Citrus Sinensis ID: 008628

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
MWDIGVHTLYFLDLSRNFLTSIDHLPWKNLEYLTLDSNLLQGSLPDLPPHMVELLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLRMNNFQGTIPQTYAKGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRNNSLSGPIPECLGNSTLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQMERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDSYSGNSGLCGFPLSKSCSIDEASEPPTPTGFIEGDDASRWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERKQSKKLRRVIRRGRAGRRSLLVHL
ccccccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccEEEccccccccccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccccEEcccHHHHccccccEEEcccccccccccHHHcccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHHHcccccccccccccEEEcccccccEEEEEEEEEccccEEEEEcccccEEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccEEEEEEEEccccccccccccc
cccccccccEEEEccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccEEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccEEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccccEEEEcccccccccccHHHHcHHHHHHHHcccccccccccccccEEEEcccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHcccHHHccHHHcccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEc
MWDIGVHTLYFLDLSRNfltsidhlpwknleyltldsnllqgslpdlppHMVELLIsnnsltgeipssfcnlssiqylnlsnnslsgqipqclgnstleTLDLRMNnfqgtipqtyakgcnlsylrlsgnhlegplppslincvklhfldvgnnnlsgpipeylgnstslSFLNVRnnslsgpipeclgnstLEILDMRMnkfsgslpqtfAKSCVLVSLNlngnrlegplppslvncrhlevidvgnnqinetfphwldvlpeLQVLtlrsnrfrgpigdtktrvpfpklriidlsynrftgvlpiwYLNGfkammhgddnstevNYMRSLNYSYYESISLTMKGNNIQMERILTTFATidlssnrfQGEISQVLGKLNSlkslnishnnltggipsslrnltelesldlssnklagriptqlASLNYLSVLNLsnnqlegpipegpqfntfandsysgnsglcgfplskscsideasepptptgfiegddasrwFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERKQSKKLRRVIRRGRAGRRSLLVHL
MWDIGVHTLYFLDLSRNFLTSIDHLPWKNLEYLTLDSNLLQGSLPDLPPHMVELLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLRMNNFQGTIPQTYAKGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRNNSLSGPIPECLGNSTLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLrsnrfrgpigdtktrvpfpklriIDLSYNRFTGVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQMERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDSYSGNSGLCGFPLSKSCSIDEASEPPTPTGFIEGDDASRWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIerkqskklrrvirrgragrrsllvhl
MWDIGVHTLYFLDLSRNFLTSIDHLPWKNLEYLTLDSNLLQGSLPDLPPHMVELLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLRMNNFQGTIPQTYAKGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRNNSLSGPIPECLGNSTLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQMERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQlaslnylsvlnlsnnqlEGPIPEGPQFNTFANDSYSGNSGLCGFPLSKSCSIDEASEPPTPTGFIEGDDASRWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERKQSKKLrrvirrgragrrSLLVHL
*WDIGVHTLYFLDLSRNFLTSIDHLPWKNLEYLTLDSNLLQGSLPDLPPHMVELLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLRMNNFQGTIPQTYAKGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRNNSLSGPIPECLGNSTLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQMERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGI*******************LAGRIPTQLASLNYLSVLNLSN*************************GLCGFPL*****************FIEGDDASRWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIER************************
MWDIGVHTLYFLDLSRNFLTSIDHLPWKNLEYLTLDSNLLQGSLPDLPPHMVELLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLRMNNFQGTIPQTYAKGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRNNSLSGPIPECLGNSTLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLNGFKA*************MRSLNYSYYESISLTMKGNNIQMERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDSYSGNSGLCGFPL***************************FDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERKQSKKLRRVIRRGRAGRRSLLVH*
MWDIGVHTLYFLDLSRNFLTSIDHLPWKNLEYLTLDSNLLQGSLPDLPPHMVELLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLRMNNFQGTIPQTYAKGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRNNSLSGPIPECLGNSTLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQMERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDSYSGNSGLCGFPLSKSCSIDEASEPPTPTGFIEGDDASRWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERKQSKKLRRVIRRGRAGRRSLLVHL
MWDIGVHTLYFLDLSRNFLTSIDHLPWKNLEYLTLDSNLLQGSLPDLPPHMVELLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLRMNNFQGTIPQTYAKGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRNNSLSGPIPECLGNSTLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQMERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDSYSGNSGLCGFPLSKSC********************SRWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERKQSKKLRRVIRRG*AGRRSLLV*L
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWDIGVHTLYFLDLSRNFLTSIDHLPWKNLEYLTLDSNLLQGSLPDLPPHMVELLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLRMNNFQGTIPQTYAKGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRNNSLSGPIPECLGNSTLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQMERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDSYSGNSGLCGFPLSKSCSIDEASEPPTPTGFIEGDDASRWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERKQSKKLRRVIRRGRAGRRSLLVHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query559 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 yes no 0.940 0.621 0.383 3e-91
Q8VZG8 1045 Probable LRR receptor-lik no no 0.758 0.405 0.356 9e-60
Q8L899 1207 Systemin receptor SR160 O N/A no 0.817 0.378 0.341 3e-54
Q9FL28 1173 LRR receptor-like serine/ no no 0.801 0.381 0.334 5e-54
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.817 0.378 0.339 4e-53
O22476 1196 Protein BRASSINOSTEROID I no no 0.817 0.382 0.336 8e-53
Q9M0G7 1013 Leucine-rich repeat recep no no 0.858 0.473 0.328 9e-53
Q9FII5 1041 Leucine-rich repeat recep no no 0.760 0.408 0.349 9e-52
Q9LP24 1120 Probable leucine-rich rep no no 0.774 0.386 0.358 1e-51
Q9SHI3729 Receptor-like protein 2 O no no 0.881 0.676 0.302 1e-51
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  336 bits (862), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 218/569 (38%), Positives = 310/569 (54%), Gaps = 43/569 (7%)

Query: 11  FLDLSRNFLTSI--DHLPWKNLEYLTLDSNLLQGSLPD---LPPHMVELLISNNSLTGEI 65
           F+  S NF ++   D   + NLEY  +  N   G  P    L P +  + +  N  TG  
Sbjct: 283 FVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTG-- 340

Query: 66  PSSFCNLSS---IQYLNLSNNSLSGQIPQCLGNS-TLETLDLRMNNFQGTIPQTYAKGCN 121
           P  F N SS   +Q L L  N L G IP+ +     LE LD+  NNF G IP T +K  N
Sbjct: 341 PIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVN 400

Query: 122 LSYLRLSGNHLEGPLPPSL--INCVKLHF------------------LDVGNNNLSGPIP 161
           L +L LS N+LEG +P  L  +N + L                    LD+ +N+  GPIP
Sbjct: 401 LLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQEEALIEELDLNSNSFQGPIP 460

Query: 162 EYLGNSTSLSFLNVRNNSLSGPIPECLGN--STLEILDMRMNKFSGSLPQTFAKSCVLVS 219
             +   +SL FL++ NN  SG IP C+ N   +++ L++  N FSG+LP  F+K+  LVS
Sbjct: 461 YMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVS 520

Query: 220 LNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPI 279
           L+++ N+LEG  P SL+NC+ LE+++V +N+I + FP WL+ LP L VL LRSN+F GP+
Sbjct: 521 LDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPL 580

Query: 280 GDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLNGFKAM--MHGDDNSTEVNYMRSLNYSYY 337
                 + F  LRIID+S+N F+G LP +Y + +K M  +  + +     + R  + SYY
Sbjct: 581 YHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRYAD-SYY 639

Query: 338 ESISLTMKGNNIQMERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIP 397
             + +  KG ++  ERI   F  ID S N+  G I + LG L  L+ LN+S N  T  IP
Sbjct: 640 HEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIP 699

Query: 398 SSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDS 457
             L NLT+LE+LD+S NKL+G+IP  LA+L++LS +N S+N L+GP+P G QF      S
Sbjct: 700 RFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSS 759

Query: 458 YSGNSGLCGFPLSKSCSIDEASEPPT--PTGFIEGDDASRWFDWKLAMLGYASGVVIGLS 515
           +  N GL G  L   C    A  P +  P    E ++    F+W  A + Y  GV+ GL 
Sbjct: 760 FLDNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEE--NMFNWVAAAIAYGPGVLCGLV 815

Query: 516 IGYMAFVTGRPQWFVRMIERKQSKKLRRV 544
           IG+  + +   +WF     RKQ K L  V
Sbjct: 816 IGHF-YTSHNHEWFTEKFGRKQHKALTSV 843
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR OS=Arabidopsis thaliana GN=TDR PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI3|RLP2_ARATH Receptor-like protein 2 OS=Arabidopsis thaliana GN=RLP2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query559
296082718 745 unnamed protein product [Vitis vinifera] 0.930 0.697 0.508 1e-132
225462116 1001 PREDICTED: receptor-like protein 12-like 0.948 0.529 0.475 1e-125
296089526616 unnamed protein product [Vitis vinifera] 0.872 0.792 0.492 1e-124
224111510 942 predicted protein [Populus trichocarpa] 0.957 0.567 0.475 1e-124
224116970 921 predicted protein [Populus trichocarpa] 0.869 0.527 0.502 1e-123
359493546 985 PREDICTED: LRR receptor-like serine/thre 0.958 0.544 0.468 1e-121
224105237 760 predicted protein [Populus trichocarpa] 0.960 0.706 0.469 1e-121
147826872 751 hypothetical protein VITISV_000530 [Viti 0.896 0.667 0.475 1e-120
359493479 814 PREDICTED: receptor-like protein 12-like 0.905 0.621 0.464 1e-120
359493544 978 PREDICTED: receptor-like protein 12-like 0.915 0.523 0.489 1e-120
>gi|296082718|emb|CBI21723.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  478 bits (1231), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 274/539 (50%), Positives = 363/539 (67%), Gaps = 19/539 (3%)

Query: 12  LDLSRN-FLTSIDHL--PWKNLEYLTLDSNLLQGSLPDLPPHMVELL---ISNNSLTGEI 65
           LDLSRN F   I ++    + L  L L SN  +G       ++ EL    +SNN+L G I
Sbjct: 202 LDLSRNQFDGEISNVFNKIRKLIVLDLSSNSFRGQFIASLDNLTELSFLDLSNNNLEGII 261

Query: 66  PSSFCNLSSIQYLNLSNNSLSGQIPQCLGN-STLETLDLRMNNFQGTIPQTYAKGCNLSY 124
           PS    LSS+  ++LSNN L+G IP  L +  +L  LDL  N   G I +  +   +L  
Sbjct: 262 PSHVKELSSLSDIHLSNNLLNGTIPSWLFSLPSLIRLDLSHNKLNGHIDEFQSP--SLES 319

Query: 125 LRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRNNSLSGPI 184
           + LS N L+GP+P S+   V L +L + +NNL GP+P  +   + +S L+  NN+LSG I
Sbjct: 320 IDLSSNELDGPVPSSIFELVNLTYLQLSSNNL-GPLPSLICEMSYISVLDFSNNNLSGLI 378

Query: 185 PECLGN--STLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLE 242
           P+CLGN   +L +LD+RMN+  G++P+TF+K   + +L  NGN+LEGPLP SL+NCR L+
Sbjct: 379 PQCLGNFSESLSVLDLRMNQLHGNIPETFSKGNFIRNLGFNGNQLEGPLPRSLINCRRLQ 438

Query: 243 VIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKLRIIDLSYNRFT 302
           V+D+GNN+IN+TFP+WL+ LPELQVL LRSNRF G I  +  + PFPKLRI+DLS N F+
Sbjct: 439 VLDLGNNRINDTFPYWLETLPELQVLILRSNRFHGHISGSNFQFPFPKLRIMDLSRNDFS 498

Query: 303 GVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQMERILTTFATID 362
           G LP  YL  FKAMM+  ++  ++ YM    Y Y +SI  T+KG + +   IL+TF TID
Sbjct: 499 GSLPEMYLKNFKAMMNVTEDKMKLKYMGE--YYYRDSIMGTIKGFDFEFV-ILSTFTTID 555

Query: 363 LSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPT 422
           LSSNRFQGEI   +G L+SL+ LN+SHNNLTG IPSSL NL  LESLDLSSNKL+GRIP 
Sbjct: 556 LSSNRFQGEILDFIGSLSSLRELNLSHNNLTGHIPSSLGNLMVLESLDLSSNKLSGRIPR 615

Query: 423 QLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDSYSGNSGLCGFPLSKSCSIDEASEPP 482
           +L SL +L VLNLS N L G IP G QF+TFAN+SYSGN GLCG PLSK C +DEA +PP
Sbjct: 616 ELTSLTFLEVLNLSKNHLTGVIPRGNQFDTFANNSYSGNIGLCGLPLSKKCVVDEAPQPP 675

Query: 483 TPTGFIEGDDASRWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERKQSKKL 541
                 E  ++   FDWK+ ++GY  G+V+GL +G + F+T +P+WFV MIE  + KK+
Sbjct: 676 KE----EEVESDTGFDWKVILMGYGCGLVVGLFMGCLVFLTRKPKWFVTMIEGDRHKKV 730

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089526|emb|CBI39345.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111510|ref|XP_002332925.1| predicted protein [Populus trichocarpa] gi|222834420|gb|EEE72897.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493546|ref|XP_002267585.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105237|ref|XP_002333843.1| predicted protein [Populus trichocarpa] gi|222838716|gb|EEE77081.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147826872|emb|CAN73268.1| hypothetical protein VITISV_000530 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493479|ref|XP_003634609.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493544|ref|XP_002267509.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query559
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.899 0.620 0.381 7.4e-82
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.932 0.732 0.398 9.4e-82
TAIR|locus:2046397589 RLP22 "receptor like protein 2 0.906 0.860 0.359 4.1e-81
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.921 0.637 0.365 1.4e-80
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.871 0.477 0.382 4.7e-80
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.910 0.589 0.355 1.2e-79
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.942 0.622 0.351 6.8e-79
TAIR|locus:2040035671 RLP20 "receptor like protein 2 0.885 0.737 0.357 6.2e-78
TAIR|locus:2119430741 RLP47 "receptor like protein 4 0.921 0.695 0.371 7.9e-78
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.912 0.513 0.366 1.3e-77
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 821 (294.1 bits), Expect = 7.4e-82, P = 7.4e-82
 Identities = 205/538 (38%), Positives = 295/538 (54%)

Query:    28 KNLEYLTLDSNLLQGSLPDLPPHM--VELL-ISNNSLTGEIPSSFCNLSSIQYLNLSNNS 84
             KNL +L L +N L GS+P+   ++  +ELL +  N LTGEIP +   L  ++ L L  N 
Sbjct:   282 KNLVHLDLSANNLNGSIPESIGNLTNLELLYLFVNELTGEIPRAIGKLPELKELKLFTNK 341

Query:    85 LSGQIPQCLGN-STLETLDLRMNNFQGTIPQTYAKGCNLSYLRLSGNHLEGPLPPSLINC 143
             L+G+IP  +G  S LE  ++  N   G +P+    G  L  + +  N+L G +P SL +C
Sbjct:   342 LTGEIPAEIGFISKLERFEVSENQLTGKLPENLCHGGKLQSVIVYSNNLTGEIPESLGDC 401

Query:   144 VKLHFLDV----------------GNNNLSGPIPEYLGNSTSLSFLNVRNNSLSGPIPEC 187
               L  + +                 NNN +G IP ++    SL  L++  N  +G IP C
Sbjct:   402 ETLSSVLLQNNGFSGSVTISNNTRSNNNFTGKIPSFICELHSLILLDLSTNKFNGSIPRC 461

Query:   188 LGN-STLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDV 246
             + N STLE+L++  N  SGS+P+  + S  + S+++  N+L G LP SLV    LEV++V
Sbjct:   462 IANLSTLEVLNLGKNHLSGSIPENISTS--VKSIDIGHNQLAGKLPRSLVRISSLEVLNV 519

Query:   247 GNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKLRIIDLSYNRFTGVLP 306
              +N+IN+TFP WLD + +LQVL LRSN F G I        F KLRIID+S N F G LP
Sbjct:   520 ESNKINDTFPFWLDSMQQLQVLVLRSNAFHGSINQNG----FSKLRIIDISGNHFNGTLP 575

Query:   307 IWYLNGFKAMMH-G--DDNSTEVNYMRSLNYSYYESISLTMKGNNIQMERILTTFATIDL 363
             + +   + AM   G  +D     NYMR+ NY Y +SI + +KG  ++M RIL TF TID 
Sbjct:   576 LDFFVNWTAMFSLGKIEDQYMGTNYMRT-NY-YSDSIVVMIKGIALEMVRILNTFTTIDF 633

Query:   364 SSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQ 423
             S N+F+GEI + +G L  L  LN+S+N  TG IPSS+ NL ELESLD+S NKL+G IP +
Sbjct:   634 SGNKFEGEIPRSVGLLKELHVLNLSNNGFTGHIPSSMGNLIELESLDVSQNKLSGEIPPE 693

Query:   424 XXXXXXXXXXXXXXXXXEGPIPEGPQFNTFANDSYSGNSGLCGFPLSKSCSIDEASEPPT 483
                               G +P G QF T    S++ N  L G  L + C +D   + P 
Sbjct:   694 LGKLSYLAYMNFSQNQFVGLVPGGTQFQTQPCSSFADNPRLFGLSLERVC-VDIHKKTPQ 752

Query:   484 PTGFIEGD-DASRWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERKQSKK 540
              +   E + D     +W  A +G   G+ IGL++GY+  V+ +P+W +     K+  K
Sbjct:   753 QSEMPEPEEDEEEVMNWTAAAIGSIPGISIGLTMGYI-LVSYKPEWLMNSGRNKRRIK 809
GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0010200 "response to chitin" evidence=IEP
GO:0050832 "defense response to fungus" evidence=IMP
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046397 RLP22 "receptor like protein 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040035 RLP20 "receptor like protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00025666001
SubName- Full=Chromosome chr19 scaffold_35, whole genome shotgun sequence; (810 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-62
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-51
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-43
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-07
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 5e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 9e-05
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-04
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  221 bits (565), Expect = 1e-62
 Identities = 155/475 (32%), Positives = 228/475 (48%), Gaps = 35/475 (7%)

Query: 3   DIGVHT-LYFLDLSRNFLTSIDHLP-----WKNLEYLTLDSNLLQGSLPDLPPHMVEL-- 54
           DIG  + L  LDL  N L     +P       +LE+LTL SN L G +P     M  L  
Sbjct: 159 DIGSFSSLKVLDLGGNVLVG--KIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKW 216

Query: 55  -LISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGN-STLETLDLRMNNFQGTI 112
             +  N+L+GEIP     L+S+ +L+L  N+L+G IP  LGN   L+ L L  N   G I
Sbjct: 217 IYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPI 276

Query: 113 PQTYAKGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLSF 172
           P +      L  L LS N L G +P  +I    L  L + +NN +G IP  L +   L  
Sbjct: 277 PPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQV 336

Query: 173 LNVRNNSLSGPIPECLG-NSTLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPL 231
           L + +N  SG IP+ LG ++ L +LD+  N  +G +P+    S  L  L L  N LEG +
Sbjct: 337 LQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEI 396

Query: 232 PPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKL 291
           P SL  CR L  + + +N  +   P     LP +  L + +N  +G I   K  +P   L
Sbjct: 397 PKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMP--SL 454

Query: 292 RIIDLSYNRFTGVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQM 351
           +++ L+ N+F G LP  +         G      ++  R+    +  ++   +       
Sbjct: 455 QMLSLARNKFFGGLPDSF---------GSKRLENLDLSRNQ---FSGAVPRKL------- 495

Query: 352 ERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDL 411
              L+    + LS N+  GEI   L     L SL++SHN L+G IP+S   +  L  LDL
Sbjct: 496 -GSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDL 554

Query: 412 SSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDSYSGNSGLCG 466
           S N+L+G IP  L ++  L  +N+S+N L G +P    F      + +GN  LCG
Sbjct: 555 SQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG 609

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 559
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
PLN03150623 hypothetical protein; Provisional 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PLN03150623 hypothetical protein; Provisional 99.31
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.05
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.86
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.82
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.77
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.49
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.44
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.36
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.32
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.22
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.2
PRK15386426 type III secretion protein GogB; Provisional 98.16
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.99
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
PRK15386426 type III secretion protein GogB; Provisional 97.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.71
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.61
KOG4341483 consensus F-box protein containing LRR [General fu 97.45
KOG4341483 consensus F-box protein containing LRR [General fu 97.38
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.25
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.18
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.09
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.59
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.53
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.82
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.46
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.23
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.08
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.06
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.72
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.83
smart0037026 LRR Leucine-rich repeats, outliers. 93.83
KOG4308478 consensus LRR-containing protein [Function unknown 92.93
KOG4308478 consensus LRR-containing protein [Function unknown 91.59
smart0037026 LRR Leucine-rich repeats, outliers. 91.22
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.22
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.98
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.45
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.54
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.25
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 85.03
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.28
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.3e-52  Score=471.05  Aligned_cols=461  Identities=34%  Similarity=0.498  Sum_probs=366.2

Q ss_pred             CCCccCEEECCCCCCC-CCCcccccCCcEEEccCCcccccCCCCCC---CccEEEeeeccCCcccCccCCCCCCCCEEEc
Q 008628            5 GVHTLYFLDLSRNFLT-SIDHLPWKNLEYLTLDSNLLQGSLPDLPP---HMVELLISNNSLTGEIPSSFCNLSSIQYLNL   80 (559)
Q Consensus         5 ~l~~L~~L~ls~n~~~-~i~~~~~~~L~~L~Ls~n~~~~~~~~~~~---~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L   80 (559)
                      ++++|++|++++|+++ .+|....++|++|++++|.+.+.+|..+.   +|++|++++|.+.+..|..++++++|++|++
T Consensus       116 ~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L  195 (968)
T PLN00113        116 TSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTL  195 (968)
T ss_pred             cCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeec
Confidence            6789999999999987 77777779999999999999887776443   8899999999988888888999999999999


Q ss_pred             ccCcCccccCcccc-CcccCeEeccCCcCCCccchhhcCCCCCCEEEcccCcCCCCCCccCCCCCCccEEEeeCCcCCcc
Q 008628           81 SNNSLSGQIPQCLG-NSTLETLDLRMNNFQGTIPQTYAKGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGP  159 (559)
Q Consensus        81 ~~n~~~~~~~~~~~-~~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~~  159 (559)
                      ++|.+.+.+|..+. +++|++|++++|.+.+..|..++++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.
T Consensus       196 ~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~  275 (968)
T PLN00113        196 ASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGP  275 (968)
T ss_pred             cCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeecc
Confidence            99998888888887 88999999999998888888899999999999999988888888888899999999999888888


Q ss_pred             cchhccCCCCCCEEEccCCccccccCcccccCc-cCEEEccCCcCCCCcchhhcCCCCccEEEccCCccccCCCccccCC
Q 008628          160 IPEYLGNSTSLSFLNVRNNSLSGPIPECLGNST-LEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNC  238 (559)
Q Consensus       160 ~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~-L~~L~l~~n~~~~~~~~~~~~~~~L~~L~L~~n~~~~~~~~~l~~l  238 (559)
                      .|..+.++++|++|++++|.+.+.+|..+.... |+.|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+..+
T Consensus       276 ~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~  355 (968)
T PLN00113        276 IPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKH  355 (968)
T ss_pred             CchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCC
Confidence            888888888888888888888887777765544 8888888888887788888888888888888888877777777777


Q ss_pred             CCCcEEEeecCccCcccchhhcCCCCCcEEEcccccccccCCCCCCCCCCCCceEEEccCccceeecChHhhhccccccc
Q 008628          239 RHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLNGFKAMMH  318 (559)
Q Consensus       239 ~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~l~~  318 (559)
                      ++|+.|++++|.+++..|.++..+++|+.|++++|.+.+.+|...  ..+++|+.|++++|++++..|.. +..++.++.
T Consensus       356 ~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~--~~~~~L~~L~L~~n~l~~~~p~~-~~~l~~L~~  432 (968)
T PLN00113        356 NNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSL--GACRSLRRVRLQDNSFSGELPSE-FTKLPLVYF  432 (968)
T ss_pred             CCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHH--hCCCCCCEEECcCCEeeeECChh-HhcCCCCCE
Confidence            788888888777777667666666666666666666665555443  44556666666666666555543 334444444


Q ss_pred             ccCCCCcccc-------------------------cccc-cccceeeeEEeec---CchhhHHHhhccccEEEcCCcccc
Q 008628          319 GDDNSTEVNY-------------------------MRSL-NYSYYESISLTMK---GNNIQMERILTTFATIDLSSNRFQ  369 (559)
Q Consensus       319 ~~~~~~~~~~-------------------------l~~~-~~~~~~~~~~~~~---~~~~~~~~~l~~L~~L~ls~n~l~  369 (559)
                      ++...+.+..                         ++.. .......+.+..+   +........+++|++|++++|.+.
T Consensus       433 L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~  512 (968)
T PLN00113        433 LDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLS  512 (968)
T ss_pred             EECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcce
Confidence            4444332211                         0000 0000111221111   111223445889999999999999


Q ss_pred             cccchhhhcCCCCCEEEccCCcCCCCCCccccCCCCCCEEeCCCCcCCccCcccccCCCCCCeEeCcCCccccCCCCCCC
Q 008628          370 GEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQ  449 (559)
Q Consensus       370 ~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~l~~n~l~~~~p~~~~  449 (559)
                      +.+|..+.++++|++|+|++|.+++.+|..|..+++|+.|++++|++++.+|..+.++++|+.+++++|++++.+|....
T Consensus       513 ~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~  592 (968)
T PLN00113        513 GEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGA  592 (968)
T ss_pred             eeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             CCccCCccccCCCCCCCCC
Q 008628          450 FNTFANDSYSGNSGLCGFP  468 (559)
Q Consensus       450 ~~~~~~~~~~~n~~lc~~~  468 (559)
                      +.++....+.||+.+|+.+
T Consensus       593 ~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        593 FLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             hcccChhhhcCCccccCCc
Confidence            9999999999999999864

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-47
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-47
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-16
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-04
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 7e-05
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 1e-04
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 3e-04
4g8a_A 635 Crystal Structure Of Human Tlr4 Polymorphic Variant 9e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  187 bits (475), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 162/505 (32%), Positives = 233/505 (46%), Gaps = 48/505 (9%)
Query: 9   LYFLDLSRN-FLTSIDHLPWKNLEYLTLDSNLLQGSLPDLPPHMVELL----ISNNSLTG 63
           L  L++S N F+  I  LP K+L+YL+L  N   G +PD      + L    +S N   G
Sbjct: 249 LKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYG 308
Query: 64  EIPSSFCNLSSIQYLNLSNNSLSGQIPQ--CLGNSTLETLDLRMNNFQGTIPQTYAK-GC 120
            +P  F + S ++ L LS+N+ SG++P    L    L+ LDL  N F G +P++      
Sbjct: 309 AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 368
Query: 121 NLSYLRLSGNHLEGPLPPSLINCVK--LHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRNN 178
           +L  L LS N+  GP+ P+L    K  L  L + NN  +G IP  L N + L  L++  N
Sbjct: 369 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 428
Query: 179 SLSGPIPECLGN-STLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVN 237
            LSG IP  LG+ S L  L + +N   G +PQ       L +L L+ N L G +P  L N
Sbjct: 429 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSN 488
Query: 238 CRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPI----GDTKTRVPFPKLRI 293
           C +L  I + NN++    P W+  L  L +L L +N F G I    GD ++ +       
Sbjct: 489 CTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLI------W 542
Query: 294 IDLSYNRFTGVLPIWYL---------------------NGFKAMMHGDDNSTEVNYMRSL 332
           +DL+ N F G +P                         +G K   HG  N  E   +RS 
Sbjct: 543 LDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSE 602
Query: 333 NYSYYESISLTMKGNNIQMERILTTFAT------IDLSSNRFQGEISQVLGKLNSLKSLN 386
             +   + +     + +       TF        +D+S N   G I + +G +  L  LN
Sbjct: 603 QLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILN 662
Query: 387 ISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQXXXXXXXXXXXXXXXXXEGPIPE 446
           + HN+++G IP  + +L  L  LDLSSNKL GRIP                    GPIPE
Sbjct: 663 LGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE 722
Query: 447 GPQFNTFANDSYSGNSGLCGFPLSK 471
             QF TF    +  N GLCG+PL +
Sbjct: 723 MGQFETFPPAKFLNNPGLCGYPLPR 747
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-128
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-97
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-94
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-94
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-82
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-60
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-79
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-72
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-66
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-61
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-46
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-58
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-30
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-68
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-57
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-53
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-44
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-39
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-34
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-20
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-62
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-38
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-58
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-52
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-46
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-33
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-52
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-39
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-43
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-35
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-44
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-44
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-33
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-29
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-33
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-31
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-29
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-19
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-12
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-09
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-23
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  391 bits (1007), Expect = e-128
 Identities = 141/486 (29%), Positives = 206/486 (42%), Gaps = 84/486 (17%)

Query: 9   LYFLDLSRNFLT-----SIDHLPWKNLEYLTLDSNLLQGSLPD-----LPPHMVELLISN 58
           L  LDLS N  +     S+ +L   +L  L L SN   G +           + EL + N
Sbjct: 345 LKVLDLSFNEFSGELPESLTNL-SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN 403

Query: 59  NSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGN-STLETLDLRMNNFQGTIPQTYA 117
           N  TG+IP +  N S +  L+LS N LSG IP  LG+ S L  L L +N  +G IPQ   
Sbjct: 404 NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM 463

Query: 118 KGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRN 177
               L  L L  N L G +P  L NC  L+++ + NN L+G IP+++G   +L+ L + N
Sbjct: 464 YVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSN 523

Query: 178 NSLSGPIPECLGN-STLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLV 236
           NS SG IP  LG+  +L  LD+  N F+G++P    K     S  +  N + G     + 
Sbjct: 524 NSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQ----SGKIAANFIAGKRYVYIK 579

Query: 237 NCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKLRIIDL 296
           N    +      N                         F+G   +   R         ++
Sbjct: 580 NDGMKKECHGAGN----------------------LLEFQGIRSEQLNR--LSTRNPCNI 615

Query: 297 SYNRFTGVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQMERILT 356
           +   + G     +                                               
Sbjct: 616 TSRVYGGHTSPTF-------------------------------------------DNNG 632

Query: 357 TFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKL 416
           +   +D+S N   G I + +G +  L  LN+ HN+++G IP  + +L  L  LDLSSNKL
Sbjct: 633 SMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKL 692

Query: 417 AGRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDSYSGNSGLCGFPLSKSCSID 476
            GRIP  +++L  L+ ++LSNN L GPIPE  QF TF    +  N GLCG+PL +    +
Sbjct: 693 DGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSN 752

Query: 477 EASEPP 482
                 
Sbjct: 753 ADGYAH 758
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query559
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.8
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.37
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.35
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.34
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.18
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.17
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.03
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.96
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.86
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.37
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.09
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.35
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.97
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.66
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-57  Score=498.29  Aligned_cols=471  Identities=34%  Similarity=0.523  Sum_probs=307.4

Q ss_pred             ccCCCccCEEECCCCCCC-CCCcccc--cCCcEEEccCCcccccCCCC-CCCccEEEeeeccCCcccCccCCCC-CCCCE
Q 008628            3 DIGVHTLYFLDLSRNFLT-SIDHLPW--KNLEYLTLDSNLLQGSLPDL-PPHMVELLISNNSLTGEIPSSFCNL-SSIQY   77 (559)
Q Consensus         3 ~~~l~~L~~L~ls~n~~~-~i~~~~~--~~L~~L~Ls~n~~~~~~~~~-~~~L~~L~L~~n~i~~~~~~~~~~l-~~L~~   77 (559)
                      ++++++|++|++++|.++ .+|..+.  ++|++|++++|.+.+.+|.. +.+|++|++++|.+++.+|..+.+. ++|++
T Consensus       219 l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~  298 (768)
T 3rgz_A          219 LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTG  298 (768)
T ss_dssp             CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSE
T ss_pred             cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCE
Confidence            345666666666666665 3343332  56666666666655544332 2255555555555555555544443 55555


Q ss_pred             EEcccCcCccccCcccc-CcccCeEeccCCcCCCccchh-hcCCCCCCEEEcccCcCCCCC-------------------
Q 008628           78 LNLSNNSLSGQIPQCLG-NSTLETLDLRMNNFQGTIPQT-YAKGCNLSYLRLSGNHLEGPL-------------------  136 (559)
Q Consensus        78 L~L~~n~~~~~~~~~~~-~~~L~~L~L~~n~~~~~~~~~-~~~l~~L~~L~L~~n~~~~~~-------------------  136 (559)
                      |++++|.+.+.+|..+. +++|++|++++|.+.+.+|.. +..+++|++|++++|.+.+.+                   
T Consensus       299 L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N  378 (768)
T 3rgz_A          299 LDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN  378 (768)
T ss_dssp             EECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSS
T ss_pred             EECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCC
Confidence            55555555555555544 555555555555554444433 455555555555555544444                   


Q ss_pred             ------CccCCC--CCCccEEEeeCCcCCcccchhccCCCCCCEEEccCCccccccCcccccCc-cCEEEccCCcCCCCc
Q 008628          137 ------PPSLIN--CVKLHFLDVGNNNLSGPIPEYLGNSTSLSFLNVRNNSLSGPIPECLGNST-LEILDMRMNKFSGSL  207 (559)
Q Consensus       137 ------~~~l~~--l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~-L~~L~l~~n~~~~~~  207 (559)
                            |..+..  +++|++|++++|.+++.+|..+..+++|++|++++|.+.+.+|..++... |+.|++++|.+.+.+
T Consensus       379 ~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~  458 (768)
T 3rgz_A          379 NFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI  458 (768)
T ss_dssp             EEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCC
T ss_pred             CcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcC
Confidence                  444433  55566666666666666666666667777777777766666666655544 777777777776666


Q ss_pred             chhhcCCCCccEEEccCCccccCCCccccCCCCCcEEEeecCccCcccchhhcCCCCCcEEEcccccccccCCCCCCCCC
Q 008628          208 PQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVP  287 (559)
Q Consensus       208 ~~~~~~~~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~  287 (559)
                      |..+..+++|++|++++|.+++..|..+..+++|++|++++|.+++.+|.+++.+++|++|++++|++.+.+|..+  ..
T Consensus       459 p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l--~~  536 (768)
T 3rgz_A          459 PQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL--GD  536 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGG--GG
T ss_pred             CHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHH--cC
Confidence            7667777777777777777776667677777777777777777766677777777777777777777766666554  55


Q ss_pred             CCCceEEEccCccceeecChHhhhcccccccccCCC-Ccccccccc-----------------------------cccce
Q 008628          288 FPKLRIIDLSYNRFTGVLPIWYLNGFKAMMHGDDNS-TEVNYMRSL-----------------------------NYSYY  337 (559)
Q Consensus       288 l~~L~~L~l~~n~l~~~~~~~~~~~l~~l~~~~~~~-~~~~~l~~~-----------------------------~~~~~  337 (559)
                      +++|+.|++++|+++|.+|..++..... ....... ....++...                             .....
T Consensus       537 l~~L~~L~Ls~N~l~g~ip~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l  615 (768)
T 3rgz_A          537 CRSLIWLDLNTNLFNGTIPAAMFKQSGK-IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNI  615 (768)
T ss_dssp             CTTCCEEECCSSEEESBCCGGGGTTTTC-BCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCT
T ss_pred             CCCCCEEECCCCccCCcCChHHhcccch-hhhhccccccccccccccccccccccccccccccccchhhhcccccccccc
Confidence            6677777777777776666554332111 1111000 000000000                             00000


Q ss_pred             eeeEEeecCchhhHHHhhccccEEEcCCcccccccchhhhcCCCCCEEEccCCcCCCCCCccccCCCCCCEEeCCCCcCC
Q 008628          338 ESISLTMKGNNIQMERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLA  417 (559)
Q Consensus       338 ~~~~~~~~~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~  417 (559)
                      ....  ..+........+++|++||+++|+++|.+|..++.+++|+.|+|++|+++|.+|..++.+++|++|||++|+++
T Consensus       616 ~~~~--~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~  693 (768)
T 3rgz_A          616 TSRV--YGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLD  693 (768)
T ss_dssp             TSCE--EEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCE
T ss_pred             ccce--ecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCccc
Confidence            0000  00000111223678999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCcccccCCCCCCeEeCcCCccccCCCCCCCCCccCCccccCCCCCCCCCCCCCCCCCCCC
Q 008628          418 GRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDSYSGNSGLCGFPLSKSCSIDEAS  479 (559)
Q Consensus       418 ~~~p~~l~~l~~L~~L~l~~n~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~~~~~c~~~~~~  479 (559)
                      +.+|..+.++++|++|++++|+++|.+|...++.++....|.|||++||.|+. .|....+.
T Consensus       694 g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~~~  754 (768)
T 3rgz_A          694 GRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSNAD  754 (768)
T ss_dssp             ECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC--
T ss_pred             CcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCccC
Confidence            99999999999999999999999999999999999999999999999999987 88765443
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 559
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-24
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-13
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-12
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-10
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-09
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-08
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 6e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 7e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score =  102 bits (253), Expect = 5e-24
 Identities = 66/387 (17%), Positives = 136/387 (35%), Gaps = 28/387 (7%)

Query: 52  VELLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLRMNNFQGT 111
           ++ ++   ++T  +  +  +L  +  L      +   I      + L  ++   N     
Sbjct: 25  MKTVLGKTNVTDTVSQT--DLDQVTTLQADRLGIK-SIDGVEYLNNLTQINFSNNQLTDI 81

Query: 112 IPQTYAKGCNLSYLRLSGNHLEGPLPPSLINCVKLHFLDVGNNNLSGPIPEYLGNSTSLS 171
            P       NL+ L     +       + +  +         NN      + L N T+L+
Sbjct: 82  TPL-----KNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNN-QITDIDPLKNLTNLN 135

Query: 172 FLNVRNNSLSGPIPECLGNSTLEILDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPL 231
            L + +N++S         S  ++           L        + +S N   +      
Sbjct: 136 RLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSD------ 189

Query: 232 PPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPKL 291
              L    +LE +   NNQI++  P  +     L  L+L  N+ +       T      L
Sbjct: 190 ISVLAKLTNLESLIATNNQISDITPLGIL--TNLDELSLNGNQLKDI----GTLASLTNL 243

Query: 292 RIIDLSYNRFTGVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQM 351
             +DL+ N+ + + P+  L     +  G +  + ++ +  L       ++      +I  
Sbjct: 244 TDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQL-EDISP 302

Query: 352 ERILTTFATIDLSSNRFQGEISQVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDL 411
              L     + L  N         +  L  L+ L  ++N ++    SSL NLT +  L  
Sbjct: 303 ISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSA 358

Query: 412 SSNKLAGRIPTQLASLNYLSVLNLSNN 438
             N+++   P  LA+L  ++ L L++ 
Sbjct: 359 GHNQISDLTP--LANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query559
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.12
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.9
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.31
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.87
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.96  E-value=1.7e-29  Score=244.90  Aligned_cols=259  Identities=32%  Similarity=0.557  Sum_probs=190.6

Q ss_pred             CCccEEEeeCCcCCc--ccchhccCCCCCCEEEccC-CccccccCcccccCccCEEEccCCcCCCCcchhhcCCCCccEE
Q 008628          144 VKLHFLDVGNNNLSG--PIPEYLGNSTSLSFLNVRN-NSLSGPIPECLGNSTLEILDMRMNKFSGSLPQTFAKSCVLVSL  220 (559)
Q Consensus       144 ~~L~~L~l~~n~l~~--~~~~~~~~l~~L~~L~l~~-n~l~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L  220 (559)
                      .+++.|+++++.+.+  .+|..++++++|++|++++ |.+.|.                       +|..+.++++|++|
T Consensus        50 ~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~-----------------------iP~~i~~L~~L~~L  106 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGP-----------------------IPPAIAKLTQLHYL  106 (313)
T ss_dssp             CCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESC-----------------------CCGGGGGCTTCSEE
T ss_pred             EEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccc-----------------------cccccccccccchh
Confidence            357778888877766  3567777777777777764 555544                       44455555556666


Q ss_pred             EccCCccccCCCccccCCCCCcEEEeecCccCcccchhhcCCCCCcEEEcccccccccCCCCCCCCCCCC-ceEEEccCc
Q 008628          221 NLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFRGPIGDTKTRVPFPK-LRIIDLSYN  299 (559)
Q Consensus       221 ~L~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~-L~~L~l~~n  299 (559)
                      ++++|++.+..+..+..+..|+.+++++|.+.+.+|..+..++.++.+++++|.+.+.+|...  ..+.. ++.+++++|
T Consensus       107 ~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~--~~l~~l~~~l~~~~n  184 (313)
T d1ogqa_         107 YITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSY--GSFSKLFTSMTISRN  184 (313)
T ss_dssp             EEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGG--GCCCTTCCEEECCSS
T ss_pred             hhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecccccccccccccc--ccccccccccccccc
Confidence            666665555555555555666666666665555555566666666666666666655555443  23333 366777777


Q ss_pred             cceeecChHhhhcccccccccCCCCcccccccccccceeeeEEeecCchhhHHHhhccccEEEcCCcccccccchhhhcC
Q 008628          300 RFTGVLPIWYLNGFKAMMHGDDNSTEVNYMRSLNYSYYESISLTMKGNNIQMERILTTFATIDLSSNRFQGEISQVLGKL  379 (559)
Q Consensus       300 ~l~~~~~~~~~~~l~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~~~~l  379 (559)
                      ++++..+..+.                                            ......++++++...+.+|..+..+
T Consensus       185 ~l~~~~~~~~~--------------------------------------------~l~~~~l~l~~~~~~~~~~~~~~~~  220 (313)
T d1ogqa_         185 RLTGKIPPTFA--------------------------------------------NLNLAFVDLSRNMLEGDASVLFGSD  220 (313)
T ss_dssp             EEEEECCGGGG--------------------------------------------GCCCSEEECCSSEEEECCGGGCCTT
T ss_pred             ccccccccccc--------------------------------------------ccccccccccccccccccccccccc
Confidence            77776654321                                            2234568899999999999999999


Q ss_pred             CCCCEEEccCCcCCCCCCccccCCCCCCEEeCCCCcCCccCcccccCCCCCCeEeCcCCccccCCCCCCCCCccCCcccc
Q 008628          380 NSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPEGPQFNTFANDSYS  459 (559)
Q Consensus       380 ~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~l~~n~l~~~~p~~~~~~~~~~~~~~  459 (559)
                      ++|+.+++++|.+.+.+| .+..+++|+.|++++|++++.+|..+.++++|++|+|++|+++|.+|+...+..+....+.
T Consensus       221 ~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~  299 (313)
T d1ogqa_         221 KNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYA  299 (313)
T ss_dssp             SCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTC
T ss_pred             cccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhC
Confidence            999999999999987765 5888999999999999999999999999999999999999999999988778889999999


Q ss_pred             CCCCCCCCCCCCCC
Q 008628          460 GNSGLCGFPLSKSC  473 (559)
Q Consensus       460 ~n~~lc~~~~~~~c  473 (559)
                      ||+.+||.|+. .|
T Consensus       300 ~N~~l~g~plp-~c  312 (313)
T d1ogqa_         300 NNKCLCGSPLP-AC  312 (313)
T ss_dssp             SSSEEESTTSS-CC
T ss_pred             CCccccCCCCC-CC
Confidence            99999999874 56
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure