Citrus Sinensis ID: 008635
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 558 | ||||||
| 224121764 | 554 | predicted protein [Populus trichocarpa] | 0.978 | 0.985 | 0.684 | 0.0 | |
| 359478275 | 649 | PREDICTED: uncharacterized protein LOC10 | 0.973 | 0.836 | 0.647 | 0.0 | |
| 356569155 | 650 | PREDICTED: uncharacterized protein LOC10 | 0.987 | 0.847 | 0.605 | 0.0 | |
| 356540095 | 643 | PREDICTED: uncharacterized protein LOC10 | 0.987 | 0.856 | 0.606 | 0.0 | |
| 357462747 | 620 | hypothetical protein MTR_3g084020 [Medic | 0.971 | 0.874 | 0.610 | 0.0 | |
| 334186137 | 686 | rhodanese/Cell cycle control phosphatase | 0.935 | 0.760 | 0.606 | 0.0 | |
| 449450369 | 619 | PREDICTED: uncharacterized protein LOC10 | 0.953 | 0.859 | 0.602 | 1e-177 | |
| 449494443 | 619 | PREDICTED: uncharacterized LOC101220363 | 0.953 | 0.859 | 0.600 | 1e-177 | |
| 297817278 | 690 | predicted protein [Arabidopsis lyrata su | 0.885 | 0.715 | 0.554 | 1e-168 | |
| 7019672 | 663 | putative protein [Arabidopsis thaliana] | 0.905 | 0.761 | 0.484 | 1e-149 |
| >gi|224121764|ref|XP_002330647.1| predicted protein [Populus trichocarpa] gi|222872251|gb|EEF09382.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 738 bits (1904), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 375/548 (68%), Positives = 452/548 (82%), Gaps = 2/548 (0%)
Query: 5 GSGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSL 64
G G+LK E ++ VEE L+D D++TEN D ++ VEP+TT I++TPE P+ +SL
Sbjct: 3 GGGKLKSFESYNIADVEEELMDSTDQLTENTDSVIGLVEPQTTSTIDITPEKPSLGSESL 62
Query: 65 DMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDN 124
+MD+ S+S+ K+S DD L G +S ++S+ +GENAV+SSL+TIT+S+TSIKKS SE D+
Sbjct: 63 EMDSDSLSSAKTSLDDLLGGFKDSINTSVNQGENAVQSSLNTITTSITSIKKSASETADS 122
Query: 125 VVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFV 184
+S+VFS+ +QTG AG +LT+FSTDL+EA K T A+V+VLR IVA+EES+ GASFV
Sbjct: 123 ALSKVFSTFNQTGELAGDRLTSFSTDLREAIKKTTGASVEVLRGAIVAVEESIVKGASFV 182
Query: 185 VYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQQVSVAIEGLERSLGFDPNDPI 244
VY YG+ KE LPPEIR ALNL E+RA K+ RP+G+ QQ V +AIEGLE+SLG DPNDP+
Sbjct: 183 VYSYGSAKELLPPEIRGALNLSEERATKILRPIGATFQQ-VYIAIEGLEKSLGLDPNDPV 241
Query: 245 VPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGI 304
VPFV+FLGTSATLW FYW W YGGYSGDLSP+ TL+LL K + +LIDVR E LRERDGI
Sbjct: 242 VPFVLFLGTSATLWGFYWVWAYGGYSGDLSPQLTLKLLAEKGDTILIDVRPEVLRERDGI 301
Query: 305 PDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDAD 364
PDLRR ARFRYASV LP+V GSV+KLL+GG++LDDTL AAVIRNLK VQDR +VIVMDA+
Sbjct: 302 PDLRRAARFRYASVTLPQVDGSVRKLLKGGKDLDDTLIAAVIRNLKAVQDRYQVIVMDAN 361
Query: 365 GTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDIN 424
G+RSKGIARSLRKLGV ++VQGGFQSWVK+GLR+KELK ETALTILNE+AEAILE+I
Sbjct: 362 GSRSKGIARSLRKLGVKRPYVVQGGFQSWVKQGLRVKELKPETALTILNEEAEAILEEIR 421
Query: 425 SSPVQFLGFGVGCFAVLYVLLEWEKTLQFIAVIGLGQTIYRRVASYNDAEDFKQDVRLLL 484
SPVQ LG GVG A Y LLEWEKTLQFIA++GLGQTIYRRVASYN EDFKQD+RLLL
Sbjct: 422 PSPVQALGCGVGFAAASYALLEWEKTLQFIAIVGLGQTIYRRVASYNGPEDFKQDMRLLL 481
Query: 485 APVRIGARAFSWAAGKLETNRPGLPTSPSSVDVQNRVLQAAAKHESQPADTEGIQDPSSE 544
+PVR+GA+AFSWA GKLE NR GLPTSPSS DVQNRVLQAAAKHESQP++T G+Q+PS
Sbjct: 482 SPVRVGAQAFSWATGKLENNRLGLPTSPSSTDVQNRVLQAAAKHESQPSET-GVQNPSPN 540
Query: 545 SVASMNEN 552
SVA +NEN
Sbjct: 541 SVAPLNEN 548
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359478275|ref|XP_002274820.2| PREDICTED: uncharacterized protein LOC100249037 [Vitis vinifera] gi|296084312|emb|CBI24700.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356569155|ref|XP_003552771.1| PREDICTED: uncharacterized protein LOC100786123 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356540095|ref|XP_003538526.1| PREDICTED: uncharacterized protein LOC100786142 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357462747|ref|XP_003601655.1| hypothetical protein MTR_3g084020 [Medicago truncatula] gi|355490703|gb|AES71906.1| hypothetical protein MTR_3g084020 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|334186137|ref|NP_191537.4| rhodanese/Cell cycle control phosphatase-like protein [Arabidopsis thaliana] gi|332646447|gb|AEE79968.1| rhodanese/Cell cycle control phosphatase-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449450369|ref|XP_004142935.1| PREDICTED: uncharacterized protein LOC101220363 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449494443|ref|XP_004159547.1| PREDICTED: uncharacterized LOC101220363 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297817278|ref|XP_002876522.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322360|gb|EFH52781.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|7019672|emb|CAB75797.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 558 | ||||||
| TAIR|locus:2178287 | 387 | CaS "calcium sensing receptor" | 0.240 | 0.346 | 0.326 | 9.8e-13 |
| TAIR|locus:2178287 CaS "calcium sensing receptor" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 196 (74.1 bits), Expect = 9.8e-13, Sum P(2) = 9.8e-13
Identities = 45/138 (32%), Positives = 79/138 (57%)
Query: 264 WTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEV 323
+ + GY GDL+P TL+LL K N +++D+R E +E+ GIP L A+ R S+ L E+
Sbjct: 212 FNFRGYKGDLTPAQTLDLLCTK-NYLMVDIRSEKDKEKAGIPRLPSNAKNRVISIPLEEL 270
Query: 324 GGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVT 383
VK ++R + ++ + A I LK + S +I++D+ +K +A++L+ LG
Sbjct: 271 PNKVKGIVRNSKRVEAEIAALKISYLKKINKGSNIIILDSYTDSAKIVAKTLKVLGYKNC 330
Query: 384 FLVQGGF---QSWVKEGL 398
++V GF + W++ L
Sbjct: 331 YIVTDGFSGGRGWLQSRL 348
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_1420041 | hypothetical protein (555 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 558 | |||
| smart00450 | 100 | smart00450, RHOD, Rhodanese Homology Domain | 1e-09 | |
| COG0607 | 110 | COG0607, PspE, Rhodanese-related sulfurtransferase | 2e-08 | |
| cd00158 | 89 | cd00158, RHOD, Rhodanese Homology Domain (RHOD); a | 3e-04 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 3e-04 |
| >gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain | Back alignment and domain information |
|---|
Score = 55.2 bits (133), Expect = 1e-09
Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 16/115 (13%)
Query: 284 GKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTA 343
E VL+DVR + E IP +V +P + +LL ELD
Sbjct: 1 NDEKVVLLDVRSPEEYEGGHIPG----------AVNIP-----LSELLDRRGELDILEFE 45
Query: 344 AVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEGL 398
+++ L + +D+ V+V G RS A LR+LG +L+ GG++ W G
Sbjct: 46 ELLKRLGLDKDK-PVVVYCRSGNRSAKAAWLLRELGFKNVYLLDGGYKEWSAAGP 99
|
An alpha beta fold found duplicated in the Rhodanese protein. The the Cysteine containing enzymatically active version of the domain is also found in the CDC25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and stress proteins such as Senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions with a loss of the cysteine are also seen in Dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases. These are likely to play a role in protein interactions. Length = 100 |
| >gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 558 | |||
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 99.83 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 99.81 | |
| PRK00162 | 108 | glpE thiosulfate sulfurtransferase; Validated | 99.79 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 99.79 | |
| cd01527 | 99 | RHOD_YgaP Member of the Rhodanese Homology Domain | 99.79 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 99.78 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 99.78 | |
| cd01526 | 122 | RHOD_ThiF Member of the Rhodanese Homology Domain | 99.76 | |
| cd01521 | 110 | RHOD_PspE2 Member of the Rhodanese Homology Domain | 99.75 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 99.75 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 99.75 | |
| cd01525 | 105 | RHOD_Kc Member of the Rhodanese Homology Domain su | 99.73 | |
| cd01524 | 90 | RHOD_Pyr_redox Member of the Rhodanese Homology Do | 99.73 | |
| cd01447 | 103 | Polysulfide_ST Polysulfide-sulfurtransferase - Rho | 99.72 | |
| cd01535 | 145 | 4RHOD_Repeat_4 Member of the Rhodanese Homology Do | 99.72 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 99.72 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 99.72 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 99.72 | |
| cd01530 | 121 | Cdc25 Cdc25 phosphatases are members of the Rhodan | 99.71 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.71 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 99.71 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 99.71 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 99.71 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 99.7 | |
| KOG1530 | 136 | consensus Rhodanese-related sulfurtransferase [Ino | 99.69 | |
| cd01529 | 96 | 4RHOD_Repeats Member of the Rhodanese Homology Dom | 99.69 | |
| cd01449 | 118 | TST_Repeat_2 Thiosulfate sulfurtransferase (TST), | 99.68 | |
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 99.68 | |
| cd01531 | 113 | Acr2p Eukaryotic arsenate resistance proteins are | 99.68 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 99.68 | |
| PRK01415 | 247 | hypothetical protein; Validated | 99.63 | |
| TIGR02981 | 101 | phageshock_pspE phage shock operon rhodanese PspE. | 99.63 | |
| cd00158 | 89 | RHOD Rhodanese Homology Domain (RHOD); an alpha be | 99.63 | |
| cd01443 | 113 | Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda | 99.62 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 99.62 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 99.62 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 99.61 | |
| PRK10287 | 104 | thiosulfate:cyanide sulfurtransferase; Provisional | 99.6 | |
| cd01445 | 138 | TST_Repeats Thiosulfate sulfurtransferases (TST) c | 99.59 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 99.58 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 99.58 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 99.57 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 99.56 | |
| PRK07411 | 390 | hypothetical protein; Validated | 99.54 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 99.54 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 99.52 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 99.5 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 99.48 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 99.47 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 99.46 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 99.46 | |
| cd01446 | 132 | DSP_MapKP N-terminal regulatory rhodanese domain o | 99.46 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 99.45 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 99.45 | |
| PRK01269 | 482 | tRNA s(4)U8 sulfurtransferase; Provisional | 99.11 | |
| COG1054 | 308 | Predicted sulfurtransferase [General function pred | 98.94 | |
| KOG1529 | 286 | consensus Mercaptopyruvate sulfurtransferase/thios | 98.79 | |
| KOG3772 | 325 | consensus M-phase inducer phosphatase [Cell cycle | 98.54 | |
| KOG1529 | 286 | consensus Mercaptopyruvate sulfurtransferase/thios | 98.07 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 97.93 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 97.85 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 97.85 | |
| PRK06370 | 463 | mercuric reductase; Validated | 97.83 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 97.77 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 97.71 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 97.66 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 97.6 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 97.57 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 97.56 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 97.56 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 97.49 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 97.47 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 97.47 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 97.42 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 97.41 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.4 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 97.35 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 97.33 | |
| PRK06116 | 450 | glutathione reductase; Validated | 97.3 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 97.3 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 97.23 | |
| COG5105 | 427 | MIH1 Mitotic inducer, protein phosphatase [Cell di | 97.22 | |
| PLN02507 | 499 | glutathione reductase | 97.2 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 97.2 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 97.1 | |
| PLN02546 | 558 | glutathione reductase | 97.08 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 97.08 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 97.05 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 96.96 | |
| PF02852 | 110 | Pyr_redox_dim: Pyridine nucleotide-disulphide oxid | 96.88 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 96.75 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 96.69 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 96.62 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 95.15 | |
| COG2603 | 334 | Predicted ATPase [General function prediction only | 95.1 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 94.81 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 94.0 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 86.26 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 85.24 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 82.12 | |
| KOG1093 | 725 | consensus Predicted protein kinase (contains TBC a | 80.42 |
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
Probab=99.83 E-value=1.8e-20 Score=164.15 Aligned_cols=99 Identities=26% Similarity=0.210 Sum_probs=87.0
Q ss_pred cccCHHHHHHHHhCCCCcEEEEeCChhhhhhcCCCcccccccccccCCCchhhhhhHHhhhcCCccchhhHHHHHHhhhh
Q 008635 271 GDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLK 350 (558)
Q Consensus 271 ~~ISp~El~elL~~~e~avLIDVRsp~Ef~~GHIPGAv~a~~~~~~nIPL~eL~~~l~eL~~~~~~L~~~l~aa~i~~Lk 350 (558)
..++++++.++++.+++.+|||||++.||..+|||||+ |+|+.++...+.++..
T Consensus 10 ~~i~~~~l~~~~~~~~~~~liDvR~~~e~~~ghIpgai--------nip~~~l~~~~~~l~~------------------ 63 (109)
T cd01533 10 PSVSADELAALQARGAPLVVLDGRRFDEYRKMTIPGSV--------SCPGAELVLRVGELAP------------------ 63 (109)
T ss_pred CcCCHHHHHHHHhcCCCcEEEeCCCHHHHhcCcCCCce--------eCCHHHHHHHHHhcCC------------------
Confidence 46899999999864445789999999999999999999 9999988776655532
Q ss_pred ccCCCcEEEEEeCCChhHHHHHHHHHHcCCCc-EEEEcccHHHHHHcC
Q 008635 351 IVQDRSKVIVMDADGTRSKGIARSLRKLGVMV-TFLVQGGFQSWVKEG 397 (558)
Q Consensus 351 gl~kdk~VVVyC~sG~RS~~AA~~L~~~Gfkn-Vy~LdGG~~aWkaAG 397 (558)
+++++||+||++|.||..+++.|+.+||++ |++|+||+.+|+.+|
T Consensus 64 --~~~~~ivv~C~~G~rs~~a~~~L~~~G~~~~v~~l~gG~~~W~~~g 109 (109)
T cd01533 64 --DPRTPIVVNCAGRTRSIIGAQSLINAGLPNPVAALRNGTQGWTLAG 109 (109)
T ss_pred --CCCCeEEEECCCCchHHHHHHHHHHCCCCcceeEecCCHHHHHhcC
Confidence 257899999999999999999999999988 999999999999876
|
This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 2nd repeat which does contain the putative catalytic Cys residue. |
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK00162 glpE thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
| >cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02981 phageshock_pspE phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >COG1054 Predicted sulfurtransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PF02852 Pyr_redox_dim: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; InterPro: IPR004099 This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [, , ] | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >COG2603 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 558 | |||
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 1e-15 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 1e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 2e-07 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 6e-07 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 3e-06 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 7e-06 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 9e-05 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 3e-04 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 3e-04 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 4e-04 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 5e-04 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 6e-04 |
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 | Back alignment and structure |
|---|
Score = 73.2 bits (179), Expect = 1e-15
Identities = 34/131 (25%), Positives = 49/131 (37%), Gaps = 11/131 (8%)
Query: 268 GYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSV 327
Y+GD++P E+L AVL+DVR E G+PDL L V
Sbjct: 2 SYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSS----------LGREVVYV 51
Query: 328 KKLLRGGRELDDTLTAAVIRNLKIVQDRSK-VIVMDADGTRSKGIARSLRKLGVMVTFLV 386
+ G D+ L R + VI + G RS G A + G+ + V
Sbjct: 52 EWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAGITPAYNV 111
Query: 387 QGGFQSWVKEG 397
GF+ +
Sbjct: 112 LDGFEGHLDAE 122
|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 558 | |||
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.95 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 99.94 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.9 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 99.89 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.88 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 99.87 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 99.86 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 99.85 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 99.85 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 99.84 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 99.84 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 99.83 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 99.83 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 99.82 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 99.82 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 99.81 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 99.8 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 99.79 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 99.79 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 99.79 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 99.77 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 99.77 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 99.77 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 99.75 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 99.74 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 99.73 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 99.72 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 99.72 | |
| 2vsw_A | 153 | Dual specificity protein phosphatase 16; hydrolase | 99.71 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 99.71 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 99.71 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 99.7 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 99.7 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 99.7 | |
| 2ouc_A | 142 | Dual specificity protein phosphatase 10; rhodanese | 99.69 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 99.69 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 99.69 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 99.68 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 99.68 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 99.68 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 99.68 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 99.67 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 99.66 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 99.66 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 99.66 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 99.66 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 99.66 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 99.65 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 99.65 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 99.64 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 99.63 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 99.63 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 99.61 | |
| 1hzm_A | 154 | Dual specificity protein phosphatase 6; hydrolase; | 99.6 | |
| 3tg1_B | 158 | Dual specificity protein phosphatase 10; kinase/rh | 99.58 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 99.51 | |
| 1whb_A | 157 | KIAA0055; deubiqutinating enzyme, UBPY, structural | 99.5 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 99.5 | |
| 2gwf_A | 157 | Ubiquitin carboxyl-terminal hydrolase 8; protein-p | 99.48 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 99.48 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 99.39 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 99.39 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 99.35 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 98.89 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 98.29 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 98.23 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 98.09 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 97.67 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 97.55 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 97.52 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 97.48 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 97.4 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 97.33 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 97.31 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 97.24 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 97.04 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 97.0 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 96.96 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 96.87 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 96.8 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 96.77 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 96.74 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 96.64 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 96.54 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 96.46 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 96.17 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 95.97 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 95.95 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 95.92 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 95.79 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 95.77 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 95.72 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 95.65 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 95.64 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 95.58 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 95.48 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 95.42 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 95.32 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 95.04 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 94.91 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 94.47 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 94.43 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 93.4 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 92.88 |
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
Probab=99.95 E-value=4.7e-29 Score=269.57 Aligned_cols=221 Identities=20% Similarity=0.248 Sum_probs=182.6
Q ss_pred hhhhHhhhHhHHHHHhhcCccccccCcccccccc---ccccccchhhHHhhhcccchhhhhcccccceeeeecCCCceee
Q 008635 110 SLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSK---LTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVY 186 (558)
Q Consensus 110 ~~~~a~~~~r~~~d~~~~g~~~~~~~~~~~a~~~---~t~~stgl~e~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~y 186 (558)
.+..|.+|||.+|+|++| ....+.+...+...+ ...+++|++|+.+++.|++| +.......+++.|
T Consensus 320 ~~~~A~~~g~~aa~~i~g-~~~~~~~~~~~~~~~~~~~~~~~vG~~e~~a~~~g~~~----------~~~~~~~~~~~~~ 388 (565)
T 3ntd_A 320 LAGPANRQGRMAADNMFG-REERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAF----------EKVYVHTASHASY 388 (565)
T ss_dssp CHHHHHHHHHHHHHHHTT-CCCCCCCBCCCEEEEETTEEEEEEECCHHHHHHTTCCC----------EEEEEEEESSCTT
T ss_pred cHHHHHHHHHHHHHHhcC-CCccCCCcccceEEEEcCcEEEEecCCHHHHHHcCCCe----------EEEEEecCcccCc
Confidence 567899999999999995 666788877766544 67899999999999999876 4555566778899
Q ss_pred cCCCcccccChhhhhhhhhhhhccceeec-cchhhhHHHHHHHHHHHHHhcCCCCCCCchHHHHHHhhHHH-HH---HHH
Q 008635 187 YYGTTKESLPPEIRDALNLYEDRAVKLWR-PVGSALQQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSAT-LW---IFY 261 (558)
Q Consensus 187 ~pGa~~~~l~p~~k~~~~~~ee~~k~i~~-~~G~iLgaQ~~vg~~gvdkridf~~~~PVLa~ai~~g~~~~-L~---l~Y 261 (558)
|||..+..+ |+|++ .+|++||+|+ +|-+++..+|+ .++.++..+.+.. +. +.|
T Consensus 389 ~~~~~~~~~---------------k~v~~~~~~~ilG~~~-~g~~a~~e~i~------~~~~ai~~~~~~~~l~~~~~~~ 446 (565)
T 3ntd_A 389 YPGAEVVSF---------------KLLFDPVKGTIFGAQA-VGKDGIDKRID------VMAVAQRAGMTVEQLQHLELSY 446 (565)
T ss_dssp STTCCEEEE---------------EEEECTTTCBEEEEEE-EESSSHHHHHH------HHHHHHHTTCBHHHHTTCCCCC
T ss_pred CCCCceEEE---------------EEEEECCCCEEEEEEE-ECCccHHHHHH------HHHHHHHcCCCHHHHhhhhhcc
Confidence 999999989 99996 5999999999 88888788888 7777777777765 11 123
Q ss_pred HH-----------------HHhcCCCcccCHHHHHHHHhCCCCcEEEEeCChhhhhhcCCCcccccccccccCCCchhhh
Q 008635 262 WW-----------------WTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVG 324 (558)
Q Consensus 262 ap-----------------~~~~G~~~~ISp~El~elL~~~e~avLIDVRsp~Ef~~GHIPGAv~a~~~~~~nIPL~eL~ 324 (558)
.| +...+....|+++++.++ +++.+|||||++.||+.+|||||+ |+|++++.
T Consensus 447 ~P~~~~~~~~i~~aa~~~~~~~~~~~~~i~~~~~~~~---~~~~~~iDvR~~~e~~~~~i~ga~--------~ip~~~l~ 515 (565)
T 3ntd_A 447 APPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNL---SEDQLLLDVRNPGELQNGGLEGAV--------NIPVDELR 515 (565)
T ss_dssp CTTTCCSSCHHHHHHHHHHHHHHTSCCEECTTTTTSC---CTTEEEEECSCGGGGGGCCCTTCE--------ECCGGGTT
T ss_pred CcccCchhhhhhhhhhhhhhccccccceeeHHHHHhC---CCCcEEEEeCCHHHHhcCCCCCcE--------ECCHHHHH
Confidence 22 233455667899987765 367899999999999999999999 99999887
Q ss_pred hhHHhhhcCCccchhhHHHHHHhhhhccCCCcEEEEEeCCChhHHHHHHHHHHcCCCcEEEEcccHHHHHHcC
Q 008635 325 GSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEG 397 (558)
Q Consensus 325 ~~l~eL~~~~~~L~~~l~aa~i~~Lkgl~kdk~VVVyC~sG~RS~~AA~~L~~~GfknVy~LdGG~~aWkaAG 397 (558)
+.+.++ +++++||+||++|.||..+++.|+++|| +|++|+|||.+|+++|
T Consensus 516 ~~~~~~----------------------~~~~~iv~~c~~g~rs~~a~~~l~~~G~-~v~~l~gG~~~w~~~g 565 (565)
T 3ntd_A 516 DRMHEL----------------------PKDKEIIIFSQVGLRGNVAYRQLVNNGY-RARNLIGGYRTYKFAS 565 (565)
T ss_dssp TSGGGS----------------------CTTSEEEEECSSSHHHHHHHHHHHHTTC-CEEEETTHHHHHHHTC
T ss_pred HHHhhc----------------------CCcCeEEEEeCCchHHHHHHHHHHHcCC-CEEEEcChHHHHHhCc
Confidence 765543 3789999999999999999999999999 9999999999999876
|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 558 | ||||
| d1tq1a_ | 119 | c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc | 2e-05 | |
| d1gmxa_ | 108 | c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia | 2e-04 | |
| d2gwfa1 | 135 | c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h | 6e-04 | |
| d1yt8a1 | 136 | c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase | 0.001 | |
| d1qxna_ | 137 | c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf | 0.002 |
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Single-domain sulfurtransferase domain: Thiosulfate sulfurtransferase/Senescence-associated protein species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 41.8 bits (97), Expect = 2e-05
Identities = 24/129 (18%), Positives = 35/129 (27%), Gaps = 20/129 (15%)
Query: 273 LSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLR 332
+S +LL +DVR + + GA
Sbjct: 10 VSVTVAHDLL--LAGHRYLDVRTPEEFSQGHAC----GAINVPYMNR------------- 50
Query: 333 GGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQS 392
G T + + +IV G RS L G + GG+ +
Sbjct: 51 -GASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSA 109
Query: 393 WVKEGLRIK 401
W K GL K
Sbjct: 110 WAKNGLPTK 118
|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 558 | |||
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.87 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 99.84 | |
| d1yt8a2 | 101 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.84 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 99.84 | |
| d1yt8a3 | 157 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.84 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 99.84 | |
| d1e0ca2 | 136 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.79 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.79 | |
| d1e0ca1 | 135 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.78 | |
| d1urha1 | 147 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.78 | |
| d1t3ka_ | 132 | Dual specificity phosphatase Cdc25 {Thale cress (A | 99.76 | |
| d1uara1 | 143 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.75 | |
| d1rhsa1 | 149 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.74 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.7 | |
| d1uara2 | 141 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.69 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.64 | |
| d1okga1 | 156 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.62 | |
| d1okga2 | 139 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.61 | |
| d1c25a_ | 161 | CDC25a {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d2gwfa1 | 135 | Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum | 99.5 | |
| d1ymka1 | 174 | CDC25b {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1hzma_ | 154 | Erk2 binding domain of Mapk phosphatase mkp-3 {Hum | 99.3 | |
| d1nhpa3 | 126 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 98.37 | |
| d1lvla3 | 123 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 94.13 | |
| d1xdia2 | 118 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 93.88 | |
| d1ebda3 | 115 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 92.69 | |
| d1ojta3 | 128 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 92.35 | |
| d1dxla3 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 91.25 | |
| d3lada3 | 124 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 91.04 | |
| d1v59a3 | 123 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 90.47 | |
| d1mo9a3 | 140 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 83.11 |
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Multidomain sulfurtransferase (rhodanese) domain: Thiosulfate sulfurtransferase PA2603 species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.87 E-value=2.2e-22 Score=181.15 Aligned_cols=108 Identities=27% Similarity=0.279 Sum_probs=98.0
Q ss_pred CcccCHHHHHHHHhCCCCcEEEEeCChhhhhhcCCCcccccccccccCCCchhhhhhHHhhhcCCccchhhHHHHHHhhh
Q 008635 270 SGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNL 349 (558)
Q Consensus 270 ~~~ISp~El~elL~~~e~avLIDVRsp~Ef~~GHIPGAv~a~~~~~~nIPL~eL~~~l~eL~~~~~~L~~~l~aa~i~~L 349 (558)
...|+++++.++++++++.+|||||++.||+.||||||+ |+|..++...+.++..+
T Consensus 23 ~~~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpGAi--------~ip~~~l~~~~~~l~~~---------------- 78 (136)
T d1yt8a1 23 TPSLAAEEVQALLDARAEAVILDARRFDEYQTMSIPGGI--------SVPGAELVLRVAELAPD---------------- 78 (136)
T ss_dssp CCEECHHHHHHHHHTTCSEEEEECSCHHHHHHSBCTTCE--------ECCGGGHHHHHHHHCCS----------------
T ss_pred CCccCHHHHHHHHhcCCCcEEEEcCChhhccceecCCch--------hhhhhHHHHHhhccccc----------------
Confidence 357999999999976677999999999999999999999 99999998888776533
Q ss_pred hccCCCcEEEEEeCCChhHHHHHHHHHHcCCCc-EEEEcccHHHHHHcCCceecCCc
Q 008635 350 KIVQDRSKVIVMDADGTRSKGIARSLRKLGVMV-TFLVQGGFQSWVKEGLRIKELKS 405 (558)
Q Consensus 350 kgl~kdk~VVVyC~sG~RS~~AA~~L~~~Gfkn-Vy~LdGG~~aWkaAGLPV~~~~~ 405 (558)
++++||+||++|.||..++..|+.+||+| |++|+||+.+|+.+|+|++.+..
T Consensus 79 ----~~~~iV~~C~~g~rs~~aa~~L~~~G~~~~V~~L~GG~~~W~~~G~pve~g~~ 131 (136)
T d1yt8a1 79 ----PRTRVIVNCAGRTRSIIGTQSLLNAGIPNPVAALRNGTIGWTLAGQQLEHGQT 131 (136)
T ss_dssp ----TTSEEEEECSSSHHHHHHHHHHHHTTCSSCEEEETTHHHHHHHTTCCCBCSCC
T ss_pred ----ccceEEEEcCCCCchHHHHHHHHHcCCCceEEEeCCcHHHHHHCCCCceeCCC
Confidence 68899999999999999999999999986 99999999999999999998754
|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|