Citrus Sinensis ID: 008635


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
MNPMGSGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVGCFAVLYVLLEWEKTLQFIAVIGLGQTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLETNRPGLPTSPSSVDVQNRVLQAAAKHESQPADTEGIQDPSSESVASMNENIPRNFF
cccccccccEEEEcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccEEEEEcccHHHHHccccccccccccccEEEEEcccccccHHHHccccccHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHcccccEEEcHHcHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
cccccccEEEEEEccccccccHHHHcHHHHHHccccccccccccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccEEEEEEccHHHHHHcccccccHHHcccEEEEcHHHcccHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHcccccEEEEEccHHHHHHccccEEcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHcHccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccc
mnpmgsgelkyiedssvpaveEGLVDFADRMTENadklmapvepkttlaieltpenptttfdsldmdnssisniKSSFDDFLAGvnesfsssmikgenavKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSidqtggsagskltnFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYgttkeslppeIRDALNLYEDRAvklwrpvgsALQQQVSVAIEGLerslgfdpndpivPFVVFLGTSATLWIFYWWWtyggysgdlspkstLELLRGKENAVLIDVRhedlrerdgipdlrrgarFRYASvylpevggSVKKLLRGGRELDDTLTAAVIRNLKivqdrskvivmdadgtrskGIARSLRKLGVMVTFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILedinsspvqflgFGVGCFAVLYVLLEWEKTLQFIAVIGLGQTIYRRVAsyndaedfKQDVRLLLAPVRIGARAFSWAagkletnrpglptspssvDVQNRVLQAAAkhesqpadtegiqdpssesvasmneniprnff
mnpmgsgelkyiedssvpAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSikkstseavdnVVSRVFSsidqtggsagskLTNFSTDLKEASSKATVAAVDVLRNTIVALeesmtngaSFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAvlidvrhedlrerdgipdlrrgarfryasvylpevggsvkkllrggreldDTLTAAVIrnlkivqdrskvivmdadgtrskgiarslrKLGVMVTFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVGCFAVLYVLLEWEKTLQFIAVIGLGQTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLetnrpglptspssVDVQNRVLQAAakhesqpadtegiqdpssesvasmneniprnff
MNPMGSGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVkssldtitssltsikkstsEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVGCFAVLYVLLEWEKTLQFIAVIGLGQTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLETNRPGLPTSPSSVDVQNRVLQAAAKHESQPADTEGIQDPSSESVASMNENIPRNFF
*************************************************************************************************************************************************************ATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVGCFAVLYVLLEWEKTLQFIAVIGLGQTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGK**********************************************************
**********YIEDSSVPAVEEGLVDFAD*****************TL*IELTP************************************************SLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNF*****E***KATVAAVDVLRNTIVA**************************************VKLWRPVGSALQQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAIL**INSSPVQFLGFGVGCFAVLYVLLEWEKTLQFIAVIGLGQTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAA************************************************************
********LKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVGCFAVLYVLLEWEKTLQFIAVIGLGQTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLETNRPGLPTSPSSVDVQNRVLQ**********************VASMNENIPRNFF
*****SGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPE********************SSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVGCFAVLYVLLEWEKTLQFIAVIGLGQTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLET*R*****************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPMGSGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVGCFAVLYVLLEWEKTLQFIAVIGLGQTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLETNRPGLPTSPSSVDVQNRVLQAAAKHESQPADTEGIQDPSSESVASMNENIPRNFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query558 2.2.26 [Sep-21-2011]
Q9FN48387 Calcium sensing receptor, no no 0.313 0.452 0.296 4e-15
>sp|Q9FN48|CAS_ARATH Calcium sensing receptor, chloroplastic OS=Arabidopsis thaliana GN=CAS PE=1 SV=1 Back     alignment and function desciption
 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 94/189 (49%), Gaps = 14/189 (7%)

Query: 223 QQVSVAIEGLE--RSLGFDPNDPIVPFVVFLGTSATLWIFYWW--------WTYGGYSGD 272
           QQ S AIE  +   S   D      P V+ +   A    +           + + GY GD
Sbjct: 161 QQTSKAIEDAKPIASSTMDTISSADPSVIVVAAGAAFLAYLLLPPVFSAISFNFRGYKGD 220

Query: 273 LSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLR 332
           L+P  TL+LL  K N +++D+R E  +E+ GIP L   A+ R  S+ L E+   VK ++R
Sbjct: 221 LTPAQTLDLLCTK-NYLMVDIRSEKDKEKAGIPRLPSNAKNRVISIPLEELPNKVKGIVR 279

Query: 333 GGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGF-- 390
             + ++  + A  I  LK +   S +I++D+    +K +A++L+ LG    ++V  GF  
Sbjct: 280 NSKRVEAEIAALKISYLKKINKGSNIIILDSYTDSAKIVAKTLKVLGYKNCYIVTDGFSG 339

Query: 391 -QSWVKEGL 398
            + W++  L
Sbjct: 340 GRGWLQSRL 348




Modulates cytoplasmic Ca(2+) concentration and is crucial for proper stomatal regulation in response to elevated levels of external Ca(2+). May function by regulating concentrations of inositol 1,4,5-trisphosphate (IP3), which in turn triggers release of Ca(2+) from internal stores. May play a role in de-etiolation.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query558
224121764554 predicted protein [Populus trichocarpa] 0.978 0.985 0.684 0.0
359478275649 PREDICTED: uncharacterized protein LOC10 0.973 0.836 0.647 0.0
356569155650 PREDICTED: uncharacterized protein LOC10 0.987 0.847 0.605 0.0
356540095643 PREDICTED: uncharacterized protein LOC10 0.987 0.856 0.606 0.0
357462747620 hypothetical protein MTR_3g084020 [Medic 0.971 0.874 0.610 0.0
334186137 686 rhodanese/Cell cycle control phosphatase 0.935 0.760 0.606 0.0
449450369619 PREDICTED: uncharacterized protein LOC10 0.953 0.859 0.602 1e-177
449494443619 PREDICTED: uncharacterized LOC101220363 0.953 0.859 0.600 1e-177
297817278 690 predicted protein [Arabidopsis lyrata su 0.885 0.715 0.554 1e-168
7019672 663 putative protein [Arabidopsis thaliana] 0.905 0.761 0.484 1e-149
>gi|224121764|ref|XP_002330647.1| predicted protein [Populus trichocarpa] gi|222872251|gb|EEF09382.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/548 (68%), Positives = 452/548 (82%), Gaps = 2/548 (0%)

Query: 5   GSGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSL 64
           G G+LK  E  ++  VEE L+D  D++TEN D ++  VEP+TT  I++TPE P+   +SL
Sbjct: 3   GGGKLKSFESYNIADVEEELMDSTDQLTENTDSVIGLVEPQTTSTIDITPEKPSLGSESL 62

Query: 65  DMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDN 124
           +MD+ S+S+ K+S DD L G  +S ++S+ +GENAV+SSL+TIT+S+TSIKKS SE  D+
Sbjct: 63  EMDSDSLSSAKTSLDDLLGGFKDSINTSVNQGENAVQSSLNTITTSITSIKKSASETADS 122

Query: 125 VVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFV 184
            +S+VFS+ +QTG  AG +LT+FSTDL+EA  K T A+V+VLR  IVA+EES+  GASFV
Sbjct: 123 ALSKVFSTFNQTGELAGDRLTSFSTDLREAIKKTTGASVEVLRGAIVAVEESIVKGASFV 182

Query: 185 VYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQQVSVAIEGLERSLGFDPNDPI 244
           VY YG+ KE LPPEIR ALNL E+RA K+ RP+G+  QQ V +AIEGLE+SLG DPNDP+
Sbjct: 183 VYSYGSAKELLPPEIRGALNLSEERATKILRPIGATFQQ-VYIAIEGLEKSLGLDPNDPV 241

Query: 245 VPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGI 304
           VPFV+FLGTSATLW FYW W YGGYSGDLSP+ TL+LL  K + +LIDVR E LRERDGI
Sbjct: 242 VPFVLFLGTSATLWGFYWVWAYGGYSGDLSPQLTLKLLAEKGDTILIDVRPEVLRERDGI 301

Query: 305 PDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDAD 364
           PDLRR ARFRYASV LP+V GSV+KLL+GG++LDDTL AAVIRNLK VQDR +VIVMDA+
Sbjct: 302 PDLRRAARFRYASVTLPQVDGSVRKLLKGGKDLDDTLIAAVIRNLKAVQDRYQVIVMDAN 361

Query: 365 GTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDIN 424
           G+RSKGIARSLRKLGV   ++VQGGFQSWVK+GLR+KELK ETALTILNE+AEAILE+I 
Sbjct: 362 GSRSKGIARSLRKLGVKRPYVVQGGFQSWVKQGLRVKELKPETALTILNEEAEAILEEIR 421

Query: 425 SSPVQFLGFGVGCFAVLYVLLEWEKTLQFIAVIGLGQTIYRRVASYNDAEDFKQDVRLLL 484
            SPVQ LG GVG  A  Y LLEWEKTLQFIA++GLGQTIYRRVASYN  EDFKQD+RLLL
Sbjct: 422 PSPVQALGCGVGFAAASYALLEWEKTLQFIAIVGLGQTIYRRVASYNGPEDFKQDMRLLL 481

Query: 485 APVRIGARAFSWAAGKLETNRPGLPTSPSSVDVQNRVLQAAAKHESQPADTEGIQDPSSE 544
           +PVR+GA+AFSWA GKLE NR GLPTSPSS DVQNRVLQAAAKHESQP++T G+Q+PS  
Sbjct: 482 SPVRVGAQAFSWATGKLENNRLGLPTSPSSTDVQNRVLQAAAKHESQPSET-GVQNPSPN 540

Query: 545 SVASMNEN 552
           SVA +NEN
Sbjct: 541 SVAPLNEN 548




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359478275|ref|XP_002274820.2| PREDICTED: uncharacterized protein LOC100249037 [Vitis vinifera] gi|296084312|emb|CBI24700.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356569155|ref|XP_003552771.1| PREDICTED: uncharacterized protein LOC100786123 [Glycine max] Back     alignment and taxonomy information
>gi|356540095|ref|XP_003538526.1| PREDICTED: uncharacterized protein LOC100786142 [Glycine max] Back     alignment and taxonomy information
>gi|357462747|ref|XP_003601655.1| hypothetical protein MTR_3g084020 [Medicago truncatula] gi|355490703|gb|AES71906.1| hypothetical protein MTR_3g084020 [Medicago truncatula] Back     alignment and taxonomy information
>gi|334186137|ref|NP_191537.4| rhodanese/Cell cycle control phosphatase-like protein [Arabidopsis thaliana] gi|332646447|gb|AEE79968.1| rhodanese/Cell cycle control phosphatase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449450369|ref|XP_004142935.1| PREDICTED: uncharacterized protein LOC101220363 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449494443|ref|XP_004159547.1| PREDICTED: uncharacterized LOC101220363 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297817278|ref|XP_002876522.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322360|gb|EFH52781.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|7019672|emb|CAB75797.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query558
TAIR|locus:2178287387 CaS "calcium sensing receptor" 0.240 0.346 0.326 9.8e-13
TAIR|locus:2178287 CaS "calcium sensing receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 196 (74.1 bits), Expect = 9.8e-13, Sum P(2) = 9.8e-13
 Identities = 45/138 (32%), Positives = 79/138 (57%)

Query:   264 WTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEV 323
             + + GY GDL+P  TL+LL  K N +++D+R E  +E+ GIP L   A+ R  S+ L E+
Sbjct:   212 FNFRGYKGDLTPAQTLDLLCTK-NYLMVDIRSEKDKEKAGIPRLPSNAKNRVISIPLEEL 270

Query:   324 GGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVT 383
                VK ++R  + ++  + A  I  LK +   S +I++D+    +K +A++L+ LG    
Sbjct:   271 PNKVKGIVRNSKRVEAEIAALKISYLKKINKGSNIIILDSYTDSAKIVAKTLKVLGYKNC 330

Query:   384 FLVQGGF---QSWVKEGL 398
             ++V  GF   + W++  L
Sbjct:   331 YIVTDGFSGGRGWLQSRL 348


GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0071277 "cellular response to calcium ion" evidence=IMP
GO:0090333 "regulation of stomatal closure" evidence=IMP
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009704 "de-etiolation" evidence=IMP
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0009416 "response to light stimulus" evidence=RCA
GO:0009637 "response to blue light" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0009773 "photosynthetic electron transport in photosystem I" evidence=RCA
GO:0010114 "response to red light" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0015979 "photosynthesis" evidence=RCA
GO:0015994 "chlorophyll metabolic process" evidence=RCA
GO:0019216 "regulation of lipid metabolic process" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
GO:0031408 "oxylipin biosynthetic process" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_1420041
hypothetical protein (555 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query558
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 1e-09
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 2e-08
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 3e-04
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 3e-04
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
 Score = 55.2 bits (133), Expect = 1e-09
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 16/115 (13%)

Query: 284 GKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTA 343
             E  VL+DVR  +  E   IP           +V +P     + +LL    ELD     
Sbjct: 1   NDEKVVLLDVRSPEEYEGGHIPG----------AVNIP-----LSELLDRRGELDILEFE 45

Query: 344 AVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEGL 398
            +++ L + +D+  V+V    G RS   A  LR+LG    +L+ GG++ W   G 
Sbjct: 46  ELLKRLGLDKDK-PVVVYCRSGNRSAKAAWLLRELGFKNVYLLDGGYKEWSAAGP 99


An alpha beta fold found duplicated in the Rhodanese protein. The the Cysteine containing enzymatically active version of the domain is also found in the CDC25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and stress proteins such as Senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions with a loss of the cysteine are also seen in Dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases. These are likely to play a role in protein interactions. Length = 100

>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 558
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.83
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.81
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.79
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.79
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.79
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.78
PLN02160136 thiosulfate sulfurtransferase 99.78
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.76
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.75
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.75
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.75
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.73
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.73
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.72
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.72
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.72
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.72
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.72
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.71
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.71
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.71
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.71
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.71
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.7
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.69
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.69
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.68
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.68
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.68
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.68
PRK01415247 hypothetical protein; Validated 99.63
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.63
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.63
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.62
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.62
PRK05320257 rhodanese superfamily protein; Provisional 99.62
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.61
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.6
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.59
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.58
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.58
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 99.57
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.56
PRK07411390 hypothetical protein; Validated 99.54
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.54
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.52
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.5
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.48
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.47
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.46
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.46
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.46
PRK11784345 tRNA 2-selenouridine synthase; Provisional 99.45
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.45
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.11
COG1054308 Predicted sulfurtransferase [General function pred 98.94
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.79
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 98.54
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.07
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.93
PRK07846451 mycothione reductase; Reviewed 97.85
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.85
PRK06370463 mercuric reductase; Validated 97.83
PRK14727479 putative mercuric reductase; Provisional 97.77
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.71
PRK13512438 coenzyme A disulfide reductase; Provisional 97.66
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.6
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.57
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.56
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.56
PRK13748561 putative mercuric reductase; Provisional 97.49
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.47
TIGR02053463 MerA mercuric reductase. This model represents the 97.47
PTZ00153659 lipoamide dehydrogenase; Provisional 97.42
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.41
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.4
PRK14694468 putative mercuric reductase; Provisional 97.35
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.33
PRK06116450 glutathione reductase; Validated 97.3
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.3
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.23
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 97.22
PLN02507499 glutathione reductase 97.2
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.2
PTZ00058561 glutathione reductase; Provisional 97.1
PLN02546558 glutathione reductase 97.08
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.08
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.05
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 96.96
PF02852110 Pyr_redox_dim: Pyridine nucleotide-disulphide oxid 96.88
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 96.75
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 96.69
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 96.62
PTZ00052499 thioredoxin reductase; Provisional 95.15
COG2603334 Predicted ATPase [General function prediction only 95.1
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 94.81
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 94.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 86.26
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 85.24
PRK14989 847 nitrite reductase subunit NirD; Provisional 82.12
KOG1093725 consensus Predicted protein kinase (contains TBC a 80.42
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
Probab=99.83  E-value=1.8e-20  Score=164.15  Aligned_cols=99  Identities=26%  Similarity=0.210  Sum_probs=87.0

Q ss_pred             cccCHHHHHHHHhCCCCcEEEEeCChhhhhhcCCCcccccccccccCCCchhhhhhHHhhhcCCccchhhHHHHHHhhhh
Q 008635          271 GDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLK  350 (558)
Q Consensus       271 ~~ISp~El~elL~~~e~avLIDVRsp~Ef~~GHIPGAv~a~~~~~~nIPL~eL~~~l~eL~~~~~~L~~~l~aa~i~~Lk  350 (558)
                      ..++++++.++++.+++.+|||||++.||..+|||||+        |+|+.++...+.++..                  
T Consensus        10 ~~i~~~~l~~~~~~~~~~~liDvR~~~e~~~ghIpgai--------nip~~~l~~~~~~l~~------------------   63 (109)
T cd01533          10 PSVSADELAALQARGAPLVVLDGRRFDEYRKMTIPGSV--------SCPGAELVLRVGELAP------------------   63 (109)
T ss_pred             CcCCHHHHHHHHhcCCCcEEEeCCCHHHHhcCcCCCce--------eCCHHHHHHHHHhcCC------------------
Confidence            46899999999864445789999999999999999999        9999988776655532                  


Q ss_pred             ccCCCcEEEEEeCCChhHHHHHHHHHHcCCCc-EEEEcccHHHHHHcC
Q 008635          351 IVQDRSKVIVMDADGTRSKGIARSLRKLGVMV-TFLVQGGFQSWVKEG  397 (558)
Q Consensus       351 gl~kdk~VVVyC~sG~RS~~AA~~L~~~Gfkn-Vy~LdGG~~aWkaAG  397 (558)
                        +++++||+||++|.||..+++.|+.+||++ |++|+||+.+|+.+|
T Consensus        64 --~~~~~ivv~C~~G~rs~~a~~~L~~~G~~~~v~~l~gG~~~W~~~g  109 (109)
T cd01533          64 --DPRTPIVVNCAGRTRSIIGAQSLINAGLPNPVAALRNGTQGWTLAG  109 (109)
T ss_pred             --CCCCeEEEECCCCchHHHHHHHHHHCCCCcceeEecCCHHHHHhcC
Confidence              257899999999999999999999999988 999999999999876



This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 2nd repeat which does contain the putative catalytic Cys residue.

>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PF02852 Pyr_redox_dim: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; InterPro: IPR004099 This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [, , ] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query558
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 1e-15
1vee_A134 Proline-rich protein family; hypothetical protein, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 2e-07
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 6e-07
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 3e-06
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 7e-06
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 9e-05
1tq1_A129 AT5G66040, senescence-associated family protein; C 3e-04
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 3e-04
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 4e-04
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 5e-04
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 6e-04
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
 Score = 73.2 bits (179), Expect = 1e-15
 Identities = 34/131 (25%), Positives = 49/131 (37%), Gaps = 11/131 (8%)

Query: 268 GYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSV 327
            Y+GD++P    E+L     AVL+DVR E      G+PDL            L      V
Sbjct: 2   SYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSS----------LGREVVYV 51

Query: 328 KKLLRGGRELDDTLTAAVIRNLKIVQDRSK-VIVMDADGTRSKGIARSLRKLGVMVTFLV 386
           +     G   D+ L     R         + VI +   G RS G A    + G+   + V
Sbjct: 52  EWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAGITPAYNV 111

Query: 387 QGGFQSWVKEG 397
             GF+  +   
Sbjct: 112 LDGFEGHLDAE 122


>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query558
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.95
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.94
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.9
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.89
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.88
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.87
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.86
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.85
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.85
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.84
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.84
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.83
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.83
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.82
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.82
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.81
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.8
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.79
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.79
1vee_A134 Proline-rich protein family; hypothetical protein, 99.79
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.77
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.77
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.77
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.75
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.74
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.73
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.72
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.72
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.71
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.71
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.71
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.7
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.7
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.7
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.69
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.69
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.69
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.68
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.68
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.68
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.68
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.67
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.66
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.66
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.66
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.66
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.66
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.65
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.65
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.64
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.63
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.63
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.61
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.6
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.58
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.51
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.5
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.5
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.48
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.48
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.39
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.39
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.35
3r2u_A466 Metallo-beta-lactamase family protein; structural 98.89
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.29
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.23
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.09
4dna_A463 Probable glutathione reductase; structural genomic 97.67
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.55
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.52
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.48
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.4
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.33
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.31
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.24
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.04
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 96.96
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 96.87
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 96.8
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 96.77
1ojt_A482 Surface protein; redox-active center, glycolysis, 96.74
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 96.64
2f46_A156 Hypothetical protein; structural genomics, joint c 96.54
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 96.46
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.17
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 95.97
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 95.95
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 95.92
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 95.79
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 95.77
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 95.72
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 95.65
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 95.64
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 95.58
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 95.48
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 95.42
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 95.32
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 95.04
1fec_A490 Trypanothione reductase; redox-active center, oxid 94.91
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 94.47
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 94.43
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 93.4
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 92.88
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
Probab=99.95  E-value=4.7e-29  Score=269.57  Aligned_cols=221  Identities=20%  Similarity=0.248  Sum_probs=182.6

Q ss_pred             hhhhHhhhHhHHHHHhhcCccccccCcccccccc---ccccccchhhHHhhhcccchhhhhcccccceeeeecCCCceee
Q 008635          110 SLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSK---LTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVY  186 (558)
Q Consensus       110 ~~~~a~~~~r~~~d~~~~g~~~~~~~~~~~a~~~---~t~~stgl~e~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~y  186 (558)
                      .+..|.+|||.+|+|++| ....+.+...+...+   ...+++|++|+.+++.|++|          +.......+++.|
T Consensus       320 ~~~~A~~~g~~aa~~i~g-~~~~~~~~~~~~~~~~~~~~~~~vG~~e~~a~~~g~~~----------~~~~~~~~~~~~~  388 (565)
T 3ntd_A          320 LAGPANRQGRMAADNMFG-REERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAF----------EKVYVHTASHASY  388 (565)
T ss_dssp             CHHHHHHHHHHHHHHHTT-CCCCCCCBCCCEEEEETTEEEEEEECCHHHHHHTTCCC----------EEEEEEEESSCTT
T ss_pred             cHHHHHHHHHHHHHHhcC-CCccCCCcccceEEEEcCcEEEEecCCHHHHHHcCCCe----------EEEEEecCcccCc
Confidence            567899999999999995 666788877766544   67899999999999999876          4555566778899


Q ss_pred             cCCCcccccChhhhhhhhhhhhccceeec-cchhhhHHHHHHHHHHHHHhcCCCCCCCchHHHHHHhhHHH-HH---HHH
Q 008635          187 YYGTTKESLPPEIRDALNLYEDRAVKLWR-PVGSALQQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSAT-LW---IFY  261 (558)
Q Consensus       187 ~pGa~~~~l~p~~k~~~~~~ee~~k~i~~-~~G~iLgaQ~~vg~~gvdkridf~~~~PVLa~ai~~g~~~~-L~---l~Y  261 (558)
                      |||..+..+               |+|++ .+|++||+|+ +|-+++..+|+      .++.++..+.+.. +.   +.|
T Consensus       389 ~~~~~~~~~---------------k~v~~~~~~~ilG~~~-~g~~a~~e~i~------~~~~ai~~~~~~~~l~~~~~~~  446 (565)
T 3ntd_A          389 YPGAEVVSF---------------KLLFDPVKGTIFGAQA-VGKDGIDKRID------VMAVAQRAGMTVEQLQHLELSY  446 (565)
T ss_dssp             STTCCEEEE---------------EEEECTTTCBEEEEEE-EESSSHHHHHH------HHHHHHHTTCBHHHHTTCCCCC
T ss_pred             CCCCceEEE---------------EEEEECCCCEEEEEEE-ECCccHHHHHH------HHHHHHHcCCCHHHHhhhhhcc
Confidence            999999989               99996 5999999999 88888788888      7777777777765 11   123


Q ss_pred             HH-----------------HHhcCCCcccCHHHHHHHHhCCCCcEEEEeCChhhhhhcCCCcccccccccccCCCchhhh
Q 008635          262 WW-----------------WTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVG  324 (558)
Q Consensus       262 ap-----------------~~~~G~~~~ISp~El~elL~~~e~avLIDVRsp~Ef~~GHIPGAv~a~~~~~~nIPL~eL~  324 (558)
                      .|                 +...+....|+++++.++   +++.+|||||++.||+.+|||||+        |+|++++.
T Consensus       447 ~P~~~~~~~~i~~aa~~~~~~~~~~~~~i~~~~~~~~---~~~~~~iDvR~~~e~~~~~i~ga~--------~ip~~~l~  515 (565)
T 3ntd_A          447 APPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNL---SEDQLLLDVRNPGELQNGGLEGAV--------NIPVDELR  515 (565)
T ss_dssp             CTTTCCSSCHHHHHHHHHHHHHHTSCCEECTTTTTSC---CTTEEEEECSCGGGGGGCCCTTCE--------ECCGGGTT
T ss_pred             CcccCchhhhhhhhhhhhhhccccccceeeHHHHHhC---CCCcEEEEeCCHHHHhcCCCCCcE--------ECCHHHHH
Confidence            22                 233455667899987765   367899999999999999999999        99999887


Q ss_pred             hhHHhhhcCCccchhhHHHHHHhhhhccCCCcEEEEEeCCChhHHHHHHHHHHcCCCcEEEEcccHHHHHHcC
Q 008635          325 GSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQSWVKEG  397 (558)
Q Consensus       325 ~~l~eL~~~~~~L~~~l~aa~i~~Lkgl~kdk~VVVyC~sG~RS~~AA~~L~~~GfknVy~LdGG~~aWkaAG  397 (558)
                      +.+.++                      +++++||+||++|.||..+++.|+++|| +|++|+|||.+|+++|
T Consensus       516 ~~~~~~----------------------~~~~~iv~~c~~g~rs~~a~~~l~~~G~-~v~~l~gG~~~w~~~g  565 (565)
T 3ntd_A          516 DRMHEL----------------------PKDKEIIIFSQVGLRGNVAYRQLVNNGY-RARNLIGGYRTYKFAS  565 (565)
T ss_dssp             TSGGGS----------------------CTTSEEEEECSSSHHHHHHHHHHHHTTC-CEEEETTHHHHHHHTC
T ss_pred             HHHhhc----------------------CCcCeEEEEeCCchHHHHHHHHHHHcCC-CEEEEcChHHHHHhCc
Confidence            765543                      3789999999999999999999999999 9999999999999876



>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 558
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 2e-05
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 2e-04
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 6e-04
d1yt8a1136 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase 0.001
d1qxna_137 c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf 0.002
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 41.8 bits (97), Expect = 2e-05
 Identities = 24/129 (18%), Positives = 35/129 (27%), Gaps = 20/129 (15%)

Query: 273 LSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLR 332
           +S     +LL        +DVR  +   +        GA                     
Sbjct: 10  VSVTVAHDLL--LAGHRYLDVRTPEEFSQGHAC----GAINVPYMNR------------- 50

Query: 333 GGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMVTFLVQGGFQS 392
            G       T  + +          +IV    G RS      L   G      + GG+ +
Sbjct: 51  -GASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSA 109

Query: 393 WVKEGLRIK 401
           W K GL  K
Sbjct: 110 WAKNGLPTK 118


>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query558
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.87
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.84
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.84
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.84
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.84
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.84
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.79
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.79
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.78
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.78
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.76
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.75
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.69
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.64
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.62
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.61
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.5
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.3
d1nhpa3126 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.37
d1lvla3123 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.13
d1xdia2118 Dihydrolipoamide dehydrogenase {Mycobacterium tube 93.88
d1ebda3115 Dihydrolipoamide dehydrogenase {Bacillus stearothe 92.69
d1ojta3128 Dihydrolipoamide dehydrogenase {Neisseria meningit 92.35
d1dxla3123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 91.25
d3lada3124 Dihydrolipoamide dehydrogenase {Azotobacter vinela 91.04
d1v59a3123 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.47
d1mo9a3140 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 83.11
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Multidomain sulfurtransferase (rhodanese)
domain: Thiosulfate sulfurtransferase PA2603
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.87  E-value=2.2e-22  Score=181.15  Aligned_cols=108  Identities=27%  Similarity=0.279  Sum_probs=98.0

Q ss_pred             CcccCHHHHHHHHhCCCCcEEEEeCChhhhhhcCCCcccccccccccCCCchhhhhhHHhhhcCCccchhhHHHHHHhhh
Q 008635          270 SGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNL  349 (558)
Q Consensus       270 ~~~ISp~El~elL~~~e~avLIDVRsp~Ef~~GHIPGAv~a~~~~~~nIPL~eL~~~l~eL~~~~~~L~~~l~aa~i~~L  349 (558)
                      ...|+++++.++++++++.+|||||++.||+.||||||+        |+|..++...+.++..+                
T Consensus        23 ~~~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpGAi--------~ip~~~l~~~~~~l~~~----------------   78 (136)
T d1yt8a1          23 TPSLAAEEVQALLDARAEAVILDARRFDEYQTMSIPGGI--------SVPGAELVLRVAELAPD----------------   78 (136)
T ss_dssp             CCEECHHHHHHHHHTTCSEEEEECSCHHHHHHSBCTTCE--------ECCGGGHHHHHHHHCCS----------------
T ss_pred             CCccCHHHHHHHHhcCCCcEEEEcCChhhccceecCCch--------hhhhhHHHHHhhccccc----------------
Confidence            357999999999976677999999999999999999999        99999998888776533                


Q ss_pred             hccCCCcEEEEEeCCChhHHHHHHHHHHcCCCc-EEEEcccHHHHHHcCCceecCCc
Q 008635          350 KIVQDRSKVIVMDADGTRSKGIARSLRKLGVMV-TFLVQGGFQSWVKEGLRIKELKS  405 (558)
Q Consensus       350 kgl~kdk~VVVyC~sG~RS~~AA~~L~~~Gfkn-Vy~LdGG~~aWkaAGLPV~~~~~  405 (558)
                          ++++||+||++|.||..++..|+.+||+| |++|+||+.+|+.+|+|++.+..
T Consensus        79 ----~~~~iV~~C~~g~rs~~aa~~L~~~G~~~~V~~L~GG~~~W~~~G~pve~g~~  131 (136)
T d1yt8a1          79 ----PRTRVIVNCAGRTRSIIGTQSLLNAGIPNPVAALRNGTIGWTLAGQQLEHGQT  131 (136)
T ss_dssp             ----TTSEEEEECSSSHHHHHHHHHHHHTTCSSCEEEETTHHHHHHHTTCCCBCSCC
T ss_pred             ----ccceEEEEcCCCCchHHHHHHHHHcCCCceEEEeCCcHHHHHHCCCCceeCCC
Confidence                68899999999999999999999999986 99999999999999999998754



>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure