxylate reductase; Reviewed 98.24
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 98.2
PRK15076431 alpha-galactosidase; Provisional 98.18
PRK13403335 ketol-acid reductoisomerase; Provisional 98.15
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 98.14
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 98.14
KOG1683380 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA 98.11
PRK07574385 formate dehydrogenase; Provisional 98.1
PLN03139386 formate dehydrogenase; Provisional 98.09
KOG1681292 consensus Enoyl-CoA isomerase [Lipid transport and 98.06
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 98.06
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.05
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.05
PRK06436303 glycerate dehydrogenase; Provisional 98.04
PRK05869222 enoyl-CoA hydratase; Validated 98.02
PLN02602350 lactate dehydrogenase 98.02
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 97.99
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.99
PRK08605332 D-lactate dehydrogenase; Validated 97.91
PLN02928347 oxidoreductase family protein 97.9
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 97.9
PLN02988381 3-hydroxyisobutyryl-CoA hydrolase 97.9
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 97.89
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 97.89
KOG0016266 consensus Enoyl-CoA hydratase/isomerase [Lipid tra 97.87
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.87
PRK05225487 ketol-acid reductoisomerase; Validated 97.87
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 97.86
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.84
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 97.84
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 97.83
PRK05708305 2-dehydropantoate 2-reductase; Provisional 97.8
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 97.8
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 97.79
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 97.79
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.75
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 97.69
PRK05442326 malate dehydrogenase; Provisional 97.66
PLN00112444 malate dehydrogenase (NADP); Provisional 97.63
PLN02267239 enoyl-CoA hydratase/isomerase family protein 97.62
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.61
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 97.59
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.57
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 97.57
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 97.57
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 97.55
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 97.52
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.52
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 97.51
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 97.5
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 97.48
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 97.46
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.45
PLN02851407 3-hydroxyisobutyryl-CoA hydrolase-like protein 97.45
PRK06487317 glycerate dehydrogenase; Provisional 97.44
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 97.42
PRK06932314 glycerate dehydrogenase; Provisional 97.41
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.4
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.39
KOG2380480 consensus Prephenate dehydrogenase (NADP+) [Amino 97.39
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 97.37
PLN00106323 malate dehydrogenase 97.34
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.32
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.32
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.3
PRK06141314 ornithine cyclodeaminase; Validated 97.29
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 97.28
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 97.27
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.27
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 97.27
PLN02306386 hydroxypyruvate reductase 97.26
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 97.26
PTZ00325321 malate dehydrogenase; Provisional 97.24
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.23
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 97.23
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.22
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 97.22
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 97.21
KOG2653487 consensus 6-phosphogluconate dehydrogenase [Carboh 97.19
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.12
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 97.12
TIGR03200360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 97.12
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.09
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.08
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 97.05
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.03
PLN02494477 adenosylhomocysteinase 97.03
PTZ00075476 Adenosylhomocysteinase; Provisional 96.99
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 96.98
PRK04148134 hypothetical protein; Provisional 96.96
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.95
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.94
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 96.92
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.89
KOG3124267 consensus Pyrroline-5-carboxylate reductase [Amino 96.89
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 96.88
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.87
KOG2666481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 96.78
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 96.77
PRK05086312 malate dehydrogenase; Provisional 96.76
PRK09186256 flagellin modification protein A; Provisional 96.7
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.7
COG2910211 Putative NADH-flavin reductase [General function p 96.69
COG4091438 Predicted homoserine dehydrogenase [Amino acid tra 96.65
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.64
KOG1495332 consensus Lactate dehydrogenase [Energy production 96.64
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.63
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.62
PRK07340304 ornithine cyclodeaminase; Validated 96.6
COG0300265 DltE Short-chain dehydrogenases of various substra 96.59
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.57
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.57
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.57
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.57
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.56
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.56
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.53
PRK13301267 putative L-aspartate dehydrogenase; Provisional 96.51
PRK08339263 short chain dehydrogenase; Provisional 96.45
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.45
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.44
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.44
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.43
PRK08618325 ornithine cyclodeaminase; Validated 96.42
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 96.39
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.33
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.32
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 96.31
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.3
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 96.29
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.28
PLN00203519 glutamyl-tRNA reductase 96.23
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.23
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 96.18
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 96.16
PRK06153393 hypothetical protein; Provisional 96.15
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 96.13
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.1
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.09
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 96.07
PRK12828239 short chain dehydrogenase; Provisional 96.07
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 96.04
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 96.02
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.98
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 95.98
PRK06194287 hypothetical protein; Provisional 95.98
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 95.97
KOG2018430 consensus Predicted dinucleotide-utilizing enzyme 95.95
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 95.94
PRK13940414 glutamyl-tRNA reductase; Provisional 95.93
PRK08340259 glucose-1-dehydrogenase; Provisional 95.93
PRK12829264 short chain dehydrogenase; Provisional 95.91
PRK14027283 quinate/shikimate dehydrogenase; Provisional 95.91
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.91
PRK08291330 ectoine utilization protein EutC; Validated 95.91
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.88
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.87
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 95.84
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 95.82
PRK13303265 L-aspartate dehydrogenase; Provisional 95.79
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.77
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 95.76
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 95.75
PRK06196315 oxidoreductase; Provisional 95.75
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.74
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 95.74
PRK07326237 short chain dehydrogenase; Provisional 95.73
PRK00048257 dihydrodipicolinate reductase; Provisional 95.7
PRK05866293 short chain dehydrogenase; Provisional 95.69
cd01483143 E1_enzyme_family Superfamily of activating enzymes 95.65
PRK07831262 short chain dehydrogenase; Provisional 95.65
PRK07062265 short chain dehydrogenase; Provisional 95.64
PRK06823315 ornithine cyclodeaminase; Validated 95.62
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 95.61
PRK07825273 short chain dehydrogenase; Provisional 95.61
PRK07890258 short chain dehydrogenase; Provisional 95.56
PRK07774250 short chain dehydrogenase; Provisional 95.53
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 95.53
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 95.53
PRK07454241 short chain dehydrogenase; Provisional 95.52
PRK07832272 short chain dehydrogenase; Provisional 95.52
PRK08267260 short chain dehydrogenase; Provisional 95.48
PRK09496453 trkA potassium transporter peripheral membrane com 95.47
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 95.47
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 95.44
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.44
PRK06057255 short chain dehydrogenase; Provisional 95.44
PRK06407301 ornithine cyclodeaminase; Provisional 95.42
PRK07063260 short chain dehydrogenase; Provisional 95.42
PRK06046326 alanine dehydrogenase; Validated 95.41
PRK10669558 putative cation:proton antiport protein; Provision 95.4
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.39
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 95.39
PRK06719157 precorrin-2 dehydrogenase; Validated 95.37
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.37
PRK05562223 precorrin-2 dehydrogenase; Provisional 95.36
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 95.36
PRK08643256 acetoin reductase; Validated 95.36
PRK07523255 gluconate 5-dehydrogenase; Provisional 95.35
PRK08300302 acetaldehyde dehydrogenase; Validated 95.35
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 95.34
PRK06139330 short chain dehydrogenase; Provisional 95.34
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 95.33
PRK07478254 short chain dehydrogenase; Provisional 95.32
PRK05650270 short chain dehydrogenase; Provisional 95.31
PRK10538248 malonic semialdehyde reductase; Provisional 95.31
PRK07024257 short chain dehydrogenase; Provisional 95.28
PRK05854313 short chain dehydrogenase; Provisional 95.26
PRK05867253 short chain dehydrogenase; Provisional 95.26
PRK08265261 short chain dehydrogenase; Provisional 95.26
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.25
PRK12550272 shikimate 5-dehydrogenase; Reviewed 95.24
PRK09496453 trkA potassium transporter peripheral membrane com 95.24
PLN03209576 translocon at the inner envelope of chloroplast su 95.24
PRK03659601 glutathione-regulated potassium-efflux system prot 95.24
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 95.23
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.22
PRK09242257 tropinone reductase; Provisional 95.17
PRK07067257 sorbitol dehydrogenase; Provisional 95.17
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.16
PRK07877 722 hypothetical protein; Provisional 95.14
PRK07814263 short chain dehydrogenase; Provisional 95.09
PRK08277278 D-mannonate oxidoreductase; Provisional 95.08
PRK12939250 short chain dehydrogenase; Provisional 95.07
PRK07677252 short chain dehydrogenase; Provisional 95.07
PRK06197306 short chain dehydrogenase; Provisional 95.07
PRK07109334 short chain dehydrogenase; Provisional 95.05
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 95.05
PRK08251248 short chain dehydrogenase; Provisional 95.05
PRK06940275 short chain dehydrogenase; Provisional 95.04
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.03
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 94.99
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 94.98
PRK05876275 short chain dehydrogenase; Provisional 94.97
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 94.96
PRK06199379 ornithine cyclodeaminase; Validated 94.95
PRK05872296 short chain dehydrogenase; Provisional 94.94
PRK08862227 short chain dehydrogenase; Provisional 94.93
PRK07074257 short chain dehydrogenase; Provisional 94.92
PRK07576264 short chain dehydrogenase; Provisional 94.9
PRK08085254 gluconate 5-dehydrogenase; Provisional 94.89
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 94.86
CHL00194317 ycf39 Ycf39; Provisional 94.86
PRK07589346 ornithine cyclodeaminase; Validated 94.86
PRK03562621 glutathione-regulated potassium-efflux system prot 94.85
PRK06172253 short chain dehydrogenase; Provisional 94.83
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 94.83
PRK05600370 thiamine biosynthesis protein ThiF; Validated 94.82
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.8
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 94.79
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 94.79
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 94.77
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.77
PRK06138252 short chain dehydrogenase; Provisional 94.75
KOG0725270 consensus Reductases with broad range of substrate 94.73
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 94.73
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.72
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.72
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 94.71
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 94.69
PRK08223287 hypothetical protein; Validated 94.68
PRK06500249 short chain dehydrogenase; Provisional 94.67
PRK06124256 gluconate 5-dehydrogenase; Provisional 94.67
PLN02253280 xanthoxin dehydrogenase 94.67
PRK15116268 sulfur acceptor protein CsdL; Provisional 94.67
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 94.65
PRK07035252 short chain dehydrogenase; Provisional 94.63
PRK07097265 gluconate 5-dehydrogenase; Provisional 94.6
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 94.59
PRK08213259 gluconate 5-dehydrogenase; Provisional 94.58
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 94.58
PRK05693274 short chain dehydrogenase; Provisional 94.58
PRK08589272 short chain dehydrogenase; Validated 94.56
PRK05875276 short chain dehydrogenase; Provisional 94.52
PRK06270341 homoserine dehydrogenase; Provisional 94.51
COG0623259 FabI Enoyl-[acyl-carrier-protein] 94.5
PRK05599246 hypothetical protein; Provisional 94.49
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 94.49
PRK07069251 short chain dehydrogenase; Validated 94.48
PRK06720169 hypothetical protein; Provisional 94.47
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.46
PRK06182273 short chain dehydrogenase; Validated 94.44
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.43
PRK06949258 short chain dehydrogenase; Provisional 94.43
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 94.42
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 94.42
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 94.39
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.37
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 94.37
TIGR00036266 dapB dihydrodipicolinate reductase. 94.35
PRK05717255 oxidoreductase; Validated 94.35
TIGR02415254 23BDH acetoin reductases. One member of this famil 94.34
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 94.29
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 94.28
PRK06180277 short chain dehydrogenase; Provisional 94.26
PRK05855582 short chain dehydrogenase; Validated 94.24
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information 
Probab=100.00  E-value=6.5e-106  Score=897.41  Aligned_cols=540  Identities=31%  Similarity=0.504  Sum_probs=487.7

Q ss_pred             CcccCCCCChHHHHhCCCcceecCC-------------cchHHHHHHHHHhhhccCCCchhhhcccCCCCC-----chhH
Q 008604            1 MMLTSKPVKGEEAHSLGLVDAVVAP-------------NQLVSTARQWALDILEHRRPWVATLYKTDKIEP-----LGEA   62 (560)
Q Consensus         1 mlltG~~i~A~eA~~~GLVd~vv~~-------------~~l~~~A~~~a~~la~~~~p~~~~~~~~~~~~~-----~~~~   62 (560)
                      |+|||++++|++|+++||||+|||+             +++.+.|.+++++++..+.+..+......++.+     ....
T Consensus       174 l~ltG~~i~a~eA~~~GLVd~vv~~~~~~~~~l~~~~~~~l~~~A~~~a~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  253 (737)
T TIGR02441       174 MMLTGKKIRADRAKKMGIVDQLVDPLGPGLKPAEENTIEYLEEVAVKFAQGLANGKLSINRDKGLVHKITQYVMTNPFVR  253 (737)
T ss_pred             HHHcCCcCCHHHHHHCCCCeEecCCcccccccchhhhHHHHHHHHHHHHHHhhcccCCccccccccCccchhhcccchhH
Confidence            5899999999999999999999987             458888999998876643222111111111111     0123


Q ss_pred             HHHHHHHHHHHHHhCCC-CCcHHHHHHHHHHhhhCChHHHHHHHHHHHhHHhcCHHHHHHHHHHHhccCCCCCCCCCCCC
Q 008604           63 REIFKFARAQARKQAPN-LTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKSLVHIFFAQRGTSKVPGVTDLG  141 (560)
Q Consensus        63 ~~~~~~~~~~~~~~~~~-~~A~~~~~~~i~~~~~~~~~~~l~~E~~~f~~l~~s~~~~~~~~aF~~kr~~~~~~~~~~~~  141 (560)
                      ...+..+++++.++.++ ||||.+++++|+.+...+++++++.|++.|.+|+.|++++++++.|+.++.+++.+..    
T Consensus       254 ~~~~~~~~~~~~~~~~g~~~Ap~~~l~~v~~~~~~~~~~gl~~E~~~f~~l~~s~~a~al~~~f~~~~~~~~~~~~----  329 (737)
T TIGR02441       254 QQVYKTAEDKVMKQTKGLYPAPLKILDVVRTGYDQGPDAGYEAESKAFGELSMTFESKALIGLFHGQTDCKKNKFG----  329 (737)
T ss_pred             HHHHHHHHHHHHHhccCCCccHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHccCCCCC----
Confidence            45777888888888776 9999999999999999999999999999999999999999999999999999886431    


Q ss_pred             CCcccceEEEEEcCccchHHHHHHHHhCCCcEEEEeCCHHHHHHHHHHHHHHHHHHHHcCCCCHHHHHhhhcccccccCc
Q 008604          142 LAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDY  221 (560)
Q Consensus       142 ~~~~~~~~V~VIG~G~mG~~iA~~l~~~G~~V~l~d~~~~~~~~~~~~i~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~  221 (560)
                      ..+++|++|+|||+|+||++||..++.+|++|+++|++++.++++.+++.+.+++.+++|.+++++.++.+++|++++++
T Consensus       330 ~~~~~i~~v~ViGaG~MG~gIA~~~a~~G~~V~l~d~~~~~l~~~~~~i~~~l~~~~~~g~~~~~~~~~~~~~i~~~~~~  409 (737)
T TIGR02441       330 KPQRPVKTLAVLGAGLMGAGIAQVSVDKGLKTVLKDATPAGLDRGQQQVFKGLNKKVKRKKITSLERDSILSNLTPTLDY  409 (737)
T ss_pred             CCCCcccEEEEECCCHhHHHHHHHHHhCCCcEEEecCCHHHHHHHHHHHHHHHHHHHHcCCCCHHHHHHHHhCeEEeCCH
Confidence            13467999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCEEEEeccCChHHHHHHHHHHHhhcCCCceeeccCCcccHHHHHhhccCCCcEeecccCCCCCCCCeEEEEeCC
Q 008604          222 ESFKDVDMVIEAIIENVSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTN  301 (560)
Q Consensus       222 ~~~~~aDlVIeav~e~~~~k~~~~~~l~~~~~~~~ii~sntSsl~i~~la~~~~~~~r~~g~hf~~P~~~~~lvEiv~g~  301 (560)
                      +++++||+|||||+|++++|+++|+++++++++++||+||||+++++++++.+.+|+||+|+|||||++.|+||||++|+
T Consensus       410 ~~~~~aDlViEAv~E~l~~K~~vf~~l~~~~~~~~ilasNTSsl~i~~la~~~~~p~r~ig~Hff~P~~~m~LvEvv~g~  489 (737)
T TIGR02441       410 SGFKNADMVIEAVFEDLSLKHKVIKEVEAVVPPHCIIASNTSALPIKDIAAVSSRPEKVIGMHYFSPVDKMQLLEIITHD  489 (737)
T ss_pred             HHhccCCeehhhccccHHHHHHHHHHHHhhCCCCcEEEEcCCCCCHHHHHhhcCCccceEEEeccCCcccCceEEEeCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcHHHHHHHHHHHHhcCCceEEecCccccchhchHHHHHHHHHHHHHcCCCHHHHHHHHHhcCCCccHHHHHHHhhhHH
Q 008604          302 QTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRAITKFGMPMGPFRLADLVGFGV  381 (560)
Q Consensus       302 ~t~~e~~~~~~~l~~~lGk~~i~v~d~~G~i~nri~~~~~~ea~~l~~~G~~~~dID~a~~~~G~~~GPf~~~D~~Gld~  381 (560)
                      .|++++++.+..+++.+||+||+++|+||||+||++.++++||++++++|++++|||.+++++|||||||+++|.+|||+
T Consensus       490 ~Ts~~~~~~~~~~~~~lgk~pv~v~d~pGFi~NRi~~~~~~ea~~lv~eGv~~~~ID~a~~~~G~p~GP~~l~D~vGld~  569 (737)
T TIGR02441       490 GTSKDTLASAVAVGLKQGKVVIVVKDGPGFYTTRCLGPMLAEVIRLLQEGVDPKKLDKLTTKFGFPVGAATLADEVGVDV  569 (737)
T ss_pred             CCCHHHHHHHHHHHHHCCCeEEEECCcCCchHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHcCCCCCHHHHHHHhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999889999999999999999999


Q ss_pred             HHHHHHHHHHhCCCCCc--ccchHHHHHHCCCCccccCceeeeecCCC--CCCCChhHHHHHHHHhhccCccCCcccccC
Q 008604          382 AIATGMQFIENFPERTY--KSMIIPIMQEDKRAGETTRKGFYLYDERR--KASPDPEVKKFIEKARSMSGVAIDPKFAKL  457 (560)
Q Consensus       382 ~~~~~~~l~~~~~~~~~--~~~~l~~~v~~G~~G~k~g~GfY~y~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  457 (560)
                      +.++++.++..+++++.  |++++.+|+++|++|+|||+|||+|++++  +..+++++..++......    +  .....
T Consensus       570 ~~~v~~~l~~~~~~~~~~~~~~~l~~~v~~G~~G~k~G~GfY~y~~~~~~~~~~~~~v~~~~~~~~k~----p--~~~~~  643 (737)
T TIGR02441       570 AEHVAEDLGKAFGERFGGGSAELLSELVKAGFLGRKSGKGIFIYQEGKKGSKKVNSDADEILAQYKLP----P--KAEVS  643 (737)
T ss_pred             HHHHHHHHHHhcCcccccccCHHHHHHHHCCCCcccCCCeeEEcCCCCCCcCCCCHHHHHHHHHhccC----c--ccccC
Confidence            99999999998887653  57899999999999999999999998654  467889888876544321    1  00124


Q ss_pred             CHHHHHHHHHHHHHHHHHHHhhcCcCCChhHHHHHHHHhcCCCCCCCcHHHHHHHhCHHHHHHHHHHHHHHhCCCCCCcH
Q 008604          458 SEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCA  537 (560)
Q Consensus       458 ~~~~i~~r~l~~~~~ea~~~l~egv~~~~~diD~~~~~g~g~p~~~gGp~~~~d~~G~~~~~~~~~~~~~~~~~~~~p~~  537 (560)
                      ++.+|.||++.+|+|||++||+|||+.+|+|||.+|++|+|||+|+||||+|+|.+|++.+++.++.|++.+|++|.|++
T Consensus       644 ~~g~I~~Rll~~~~nEA~rlLeEGV~a~~~DID~a~~~G~GfP~~~gGP~~~aD~~Gld~v~~~~~~l~~~~g~~~~p~~  723 (737)
T TIGR02441       644 SPEDIQIRLVSRFVNEAVLCLEEGILASPSEGDIGAVFGLGFPPFLGGPFRFVDLYGADKLVDKMEKYAAAYGVQFTPCQ  723 (737)
T ss_pred             ChHHHHHHHHHHHHHHHHHHhhcCccCCHHHHHHHHHhCCCCCCccCCHHHHHHHhCHHHHHHHHHHHHHHhCCCcCCCH
Confidence            67899999999999999999999997799999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHc-CCCCc
Q 008604          538 FLAERAGK-GATLS  550 (560)
Q Consensus       538 ~l~~~~~~-g~~f~  550 (560)
                      +|++|+++ |++||
T Consensus       724 lL~~~~~~~g~~f~  737 (737)
T TIGR02441       724 LLLDHAKSPGKKFY  737 (737)
T ss_pred             HHHHHHHhcCCCCC
Confidence            99999999 99997

Members represent alpha subunit of mitochondrial multifunctional fatty acid degradation enzyme complex. Subunit activities include: enoyl-CoA hydratase (EC 4.2.1.17) & 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35). Some characterization in human, pig, and rat. The beta subunit has activity: acetyl-CoA C-acyltransferase (EC 2.3.1.16).
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1683 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00725 3HCDH: 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR006108 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PF00725 3HCDH: 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR006108 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>KOG1683 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism] Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
2wtb_A725 Arabidopsis Thaliana Multifuctional Protein, Mfp2 L 0.0
1wdk_A715 Fatty Acid Beta-Oxidation Multienzyme Complex From 1e-70
2x58_A727 The Crystal Structure Of Mfe1 Liganded With Coa Len 2e-68
3zw8_A742 Crystal Structure Of Rat Peroxisomal Multifunctiona 2e-68
3zwb_A742 Crystal Structure Of Rat Peroxisomal Multifunctiona 2e-68
1zcj_A463 Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenas 3e-59
3k6j_A460 Crystal Structure Of The Dehydrogenase Part Of Mult 2e-54
3mog_A483 Crystal Structure Of 3-Hydroxybutyryl-Coa Dehydroge 7e-45
1f12_A310 L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With 3- 1e-38
1f0y_A302 L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With Ac 2e-38
1lsj_A302 Crystal Structure Of The E110q Mutant Of L-3-hydrox 4e-38
1il0_A302 X-Ray Crystal Structure Of The E170q Mutant Of Huma 4e-38
1lso_A302 Crystal Structure Of The S137a Mutant Of L-3-Hydrox 4e-38
3had_A308 Biochemical Characterization And Structure Determin 5e-38
3hdh_A302 Pig Heart Short Chain L-3-Hydroxyacyl Coa Dehydroge 6e-38
1m75_A302 Crystal Structure Of The N208s Mutant Of L-3-Hydrox 7e-38
1m76_A302 Crystal Structure Of The S137c Mutant Of L-3-Hydrox 8e-38
3rqs_A324 Crystal Structure Of Human L-3- Hydroxyacyl-Coa Deh 2e-29
2hdh_A293 Biochemical Characterization And Structure Determin 4e-28
1zej_A293 Crystal Structure Of The 3-Hydroxyacyl-Coa Dehydrog 6e-21
4dyd_A283 Substrate-Directed Dual Catalysis Of Dicarbonyl Com 2e-17
3f3s_A313 The Crystal Structure Of Human Lambda-Crystallin, C 1e-12
3ado_A319 Crystal Structure Of The Rabbit L-Gulonate 3-Dehydr 2e-11
>pdb|2WTB|A Chain A, Arabidopsis Thaliana Multifuctional Protein, Mfp2 Length = 725 Back     alignment and structure 
Iteration: 1

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/560 (80%), Positives = 506/560 (90%)
Query: 1   MMLTSKPVKGEEAHSLGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLG 60
           M+LTSKPVK EE HSLGL+DAVV P +LV+TAR+WALDI+  R+PWV+++ KTDK+ PLG
Sbjct: 166 MILTSKPVKAEEGHSLGLIDAVVPPAELVTTARRWALDIVGRRKPWVSSVSKTDKLPPLG 225
Query: 61  EAREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKS 120
           EAREI  FA+AQ  K+APN+ HP++C+D +E G+VSGPRAGL+KEAE   ++++ +T K 
Sbjct: 226 EAREILTFAKAQTLKRAPNMKHPLMCLDAIEVGIVSGPRAGLEKEAEVASQVVKLDTTKG 285
Query: 121 LVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNE 180
           L+H+FF+QRGT+KVPGVTD GL PR++KKVAI+GGGLMGSGIATALILSNYPVILKEVNE
Sbjct: 286 LIHVFFSQRGTAKVPGVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNE 345
Query: 181 KFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSL 240
           KFLEAGIGRV+ANLQSRV+KG M+QEKFEKT+SLL G LDYESF+DVDMVIEA+IEN+SL
Sbjct: 346 KFLEAGIGRVKANLQSRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISL 405
Query: 241 KQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRT 300
           KQQIFADLEKYCP HCILASNTSTIDLN IGERT S+DRIVGAHFFSPAH+MPLLEIVRT
Sbjct: 406 KQQIFADLEKYCPQHCILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRT 465
Query: 301 NQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRA 360
           N TS QVIVDLLD+GKKIKKTP+VVGNCTGFAVNRMFFPYTQAA  LVE G D YLIDRA
Sbjct: 466 NHTSAQVIVDLLDVGKKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVECGADPYLIDRA 525
Query: 361 ITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQEDKRAGETTRKGF 420
           I+KFGMPMGPFRL DLVGFGVAIAT  QFIENF ERTYKSMIIP+MQEDKRAGE TRKGF
Sbjct: 526 ISKFGMPMGPFRLCDLVGFGVAIATATQFIENFSERTYKSMIIPLMQEDKRAGEATRKGF 585
Query: 421 YLYDERRKASPDPEVKKFIEKARSMSGVAIDPKFAKLSEKDIVEMIFFPVVNEACRVFAE 480
           YLYD++RKA PDPE+KK+IEKARS+SGV +DPK A LSEKDI+EM FFPVVNEACRVFAE
Sbjct: 586 YLYDDKRKAKPDPELKKYIEKARSISGVKLDPKLANLSEKDIIEMTFFPVVNEACRVFAE 645
Query: 481 GIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLA 540
           GIAVKAADLDIA +MGMGFPPYRGGIMFWADS+GSKYIYSRL+EWS  YGEFFKPCAFLA
Sbjct: 646 GIAVKAADLDIAGIMGMGFPPYRGGIMFWADSIGSKYIYSRLDEWSKAYGEFFKPCAFLA 705
Query: 541 ERAGKGATLSAPVEEAKSKL 560
           ER  KG  LSAPV++A S+L
Sbjct: 706 ERGSKGVLLSAPVKQASSRL 725
>pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 715 Back     alignment and structure
>pdb|2X58|A Chain A, The Crystal Structure Of Mfe1 Liganded With Coa Length = 727 Back     alignment and structure
>pdb|3ZW8|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) In Apo Form Length = 742 Back     alignment and structure
>pdb|3ZWB|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) Complexed With 2trans-hexenoyl-coa Length = 742 Back     alignment and structure
>pdb|1ZCJ|A Chain A, Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenase Length = 463 Back     alignment and structure
>pdb|3K6J|A Chain A, Crystal Structure Of The Dehydrogenase Part Of Multifuctional Enzyme 1 From C.Elegans Length = 460 Back     alignment and structure
>pdb|3MOG|A Chain A, Crystal Structure Of 3-Hydroxybutyryl-Coa Dehydrogenase From Escherichia Coli K12 Substr. Mg1655 Length = 483 Back     alignment and structure
>pdb|1F12|A Chain A, L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With 3- Hydroxybutyryl-Coa Length = 310 Back     alignment and structure
>pdb|1F0Y|A Chain A, L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With Acetoacetyl-Coa And Nad+ Length = 302 Back     alignment and structure
>pdb|1LSJ|A Chain A, Crystal Structure Of The E110q Mutant Of L-3-hydroxyacyl- Coa Dehydrogenase In Complex With Nad Length = 302 Back     alignment and structure
>pdb|1IL0|A Chain A, X-Ray Crystal Structure Of The E170q Mutant Of Human L-3- Hydroxyacyl-Coa Dehydrogenase Length = 302 Back     alignment and structure
>pdb|1LSO|A Chain A, Crystal Structure Of The S137a Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad Length = 302 Back     alignment and structure
>pdb|3HAD|A Chain A, Biochemical Characterization And Structure Determination Of Human Heart Short Chain L-3-Hydroxyacyl Coa Dehydrogenase Provide Insight Into Catalytic Mechanism Length = 308 Back     alignment and structure
>pdb|3HDH|A Chain A, Pig Heart Short Chain L-3-Hydroxyacyl Coa Dehydrogenase Revisited: Sequence Analysis And Crystal Structure Determination Length = 302 Back     alignment and structure
>pdb|1M75|A Chain A, Crystal Structure Of The N208s Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad And Acetoacetyl-Coa Length = 302 Back     alignment and structure
>pdb|1M76|A Chain A, Crystal Structure Of The S137c Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad And Acetoacetyl-Coa Length = 302 Back     alignment and structure
>pdb|3RQS|A Chain A, Crystal Structure Of Human L-3- Hydroxyacyl-Coa Dehydrogenase (Ec1.1.1.35) From Mitochondria At The Resolution 2.0 A, Northeast Structural Genomics Consortium Target Hr487, Mitochondrial Protein Partnership Length = 324 Back     alignment and structure
>pdb|2HDH|A Chain A, Biochemical Characterization And Structure Determination Of Human Heart Short Chain L-3-Hydroxyacyl Coa Dehydrogenase Provide Insight Into Catalytic Mechanism Length = 293 Back     alignment and structure
>pdb|1ZEJ|A Chain A, Crystal Structure Of The 3-Hydroxyacyl-Coa Dehydrogenase (Hbd-9, Af2017) From Archaeoglobus Fulgidus Dsm 4304 At 2.00 A Resolution Length = 293 Back     alignment and structure
>pdb|4DYD|A Chain A, Substrate-Directed Dual Catalysis Of Dicarbonyl Compounds By Diketoreductase Length = 283 Back     alignment and structure
>pdb|3F3S|A Chain A, The Crystal Structure Of Human Lambda-Crystallin, Cryl1 Length = 313 Back     alignment and structure
>pdb|3ADO|A Chain A, Crystal Structure Of The Rabbit L-Gulonate 3-Dehydrogenase Length = 319 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 0.0
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 0.0
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 0.0
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 0.0
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 0.0
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 2e-95
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 2e-26
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 3e-84
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 7e-75
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 7e-04
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 6e-68
2w3p_A556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 2e-11
3ctv_A110 HBD-10, 3-hydroxyacyl-COA dehydrogenase; structura 2e-10
3ctv_A110 HBD-10, 3-hydroxyacyl-COA dehydrogenase; structura 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 6e-07
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 2e-06
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 2e-06
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 2e-06
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 3e-06
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 3e-06
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 3e-06
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 4e-06
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 4e-06
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 5e-06
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 5e-06
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 5e-06
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 7e-06
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 9e-06
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 9e-06
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 1e-05
3t3w_A279 Probable enoyl-COA hydratase; ssgcid, structural g 1e-05
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 1e-05
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 1e-05
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 1e-05
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 1e-05
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 1e-05
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 1e-05
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 1e-05
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 1e-05
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 1e-05
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 1e-05
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 1e-05
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 2e-05
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 2e-05
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 2e-05
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 2e-05
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 2e-05
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 3e-05
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 3e-05
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 3e-05
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 3e-05
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 3e-05
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 3e-05
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 4e-05
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 4e-05
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 5e-05
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 5e-05
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 6e-05
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 6e-05
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 6e-05
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 9e-05
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 1e-04
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 1e-04
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 1e-04
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 2e-04
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 2e-04
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 2e-04
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 2e-04
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 2e-04
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 3e-04
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 4e-04
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 5e-04
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Back     alignment and structure
 Score =  727 bits (1879), Expect = 0.0
 Identities = 448/560 (80%), Positives = 506/560 (90%)

Query: 1   MMLTSKPVKGEEAHSLGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLG 60
           M+LTSKPVK EE HSLGL+DAVV P +LV+TAR+WALDI+  R+PWV+++ KTDK+ PLG
Sbjct: 166 MILTSKPVKAEEGHSLGLIDAVVPPAELVTTARRWALDIVGRRKPWVSSVSKTDKLPPLG 225

Query: 61  EAREIFKFARAQARKQAPNLTHPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKS 120
           EAREI  FA+AQ  K+APN+ HP++C+D +E G+VSGPRAGL+KEAE   ++++ +T K 
Sbjct: 226 EAREILTFAKAQTLKRAPNMKHPLMCLDAIEVGIVSGPRAGLEKEAEVASQVVKLDTTKG 285

Query: 121 LVHIFFAQRGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNE 180
           L+H+FF+QRGT+KVPGVTD GL PR++KKVAI+GGGLMGSGIATALILSNYPVILKEVNE
Sbjct: 286 LIHVFFSQRGTAKVPGVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNE 345

Query: 181 KFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSL 240
           KFLEAGIGRV+ANLQSRV+KG M+QEKFEKT+SLL G LDYESF+DVDMVIEA+IEN+SL
Sbjct: 346 KFLEAGIGRVKANLQSRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISL 405

Query: 241 KQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRT 300
           KQQIFADLEKYCP HCILASNTSTIDLN IGERT S+DRIVGAHFFSPAH+MPLLEIVRT
Sbjct: 406 KQQIFADLEKYCPQHCILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRT 465

Query: 301 NQTSPQVIVDLLDIGKKIKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRA 360
           N TS QVIVDLLD+GKKIKKTP+VVGNCTGFAVNRMFFPYTQAA  LVE G D YLIDRA
Sbjct: 466 NHTSAQVIVDLLDVGKKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVECGADPYLIDRA 525

Query: 361 ITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPERTYKSMIIPIMQEDKRAGETTRKGF 420
           I+KFGMPMGPFRL DLVGFGVAIAT  QFIENF ERTYKSMIIP+MQEDKRAGE TRKGF
Sbjct: 526 ISKFGMPMGPFRLCDLVGFGVAIATATQFIENFSERTYKSMIIPLMQEDKRAGEATRKGF 585

Query: 421 YLYDERRKASPDPEVKKFIEKARSMSGVAIDPKFAKLSEKDIVEMIFFPVVNEACRVFAE 480
           YLYD++RKA PDPE+KK+IEKARS+SGV +DPK A LSEKDI+EM FFPVVNEACRVFAE
Sbjct: 586 YLYDDKRKAKPDPELKKYIEKARSISGVKLDPKLANLSEKDIIEMTFFPVVNEACRVFAE 645

Query: 481 GIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGEFFKPCAFLA 540
           GIAVKAADLDIA +MGMGFPPYRGGIMFWADS+GSKYIYSRL+EWS  YGEFFKPCAFLA
Sbjct: 646 GIAVKAADLDIAGIMGMGFPPYRGGIMFWADSIGSKYIYSRLDEWSKAYGEFFKPCAFLA 705

Query: 541 ERAGKGATLSAPVEEAKSKL 560
           ER  KG  LSAPV++A S+L
Sbjct: 706 ERGSKGVLLSAPVKQASSRL 725
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Length = 463 Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Length = 460 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Length = 483 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Length = 483 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Length = 302 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Length = 293 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Length = 293 Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 Back     alignment and structure
>3ctv_A HBD-10, 3-hydroxyacyl-COA dehydrogenase; structural genomics, APC7539, PSI-2, protein structure initiative; 2.46A {Archaeoglobus fulgidus dsm 4304} Length = 110 Back     alignment and structure
>3ctv_A HBD-10, 3-hydroxyacyl-COA dehydrogenase; structural genomics, APC7539, PSI-2, protein structure initiative; 2.46A {Archaeoglobus fulgidus dsm 4304} Length = 110 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260 Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261 Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 Back     alignment and structure
>3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279 Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query560
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 100.0
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 100.0
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 100.0
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 100.0
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 100.0
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 100.0
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 100.0
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 100.0
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 100.0
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 100.0
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 100.0
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.91
3ctv_A110 HBD-10, 3-hydroxyacyl-COA dehydrogenase; structura 99.91
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 99.85
3ctv_A110 HBD-10, 3-hydroxyacyl-COA dehydrogenase; structura 99.75
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.75
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.75
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.71
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.69
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.67
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.65
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.64
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.63
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.62
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.62
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.62
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 99.61
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.61
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.58
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 99.58
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.54
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.54
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.53
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.53
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.53
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.53
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.51
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 99.5
3l6d_A306 Putative oxidoreductase; structural genomics, prot 99.5
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 99.5
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.5
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.5
4ezb_A317 Uncharacterized conserved protein; structural geno 99.49
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 99.48
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.48
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.48
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.47
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.46
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 99.45
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.44
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 99.44
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.44
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 99.44
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.43
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 99.43
1vpd_A299 Tartronate semialdehyde reductase; structural geno 99.43
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 99.43
1yb4_A295 Tartronic semialdehyde reductase; structural genom 99.42
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.42
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 99.42
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 99.41
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.41
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 99.41
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 99.41
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 99.41
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 99.41
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.4
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 99.4
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.4
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 99.4
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 99.4
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 99.4
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 99.39
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 99.39
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 99.38
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.38
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 99.38
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 99.37
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.37
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 99.37
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.37
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 99.36
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 99.36
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.36
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 99.36
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 99.36
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.36
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 99.36
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 99.36
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.34
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 99.34
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.34
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 99.34
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.33
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 99.33
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 99.32
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 99.32
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 99.31
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 99.31
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 99.31
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.3
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 99.3
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.3
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 99.3
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 99.3
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 99.3
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 99.29
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 99.29
4hdt_A353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 99.29
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 99.28
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 99.28
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 99.28
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.27
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 99.27
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 99.26
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 99.26
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 99.26
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 99.26
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 99.26
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 99.25
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.24
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.24
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 99.24
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.24
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.23
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 99.23
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 99.23
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 99.23
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.22
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 99.22
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 99.22
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.22
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 99.21
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 99.21
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 99.21
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.2
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 99.19
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 99.19
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 99.18
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 99.18
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 99.16
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.14
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 99.14
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 99.13
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 99.12
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 99.1
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 99.09
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.09
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 99.08
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 99.07
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.06
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 99.05
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.03
3ju1_A407 Enoyl-COA hydratase/isomerase family protein; alph 99.01
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.0
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 99.0
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 98.98
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 98.97
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 98.96
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 98.95
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 98.93
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 98.9
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 98.88
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 98.88
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 98.86
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 98.84
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 98.84
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 98.82
3fr7_A525 Putative ketol-acid reductoisomerase (OS05G057370 98.81
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 98.8
3tl2_A315 Malate dehydrogenase; center for structural genomi 98.78
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 98.78
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 98.78
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 98.77
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 98.74
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 98.73
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 98.19
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 98.72
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 98.71
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.71
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 98.71
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 98.68
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 98.68
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 98.67
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 98.67
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 98.67
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 98.65
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 98.63
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 98.59
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 98.58
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 98.57
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 98.53
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 98.52
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 98.52
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 98.5
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 98.46
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 98.42
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 98.4
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.38
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 98.37
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 98.37
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 98.35
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 98.34
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 98.33
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 98.29
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 98.25
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 98.25
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 98.22
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 98.21
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 98.2
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 98.2
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 98.2
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 98.2
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 98.18
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 98.18
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 98.17
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 98.17
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 98.15
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 98.14
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 98.14
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.13
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 98.13
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 98.11
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 98.11
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 98.11
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 98.1
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 98.08
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 98.07
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 98.04
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 98.03
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 98.02
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 98.0
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 98.0
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 98.0
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 97.99
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 97.97
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.96
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 97.96
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 97.96
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 97.95
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 97.92
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.92
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 97.9
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.89
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 97.88
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 97.88
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.86
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.85
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 97.75
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.75
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 97.73
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.73
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 97.69
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 97.66
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.66
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.64
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.63
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 97.62
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.58
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.56
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.54
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 97.51
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.5
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.49
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 97.48
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.48
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 97.42
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 97.41
2duw_A145 Putative COA-binding protein; ligand binding prote 97.4
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.4
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.39
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.35
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 97.31
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.29
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 97.28
3u95_A477 Glycoside hydrolase, family 4; hydrolysis, cytosol 97.28
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.28
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.28
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.24
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.24
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.24
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.22
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.21
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.16
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.14
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.14
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.13
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.12
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.12
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.11
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.09
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 97.07
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.06
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 97.05
2w3p_A556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 97.04
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.03
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.01
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 96.96
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.95
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.94
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 96.93
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 96.93
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 96.89
3ulk_A491 Ketol-acid reductoisomerase; branched-chain amino 96.88
3euw_A344 MYO-inositol dehydrogenase; protein structure init 96.88
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.87
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 96.84
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 96.84
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.84
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.84
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.83
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.8
3rih_A293 Short chain dehydrogenase or reductase; structural 96.8
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.77
3ius_A286 Uncharacterized conserved protein; APC63810, silic 96.76
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.75
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.73
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 96.73
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 96.7
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 96.7
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.7
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.68
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.68
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 96.67
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.66
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.65
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 96.65
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.63
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 96.63
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 96.61
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 96.6
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 96.59
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.54
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.54
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 96.54
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 96.53
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.53
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 96.53
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 96.52
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.52
4g65_A461 TRK system potassium uptake protein TRKA; structur 96.5
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.48
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 96.48
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.48
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 96.46
2d59_A144 Hypothetical protein PH1109; COA binding, structur 96.45
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.45
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 96.34
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.33
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.31
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 96.31
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 96.28
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.28
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 96.24
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.23
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 96.2
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 96.19
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 96.18
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 96.17
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 96.14
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 96.14
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 96.13
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 96.12
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 96.11
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 96.11
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.1
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 96.08
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 96.07
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 96.07
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 96.07
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 96.06
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 96.06
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 96.06
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 96.06
1nff_A260 Putative oxidoreductase RV2002; directed evolution 96.06
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 96.05
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.04
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 96.04
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 96.03
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 96.02
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 96.01
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 96.01
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 96.01
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 95.99
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 95.98
1xhl_A297 Short-chain dehydrogenase/reductase family member 95.97
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 95.97
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 95.96
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 95.96
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 95.95
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 95.95
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 95.95
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 95.94
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 95.94
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 95.93
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 95.93
1xkq_A280 Short-chain reductase family member (5D234); parra 95.93
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 95.9
3cxt_A291 Dehydrogenase with different specificities; rossma 95.9
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.9
1ydw_A362 AX110P-like protein; structural genomics, protein 95.89
3tjr_A301 Short chain dehydrogenase; structural genomics, se 95.88
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 95.88
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 95.88
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 95.87
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 95.87
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 95.86
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 95.86
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 95.84
4eso_A255 Putative oxidoreductase; NADP, structural genomics 95.84
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 95.82
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 95.82
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 95.8
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 95.78
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 95.78
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 95.78
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 95.77
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 95.76
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 95.75
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 95.75
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 95.74
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 95.74
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.73
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 95.72
4had_A350 Probable oxidoreductase protein; structural genomi 95.71
3imf_A257 Short chain dehydrogenase; structural genomics, in 95.7
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 95.69
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 95.69
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 95.69
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 95.68
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 95.68
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 95.67
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 95.66
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 95.65
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 95.65
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 95.65
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 95.63
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 95.62
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 95.61
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 95.59
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 95.59
4dqx_A277 Probable oxidoreductase protein; structural genomi 95.58
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 95.57
4hv4_A494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 95.57
1spx_A278 Short-chain reductase family member (5L265); paral 95.55
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.53
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 95.49
3gem_A260 Short chain dehydrogenase; structural genomics, AP 95.47
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 95.45
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 95.44
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 95.43
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 95.42
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 95.42
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 95.42
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 95.4
3tox_A280 Short chain dehydrogenase; structural genomics, PS 95.39
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 95.39
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 95.38
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 95.37
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 95.37
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 95.36
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 95.36
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 95.35
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 95.33
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 95.32
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 95.31
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 95.3
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 95.25
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.25
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 95.24
1xq1_A266 Putative tropinone reducatse; structural genomics, 95.24
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 95.21
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 95.21
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 95.19
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 95.17
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 95.17
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 95.17
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 95.16
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 95.16
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 95.14
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 95.12
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 95.11
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 95.09
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 95.09
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.08
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 95.06
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 95.06
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 95.06
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 95.05
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 95.04
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 95.04
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.03
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 95.02
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 95.02
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 95.02
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 95.0
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 94.98
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 94.98
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 94.96
3e03_A274 Short chain dehydrogenase; structural genomics, PS 94.94
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-106  Score=902.67  Aligned_cols=545  Identities=30%  Similarity=0.511  Sum_probs=484.7

Q ss_pred             CcccCCCCChHHHHhCCCcceecCCcchHHHHHHHHHhhhccCCCchhhhcccCCCCCchhHHHHHHHHHHHHHHhCCCC
Q 008604            1 MMLTSKPVKGEEAHSLGLVDAVVAPNQLVSTARQWALDILEHRRPWVATLYKTDKIEPLGEAREIFKFARAQARKQAPNL   80 (560)
Q Consensus         1 mlltG~~i~A~eA~~~GLVd~vv~~~~l~~~A~~~a~~la~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (560)
                      |+|||++++|+||+++||||+|+|++ ++++|.++|++++++  |+..+................+..+.++.+++.+++
T Consensus       170 l~ltG~~i~a~eA~~~GLv~~vv~~d-~~~~A~~~A~~ia~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~  246 (742)
T 3zwc_A          170 LITSGKYLSADEALRLGILDAVVKSD-PVEEAIKFAQKIIDK--PIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGV  246 (742)
T ss_dssp             HHHHCCCEEHHHHHHHTSCSEEESSC-HHHHHHHHHHHHTTS--CSGGGCGGGSCCCCCTTHHHHHHHHHHHHHHHSTTC
T ss_pred             HHHcCCchhHHHHHHcCCccEecCch-hhHHHHHHHHHHhcC--CchhhhhhcccccccchhhhhHHHHHHHHhhhccch
Confidence            57999999999999999999999865 568899999999996  443333333333333333455666777888888999


Q ss_pred             CcHHHHHHHHHHhhhCChHHHHHHHHHHHhHHhcCHHHHHHHHHHHhccCCCCCCCC---CCCCCCcccceEEEEEcCcc
Q 008604           81 THPIVCIDVVEAGVVSGPRAGLQKEAEDFQKLLRSETCKSLVHIFFAQRGTSKVPGV---TDLGLAPRRVKKVAILGGGL  157 (560)
Q Consensus        81 ~A~~~~~~~i~~~~~~~~~~~l~~E~~~f~~l~~s~~~~~~~~aF~~kr~~~~~~~~---~~~~~~~~~~~~V~VIG~G~  157 (560)
                      +|+..++++++++.+.+++++++.|++.|.+|+.|+++++++++|+++|+++|.+..   ...+..+++|++|+|||+|+
T Consensus       247 ~A~~~~~~~v~~~~~~~~~~gl~~E~~~F~~l~~s~~~k~~~~aFf~~r~~~k~~~~~~~~~~~~~~~~i~~v~ViGaG~  326 (742)
T 3zwc_A          247 LAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGT  326 (742)
T ss_dssp             HHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHTSHHHHHHHHHHHHHHHTTSCBCTTCCBTTTCCCCCCCEEEEECCSH
T ss_pred             hHHHHHHHHHHHHhhCCHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhhcccccccccccccccCcccccEEEEEcccH
Confidence            999999999999999999999999999999999999999999999999998886543   22344567899999999999


Q ss_pred             chHHHHHHHHhCCCcEEEEeCCHHHHHHHHHHHHHHHHHHHHcCCCCHHHHHhhhcccccccCcccccCCCEEEEeccCC
Q 008604          158 MGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIEN  237 (560)
Q Consensus       158 mG~~iA~~l~~~G~~V~l~d~~~~~~~~~~~~i~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~~~~aDlVIeav~e~  237 (560)
                      ||++||..++++|++|+++|++++.++++.+.+...++..+.++..+..  .....+++++++++++++||+|||||+|+
T Consensus       327 MG~gIA~~~a~aG~~V~l~D~~~~~l~~~~~~i~~~l~~~~~~~~~~~~--~~~~~~~~~~~~~~~l~~aDlVIEAV~E~  404 (742)
T 3zwc_A          327 MGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQ--ASAKPKLRFSSSTKELSTVDLVVEAVFED  404 (742)
T ss_dssp             HHHHHHHHHHTTTCEEEEECSSHHHHHHHHHHHHHHHHHHHHHHHTTTC--CCCCCCEEEESCGGGGGSCSEEEECCCSC
T ss_pred             HHHHHHHHHHhCCCchhcccchHhhhhhHHHHHHHHHHHHHHhccccch--hhhhhhhcccCcHHHHhhCCEEEEecccc
Confidence            9999999999999999999999999999999999998888777655432  34557888889999999999999999999


Q ss_pred             hHHHHHHHHHHHhhcCCCceeeccCCcccHHHHHhhccCCCcEeecccCCCCCCCCeEEEEeCCCCcHHHHHHHHHHHHh
Q 008604          238 VSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQVIVDLLDIGKK  317 (560)
Q Consensus       238 ~~~k~~~~~~l~~~~~~~~ii~sntSsl~i~~la~~~~~~~r~~g~hf~~P~~~~~lvEiv~g~~t~~e~~~~~~~l~~~  317 (560)
                      +++|+++|+++++++++++||+|||||+++++|++.+.+|+||+|+|||||++.|+|||||+|+.|++++++.+..+.+.
T Consensus       405 l~iK~~vf~~le~~~~~~aIlASNTSsl~i~~ia~~~~~p~r~ig~HFfnP~~~m~LVEvi~g~~Ts~e~~~~~~~~~~~  484 (742)
T 3zwc_A          405 MNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKK  484 (742)
T ss_dssp             HHHHHHHHHHHHHHSCTTCEEEECCSSSCHHHHHTTSSCGGGEEEEECCSSTTTCCEEEEEECSSCCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhhcCCCCceEEecCCcCChHHHHhhcCCccccccccccCCCCCCceEEEecCCCCCHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCceEEecCccccchhchHHHHHHHHHHHHHcCCCHHHHHHHHHhcCCCccHHHHHHHhhhHHHHHHHHHHHHhCCC--
Q 008604          318 IKKTPIVVGNCTGFAVNRMFFPYTQAAFLLVERGTDLYLIDRAITKFGMPMGPFRLADLVGFGVAIATGMQFIENFPE--  395 (560)
Q Consensus       318 lGk~~i~v~d~~G~i~nri~~~~~~ea~~l~~~G~~~~dID~a~~~~G~~~GPf~~~D~~Gld~~~~~~~~l~~~~~~--  395 (560)
                      +||+||+++|+||||+||++.++++|+++++++|+++++||.+++++|||||||+++|.+|||+..++.+.+....++  
T Consensus       485 lgK~pV~vkd~pGFi~NRi~~~~~~ea~~l~~eG~~~~~id~a~~~~G~pmGPf~l~D~vGlDv~~~v~~~~~~~~~~~~  564 (742)
T 3zwc_A          485 IGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLP  564 (742)
T ss_dssp             TTCEEEECCCSTTTTHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHTCSSCHHHHHHHHCHHHHHHHHHHTTSSSTTSC
T ss_pred             hCCCCcccCCCCCccHHHHhhHHHHHHHHHHHcCCCHHHHHHHHHHcCCCCChHHHHHHhCHHHHHHHHHHHHhhCcccC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999887654332  


Q ss_pred             ---------CCcccchHHHHHHCCCCccccCceeeeecCC--CCCCCChhHHHHHHHHhhccCccCCcccccCCHHHHHH
Q 008604          396 ---------RTYKSMIIPIMQEDKRAGETTRKGFYLYDER--RKASPDPEVKKFIEKARSMSGVAIDPKFAKLSEKDIVE  464 (560)
Q Consensus       396 ---------~~~~~~~l~~~v~~G~~G~k~g~GfY~y~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  464 (560)
                               ...++|++++|+++|++|+|||+|||+|+++  ++..+||++..++...+....+.+    ..+++++|.+
T Consensus       565 ~~~~~~~~~~~~~~~l~~~mv~~G~lG~KtG~GFY~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~ei~~  640 (742)
T 3zwc_A          565 PGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQ----RTISKEEILE  640 (742)
T ss_dssp             TTCCTTEETTEECCCHHHHHHTTTCCBGGGTBSSSEESSTTCSCEECCHHHHHHHHHHHHHHTCCC----CCCCHHHHHH
T ss_pred             ccchhhhcccccccHHHHHHHHCCCccccCCCeeEECCCCCCccCCCChHHHHHHHHHhhhcCCCc----CCCCHHHHHH
Confidence                     1124689999999999999999999999854  345689999888876655433332    2578899999


Q ss_pred             HHHHHHHHHHHHHhhcCcCCChhHHHHHHHHhcCCCCCCCcHHHHHHHhCHHHHHHHHHHHHHHhCC--CCCCcHHHHHH
Q 008604          465 MIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSSLYGE--FFKPCAFLAER  542 (560)
Q Consensus       465 r~l~~~~~ea~~~l~egv~~~~~diD~~~~~g~g~p~~~gGp~~~~d~~G~~~~~~~~~~~~~~~~~--~~~p~~~l~~~  542 (560)
                      |++.+|+|||++||+|||+.+|+|||.+|++|+|||+|+||||+|+|.+|++.+++.|+.|+..+|+  +|.|+++|++|
T Consensus       641 R~l~~~~nEa~~~l~egI~~~~~diD~a~~~G~Gfp~~~GGp~~~~D~~G~~~~v~~l~~l~~~~g~~~~~~P~~~L~~m  720 (742)
T 3zwc_A          641 RCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRL  720 (742)
T ss_dssp             HHHHHHHHHHHHHHHTTSSSCHHHHHHHHHHHSCCCGGGCCHHHHHHHHCHHHHHHHHHHHHHHCTTCGGGSCCHHHHHH
T ss_pred             HHHHHHHHHHHHHhhcCcCCCHHHHHHHHHhCcCCCCCcCCHHHHHHHHHHHHHHHHHHHHHHHcCCCCccCCCHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999996  79999999999


Q ss_pred             HHcCC-CCcCCCc
Q 008604          543 AGKGA-TLSAPVE  554 (560)
Q Consensus       543 ~~~g~-~f~~~~~  554 (560)
                      +++|. +||+|+.
T Consensus       721 a~~G~~~f~~~~~  733 (742)
T 3zwc_A          721 VAQGSPPLKEWQS  733 (742)
T ss_dssp             HHTTCCCGGGHHH
T ss_pred             HHcCCCccccccc
Confidence            99997 4788753
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3ctv_A HBD-10, 3-hydroxyacyl-COA dehydrogenase; structural genomics, APC7539, PSI-2, protein structure initiative; 2.46A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3ctv_A HBD-10, 3-hydroxyacyl-COA dehydrogenase; structural genomics, APC7539, PSI-2, protein structure initiative; 2.46A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 560
d1wdka3186 c.2.1.6 (A:311-496) Fatty oxidation complex alpha 7e-37
d1f0ya2192 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA 2e-33
d1wdka295 a.100.1.3 (A:621-715) Fatty oxidation complex alph 2e-21
d1wdka295 a.100.1.3 (A:621-715) Fatty oxidation complex alph 0.001
d1wdka4310 c.14.1.3 (A:1-310) Fatty oxidation complex alpha s 1e-19
d1wdka1124 a.100.1.3 (A:497-620) Fatty oxidation complex alph 2e-19
d1f0ya199 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl 5e-14
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 1e-11
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 4e-05
d1a5za1140 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermoto 0.001
d1hyha1146 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydro 0.003
d1ldna1148 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus 0.003
d2f1ka2165 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {S 0.003
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Length = 186 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Fatty oxidation complex alpha subunit, middle domain
species: Pseudomonas fragi [TaxId: 296]

 Score =  133 bits (334), Expect = 7e-37
 Identities = 70/184 (38%), Positives = 112/184 (60%)

Query: 145 RRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANLQSRVKKGKMT 204
           + VK+ A+LG G+MG GIA        P+++K++NE  +E G+      L  RV KG+MT
Sbjct: 2   KDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKLLVGRVDKGRMT 61

Query: 205 QEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADLEKYCPPHCILASNTST 264
             K  + ++ +   L Y  F +VD+V+EA++EN  +KQ + A++E +     ILASNTST
Sbjct: 62  PAKMAEVLNGIRPTLSYGDFGNVDLVVEAVVENPKVKQAVLAEVENHVREDAILASNTST 121

Query: 265 IDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQVIVDLLDIGKKIKKTPIV 324
           I ++L+ +     +  VG HFF+P H+MPL+E++R  ++S   +   +   KK+ K PIV
Sbjct: 122 ISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSDLAVATTVAYAKKMGKNPIV 181

Query: 325 VGNC 328
           V +C
Sbjct: 182 VNDC 185
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1wdka2 a.100.1.3 (A:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 95 Back     information, alignment and structure
>d1wdka2 a.100.1.3 (A:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 95 Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 310 Back     information, alignment and structure
>d1wdka1 a.100.1.3 (A:497-620) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 124 Back     information, alignment and structure
>d1f0ya1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 140 Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 146 Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 148 Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 165 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query560
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 100.0
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 100.0
d1wdka295 Fatty oxidation complex alpha subunit, C-terminal 99.95
d1wdka1124 Fatty oxidation complex alpha subunit, C-terminal 99.93
d1f0ya199 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.93
d1f0ya199 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.83
d1wdka295 Fatty oxidation complex alpha subunit, C-terminal 99.75
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.73
d1wdka1124 Fatty oxidation complex alpha subunit, C-terminal 99.71
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 99.61
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.61
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.55
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.53
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.52
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.46
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.46
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.46
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 99.39
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 99.37
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 99.34
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 99.3
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 99.29
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 99.22
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 99.19
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 99.17
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.15
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.12
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.11
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.06
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.01
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.99
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 98.94
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 98.84
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.8
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 98.79
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 98.78
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 98.77
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 98.72
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.71
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 98.7
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 98.68
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 98.55
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 98.55
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 98.52
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 98.52
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 98.45
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.43
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 98.43
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 98.42
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 98.38
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 98.32
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 98.32
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 98.27
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 98.21
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.04
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 98.03
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 98.01
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.0
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 98.0
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 97.98
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.93
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.91
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 97.88
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 97.85
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 97.81
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.78
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.77
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 97.77
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 97.77
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.75
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 97.7
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.68
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.64
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 97.62
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 97.62
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 97.58
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 97.56
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.56
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 97.55
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 97.55
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 97.54
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.54
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 97.52
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 97.52
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 97.46
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.45
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.45
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.41
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.4
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 97.39
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 97.39
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 97.37
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 97.36
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.36
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.35
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 97.34
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.31
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 97.28
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 97.26
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.24
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 97.19
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.17
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.1
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 97.09
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 97.08
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 97.08
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.07
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 97.07
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.02
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 97.01
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.96
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.96
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 96.94
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.91
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 96.9
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.84
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.83
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 96.81
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 96.75
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 96.74
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.69
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.69
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.68
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 96.65
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.59
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 96.55
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.55
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.54
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 96.52
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.5
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.48
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 96.48
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 96.46
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 96.45
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.44
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 96.44
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.43
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 96.41
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.36
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.36
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 96.33
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 96.29
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 96.25
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.22
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 96.21
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 96.19
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 96.14
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.11
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.04
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.03
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 96.02
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.02
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.98
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.96
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.94
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 95.91
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.85
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 95.84
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.81
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.77
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.73
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.64
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 95.57
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.52
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.41
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.39
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.38
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.37
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.37
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 95.34
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.28
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.22
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.21
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.21
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.18
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 95.12
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.12
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.1
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 95.09
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.06
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 95.03
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.87
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 94.86
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 94.81
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 94.81
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.75
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 94.74
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 94.74
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 94.72
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 94.68
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.63
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 94.57
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 94.55
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 94.47
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 94.45
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.42
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.41
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.4
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 94.38
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.26
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 94.24
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.22
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 94.19
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 94.19
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 94.1
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 94.06
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.98
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.96
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 93.86
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 93.74
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.74
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 93.63
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 93.6
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 93.55
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 93.36
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.33
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 93.25
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 93.18
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 93.14
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 92.98
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 92.95
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 92.85
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 92.82
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 92.65
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 92.54
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 92.44
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 92.42
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 92.38
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 92.36
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.32
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.25
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 92.24
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 92.19
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 92.03
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 91.88
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 91.75
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 91.62
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.59
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 91.49
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.46
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 91.4
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 91.39
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 91.3
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 91.3
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.25
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 91.25
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 91.23
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 91.12
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 90.78
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 90.73
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 90.71
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 90.62
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 90.43
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 90.29
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 90.27
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 90.23
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.1
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 90.01
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 89.93
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 89.8
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 89.75
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.46
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.4
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 89.38
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.33
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 89.21
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 89.2
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.13
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 89.13
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 88.89
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 88.73
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 88.65
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.55
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 88.48
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.42
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 88.33
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 88.28
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 88.27
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 88.24
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 88.16
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 88.07
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 87.93
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 87.75
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 87.66
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 87.61
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 87.58
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 87.45
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 87.29
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 87.13
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 87.12
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 87.02
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 86.91
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 86.81
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 86.72
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 86.63
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 86.57
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 86.01
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 85.91
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 85.82
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 85.7
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 85.51
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 85.44
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 85.37
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 85.35
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 85.31
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 85.12
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 84.91
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 84.87
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 84.76
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 84.75
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 84.57
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 84.43
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 83.99
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 83.88
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 83.87
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 83.86
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 83.71
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 83.33
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 83.19
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 82.59
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 82.13
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 81.81
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 81.7
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 81.58
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 81.29
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 81.25
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 81.1
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 80.75
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 80.71
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 80.63
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 80.45
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 80.36
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Fatty oxidation complex alpha subunit, middle domain
species: Pseudomonas fragi [TaxId: 296]

Probab=100.00  E-value=1.2e-42  Score=324.94  Aligned_cols=185  Identities=38%  Similarity=0.674  Sum_probs=181.0

Q ss_pred             ccceEEEEEcCccchHHHHHHHHhCCCcEEEEeCCHHHHHHHHHHHHHHHHHHHHcCCCCHHHHHhhhcccccccCcccc
Q 008604          145 RRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESF  224 (560)
Q Consensus       145 ~~~~~V~VIG~G~mG~~iA~~l~~~G~~V~l~d~~~~~~~~~~~~i~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~~  224 (560)
                      +.|+||+|||+|+||++||..++++|++|++||++++.++++.+++...+...++++.+++.+.+..++++..+++++++
T Consensus         2 ~~I~~vaViGaG~mG~~iA~~~a~~G~~V~l~D~~~~~l~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~   81 (186)
T d1wdka3           2 KDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKLLVGRVDKGRMTPAKMAEVLNGIRPTLSYGDF   81 (186)
T ss_dssp             CCCSSEEEECCHHHHHHHHHHHHHTTCCEEEECSSHHHHHHHHHHHHHHHHHHHTTTSSCHHHHHHHHHHEEEESSSTTG
T ss_pred             CCCCEEEEECcCHHHHHHHHHHHhCCCeEEEEECCHHHHhhhhhhhhhhHHhhhcccccchhhhhhhhceeecccccccc
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCEEEEeccCChHHHHHHHHHHHhhcCCCceeeccCCcccHHHHHhhccCCCcEeecccCCCCCCCCeEEEEeCCCCc
Q 008604          225 KDVDMVIEAIIENVSLKQQIFADLEKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTS  304 (560)
Q Consensus       225 ~~aDlVIeav~e~~~~k~~~~~~l~~~~~~~~ii~sntSsl~i~~la~~~~~~~r~~g~hf~~P~~~~~lvEiv~g~~t~  304 (560)
                      .+||+||||++|++++|+++|++|++++++++||+||||+++++++++.+.+|+||+|+|||||++.+|||||++|+.|+
T Consensus        82 ~~adlViEav~E~l~~K~~lf~~l~~~~~~~~IiaSnTS~l~i~~la~~~~~p~r~~g~Hf~nP~~~~~lVEiv~~~~T~  161 (186)
T d1wdka3          82 GNVDLVVEAVVENPKVKQAVLAEVENHVREDAILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSS  161 (186)
T ss_dssp             GGCSEEEECCCSCHHHHHHHHHHHHTTSCTTCEEEECCSSSCHHHHGGGCSCGGGEEEEECCSSTTTCCEEEEEECSSCC
T ss_pred             cccceeeeeecchHHHHHHHHHHHHhhcCCCeeEEeccccccHHHHHHhccCchheEeeccccCcccCCeEEECCCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcCCceEEecCcc
Q 008604          305 PQVIVDLLDIGKKIKKTPIVVGNCT  329 (560)
Q Consensus       305 ~e~~~~~~~l~~~lGk~~i~v~d~~  329 (560)
                      +++++.+..|++.+||.|++|+|+|
T Consensus       162 ~~~~~~~~~~~~~lgk~pv~v~d~P  186 (186)
T d1wdka3         162 DLAVATTVAYAKKMGKNPIVVNDCP  186 (186)
T ss_dssp             HHHHHHHHHHHHHTTCEEEEEESCT
T ss_pred             HHHHHHHHHHHHHcCCEEEEEeccC
Confidence            9999999999999999999999976
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka2 a.100.1.3 (A:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1wdka1 a.100.1.3 (A:497-620) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1f0ya1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka2 a.100.1.3 (A:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1wdka1 a.100.1.3 (A:497-620) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure