Citrus Sinensis ID: 008796

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550---
MFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDGGRRGKRKI
ccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHccccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccEccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHcccHHHccccccccccccccccccccccccccccHHcEcccccccccccc
MFFATAILHVHLMQWDDENSVLRSINQCDRvwesidpnrrgqclGLLFYNELLHIFYRLRIcdyknaahhVDNLDAAMKADKQKMQEIQQLSSELDALnqslsrpdlpsreRSALAGRQAKLQQRLRSledssltgkeflepsyfgnarqawgdklvlapspmdgewlpkSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLgitdgvrevdlqHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIgdaesssqaidligpvyqmkdtingVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGdrgnemendEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSmsvnldipesiglstplpvqsssrlidldggrrgkrki
MFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQrlrsledssltgkEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGlstplpvqsssrlidldggrrgkrki
MFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDGGRRGKRKI
*FFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNL****************************************************************FLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLG*********************RLADAYSSIHHIELISKVKLEVQQFHELDIKRAM******************************************
MFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRP***************************************F****QAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALL**************HSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDT*NGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRK****************HHIELISKVKLEV******************************************************
MFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLD*********
MFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELD*K*****************IGLS************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDGGRRGKRKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query553 2.2.26 [Sep-21-2011]
Q9Y6X3613 MAU2 chromatid cohesion f yes no 0.562 0.507 0.218 4e-05
Q9D2X5619 MAU2 chromatid cohesion f yes no 0.562 0.502 0.218 5e-05
B4ZIX8607 MAU2 chromatid cohesion f N/A no 0.524 0.477 0.205 6e-05
B1H1Z8604 MAU2 chromatid cohesion f yes no 0.524 0.480 0.201 0.0002
Q16NZ8620 MAU2 chromatid cohesion f N/A no 0.499 0.445 0.196 0.0003
A7SUU7611 MAU2 chromatid cohesion f N/A no 0.491 0.445 0.202 0.0003
>sp|Q9Y6X3|SCC4_HUMAN MAU2 chromatid cohesion factor homolog OS=Homo sapiens GN=MAU2 PE=1 SV=2 Back     alignment and function desciption
 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 75/343 (21%), Positives = 144/343 (41%), Gaps = 32/343 (9%)

Query: 154 DKLVLAPSPMD-GEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKL 212
           D  +L  +P D   WLPK  +  LV L+ V+     G  ++  +     +  ++    KL
Sbjct: 268 DDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLE----KL 323

Query: 213 GITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRF 272
            + D         S I ++   ++LL    E+ +   L       A + + Q+     + 
Sbjct: 324 KMLDC--------SPI-LSSFQVILL----EHIIMCRLVTGHKATALQEISQVCQLCQQS 370

Query: 273 PTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIG 332
           P +     + +  L G Y  SV C   A   +  A ++T  + + A      A  Y   G
Sbjct: 371 PRLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQELWAFIVTNLASVYIREG 430

Query: 333 D--AESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQI 390
           +   E     ++ I P +    + + +R  A+  +  GL    Q  + EA+  L + L++
Sbjct: 431 NRHQEVLYSLLERINPDHSFPVSSHCLR--AAAFYVRGLFSFFQGRYNEAKRFLRETLKM 488

Query: 391 AHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTA 450
           ++    N +L +  L +LG++   L +  ++  ++  ++ LA K+ D+  Q+W+ ++L  
Sbjct: 489 SNAEDLN-RLTACSLVLLGHIFYVLGNHRESNNMVVPAMQLASKIPDMSVQLWSSALLRD 547

Query: 451 LYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELIS 493
           L +     GN M+  E  +   +  Q+ L D      HIE  S
Sbjct: 548 LNKAC---GNAMDAHEAAQMHQNFSQQLLQD------HIEACS 581
Required for association of the cohesin complex with chromatin during interphase. Plays a role in sister chromatid cohesion and normal progression through prometaphase.
Homo sapiens (taxid: 9606)
>sp|Q9D2X5|SCC4_MOUSE MAU2 chromatid cohesion factor homolog OS=Mus musculus GN=Mau2 PE=2 SV=3 Back     alignment and function description
>sp|B4ZIX8|SCC4_XENLA MAU2 chromatid cohesion factor homolog OS=Xenopus laevis GN=mau2 PE=1 SV=1 Back     alignment and function description
>sp|B1H1Z8|SCC4_XENTR MAU2 chromatid cohesion factor homolog OS=Xenopus tropicalis GN=mau2 PE=2 SV=1 Back     alignment and function description
>sp|Q16NZ8|SCC4_AEDAE MAU2 chromatid cohesion factor homolog OS=Aedes aegypti GN=AAEL011819 PE=3 SV=1 Back     alignment and function description
>sp|A7SUU7|SCC4_NEMVE MAU2 chromatid cohesion factor homolog OS=Nematostella vectensis GN=v1g174619 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query553
297745732 722 unnamed protein product [Vitis vinifera] 1.0 0.765 0.777 0.0
225434291 755 PREDICTED: MAU2 chromatid cohesion facto 1.0 0.732 0.777 0.0
255584396563 conserved hypothetical protein [Ricinus 1.0 0.982 0.761 0.0
356500968 722 PREDICTED: uncharacterized protein LOC10 1.0 0.765 0.739 0.0
224145389532 predicted protein [Populus trichocarpa] 0.931 0.968 0.787 0.0
449456905 718 PREDICTED: uncharacterized protein LOC10 0.992 0.764 0.741 0.0
356553202 722 PREDICTED: uncharacterized protein LOC10 1.0 0.765 0.739 0.0
357491593 728 Cohesin loading complex subunit SCC4-lik 0.998 0.758 0.696 0.0
297792441 725 binding protein [Arabidopsis lyrata subs 0.998 0.761 0.682 0.0
15242058 726 cohesin-load domain-containing protein [ 0.998 0.760 0.683 0.0
>gi|297745732|emb|CBI15788.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/553 (77%), Positives = 489/553 (88%)

Query: 1   MFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLR 60
           MFFAT+ILHVHLMQWDD N V R++N+C+ VW+SI+P++R Q LGLLFYNELLHIFYRLR
Sbjct: 170 MFFATSILHVHLMQWDDVNLVERAVNKCNEVWDSIEPDKRQQSLGLLFYNELLHIFYRLR 229

Query: 61  ICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQA 120
           ICDYKNAA HVD LDAAMKAD Q+MQ IQ+L+ ELDALNQSLSR DL   +RSAL+ +QA
Sbjct: 230 ICDYKNAAQHVDKLDAAMKADLQQMQHIQELTKELDALNQSLSRHDLHYTDRSALSEKQA 289

Query: 121 KLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLM 180
           ++Q++LR +     +GKE LE +YFGN ++AWGDKL LAP P+DGEWLPKSAVY L+DLM
Sbjct: 290 QVQEQLRRVTRLGSSGKESLESAYFGNVKRAWGDKLDLAPPPIDGEWLPKSAVYGLIDLM 349

Query: 181 VVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQ 240
           VVI GRPKG FKEC +RIQSG++TIQ+ L+KLGI+D VREVDLQHSAIWMAGVYLMLLMQ
Sbjct: 350 VVIFGRPKGNFKECGKRIQSGLRTIQEELMKLGISDSVREVDLQHSAIWMAGVYLMLLMQ 409

Query: 241 FLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEA 300
           FLENKVAVELTRS FVEAQEALVQM+NWF+RFPTILQACES+IEMLRGQYAHSVGC+SEA
Sbjct: 410 FLENKVAVELTRSEFVEAQEALVQMRNWFLRFPTILQACESIIEMLRGQYAHSVGCFSEA 469

Query: 301 AFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREE 360
           AFH++EAAK+TESKSMQAMC  YAAVSY CIGDAESSSQA DLIGPVY+M D+  GVRE+
Sbjct: 470 AFHFIEAAKLTESKSMQAMCQVYAAVSYICIGDAESSSQAFDLIGPVYRMMDSFVGVREK 529

Query: 361 ASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQ 420
            S+ FAYGLLLM+Q + QEAR RLA GLQI HNH+GNLQLVSQYLTILG+LALALHDT Q
Sbjct: 530 TSVLFAYGLLLMKQHNLQEARIRLATGLQITHNHLGNLQLVSQYLTILGSLALALHDTGQ 589

Query: 421 AREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLA 480
           AREILRSSLTLAKKL DIPTQIW LSVLTALYQ+LG+RGNEMEN EY+R+K D+LQKRL 
Sbjct: 590 AREILRSSLTLAKKLCDIPTQIWVLSVLTALYQELGERGNEMENSEYQRRKADDLQKRLV 649

Query: 481 DAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRL 540
           DA+SSIHHIELI KV+LEV+Q HELDIKRA+A  SM V+LDIPES+GL TP P  SSSRL
Sbjct: 650 DAHSSIHHIELIEKVRLEVRQLHELDIKRAVAGSSMRVSLDIPESVGLLTPSPAPSSSRL 709

Query: 541 IDLDGGRRGKRKI 553
           +DLD GRRGKRKI
Sbjct: 710 VDLDTGRRGKRKI 722

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225434291|ref|XP_002275860.1| PREDICTED: MAU2 chromatid cohesion factor homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|255584396|ref|XP_002532931.1| conserved hypothetical protein [Ricinus communis] gi|223527307|gb|EEF29458.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356500968|ref|XP_003519302.1| PREDICTED: uncharacterized protein LOC100777199 [Glycine max] Back     alignment and taxonomy information
>gi|224145389|ref|XP_002325624.1| predicted protein [Populus trichocarpa] gi|222862499|gb|EEF00006.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449456905|ref|XP_004146189.1| PREDICTED: uncharacterized protein LOC101207429 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356553202|ref|XP_003544947.1| PREDICTED: uncharacterized protein LOC100780498 [Glycine max] Back     alignment and taxonomy information
>gi|357491593|ref|XP_003616084.1| Cohesin loading complex subunit SCC4-like protein [Medicago truncatula] gi|355517419|gb|AES99042.1| Cohesin loading complex subunit SCC4-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297792441|ref|XP_002864105.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297309940|gb|EFH40364.1| binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15242058|ref|NP_199947.1| cohesin-load domain-containing protein [Arabidopsis thaliana] gi|9759280|dbj|BAB09745.1| unnamed protein product [Arabidopsis thaliana] gi|332008685|gb|AED96068.1| cohesin-load domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query553
TAIR|locus:2163655726 AT5G51340 "AT5G51340" [Arabido 0.998 0.760 0.683 5.4e-205
UNIPROTKB|B7Q4I8579 IscW_ISCW010639 "Putative unch 0.479 0.457 0.216 3.1e-07
UNIPROTKB|B3M1B7639 GF17837 "MAU2 chromatid cohesi 0.455 0.394 0.205 7.1e-07
UNIPROTKB|B4PS83632 GE24275 "MAU2 chromatid cohesi 0.390 0.341 0.209 1.9e-06
UNIPROTKB|Q4S3B6589 GSTENG00024719001 "Chromosome 0.598 0.561 0.223 3.6e-06
FB|FBgn0038300632 CG4203 [Drosophila melanogaste 0.390 0.341 0.204 5.1e-06
UNIPROTKB|B3P0R4632 GG16893 "MAU2 chromatid cohesi 0.390 0.341 0.204 5.1e-06
UNIPROTKB|B4HE12632 GM24202 "MAU2 chromatid cohesi 0.390 0.341 0.204 5.1e-06
UNIPROTKB|B4QZ45632 GD18992 "MAU2 chromatid cohesi 0.390 0.341 0.204 5.1e-06
UNIPROTKB|B4NKT1663 GK13302 "MAU2 chromatid cohesi 0.390 0.325 0.209 7.1e-06
TAIR|locus:2163655 AT5G51340 "AT5G51340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1983 (703.1 bits), Expect = 5.4e-205, P = 5.4e-205
 Identities = 380/556 (68%), Positives = 463/556 (83%)

Query:     1 MFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLR 60
             MFF  ++LHVH+MQW D+ SV +++ +CD +W++I  ++  +C GL FYNE+LH+FYRLR
Sbjct:   172 MFFTASMLHVHIMQWTDDYSVEKAVQRCDEIWQTISSDKTDRCPGLFFYNEMLHVFYRLR 231

Query:    61 ICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQA 120
             +CDYKNA HHVD LD AM A   KMQEIQQL  EL +LN SLSR DLPSRERSAL+ RQ+
Sbjct:   232 LCDYKNAQHHVDRLDQAMNAHSHKMQEIQQLLDELSSLNLSLSRYDLPSRERSALSARQS 291

Query:   121 KLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLM 180
             +LQ R+ +L  SS T    LEP+YFGN  + W +KL+L+PSP+DGEWLPKSA+ ALV LM
Sbjct:   292 QLQDRVNALSPSSSTVNS-LEPAYFGNIDRGWTEKLLLSPSPIDGEWLPKSAIDALVHLM 350

Query:   181 VVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQ 240
             VVI GRPKGLFKEC +RI+SG+Q IQD L+KLGITD VRE DL+H+AIWM+ V+LML MQ
Sbjct:   351 VVISGRPKGLFKECSKRIESGLQIIQDELIKLGITDEVREADLRHTAIWMSRVFLMLQMQ 410

Query:   241 FLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEA 300
             FLEN+VA+ELTRS +VEA+EALV MKNWF RFPTILQA E MIEMLRGQY+HSVGCYSEA
Sbjct:   411 FLENRVALELTRSDYVEAEEALVDMKNWFTRFPTILQASECMIEMLRGQYSHSVGCYSEA 470

Query:   301 AFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREE 360
             AFH +EA K+TES SMQA C A+AAVSY  IGDAESSS+A+DLIGP+  M ++++GVREE
Sbjct:   471 AFHCIEATKLTESISMQASCQAFAAVSYLTIGDAESSSKALDLIGPLNGMTNSLSGVREE 530

Query:   361 ASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQ 420
             AS+ FAYGLLLM+Q+D QEARNRLAKGLQIAHNHMGNLQLV+QYLT+LGNLAL+LHDTVQ
Sbjct:   531 ASILFAYGLLLMKQRDLQEARNRLAKGLQIAHNHMGNLQLVAQYLTLLGNLALSLHDTVQ 590

Query:   421 AREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLA 480
             AREILRSSLTLAKKLYDIPTQ+W LS+ TALYQQLG++GNEMEN+E+R+KK DELQ RLA
Sbjct:   591 AREILRSSLTLAKKLYDIPTQLWVLSIFTALYQQLGEKGNEMENEEFRKKKWDELQSRLA 650

Query:   481 DAYSSIHHIELISKVKLEVQQFHELDIKRAM--ANQSMSVNLDIPESIGLSTPLPVQSSS 538
             +A  SIHHIEL++K ++E+ Q      ++++  + QSM  NLDIPES+G+  P P  SSS
Sbjct:   651 EARGSIHHIELVAKARIELYQIDNNPQEQSLVASAQSMQGNLDIPESVGIEGPSPAPSSS 710

Query:   539 RLIDLDGGRR-GKRKI 553
             RL+ LD G+R GKR++
Sbjct:   711 RLVGLDTGKRWGKRRM 726
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006487 "protein N-linked glycosylation" evidence=RCA
UNIPROTKB|B7Q4I8 IscW_ISCW010639 "Putative uncharacterized protein" [Ixodes scapularis (taxid:6945)] Back     alignment and assigned GO terms
UNIPROTKB|B3M1B7 GF17837 "MAU2 chromatid cohesion factor homolog" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
UNIPROTKB|B4PS83 GE24275 "MAU2 chromatid cohesion factor homolog" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|Q4S3B6 GSTENG00024719001 "Chromosome 1 SCAF14751, whole genome shotgun sequence" [Tetraodon nigroviridis (taxid:99883)] Back     alignment and assigned GO terms
FB|FBgn0038300 CG4203 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B3P0R4 GG16893 "MAU2 chromatid cohesion factor homolog" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|B4HE12 GM24202 "MAU2 chromatid cohesion factor homolog" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4QZ45 GD18992 "MAU2 chromatid cohesion factor homolog" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|B4NKT1 GK13302 "MAU2 chromatid cohesion factor homolog" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query553
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-05
pfam10345592 pfam10345, Cohesin_load, Cohesin loading factor 6e-05
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information 
 Score = 42.0 bits (99), Expect = 3e-05
 Identities = 23/77 (29%), Positives = 35/77 (45%)

Query: 358 REEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHD 417
            + A+      L+L R  D+ EA   L K L++A     +    ++ L  L  L LAL D
Sbjct: 2   PDLAAALNNLALVLRRLGDYDEALELLEKALELARELGEDHPETARALNNLARLYLALGD 61

Query: 418 TVQAREILRSSLTLAKK 434
             +A E L  +L L + 
Sbjct: 62  YDEALEYLEKALALREA 78

Length = 78
>gnl|CDD|220706 pfam10345, Cohesin_load, Cohesin loading factor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 553
KOG2300629 consensus Uncharacterized conserved protein [Funct 100.0
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 99.95
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.85
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.8
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.76
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.76
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.74
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.63
PRK04841903 transcriptional regulator MalT; Provisional 99.62
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.59
PRK11788389 tetratricopeptide repeat protein; Provisional 99.54
PRK04841 903 transcriptional regulator MalT; Provisional 99.5
KOG1941 518 consensus Acetylcholine receptor-associated protei 99.49
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.48
PRK11788389 tetratricopeptide repeat protein; Provisional 99.47
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.46
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.42
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.35
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.35
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.33
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.31
KOG1941518 consensus Acetylcholine receptor-associated protei 99.3
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.26
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.23
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.2
PRK12370553 invasion protein regulator; Provisional 99.19
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.16
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.13
PRK12370553 invasion protein regulator; Provisional 99.12
PRK11189296 lipoprotein NlpI; Provisional 99.08
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.08
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.07
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.03
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.01
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.0
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.0
KOG1126638 consensus DNA-binding cell division cycle control 98.98
PRK11189296 lipoprotein NlpI; Provisional 98.95
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.94
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.92
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.88
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.87
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.83
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.82
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.82
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.81
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.77
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.74
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.73
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.72
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.72
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.69
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.62
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.59
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.57
KOG1126638 consensus DNA-binding cell division cycle control 98.54
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.51
PRK10370198 formate-dependent nitrite reductase complex subuni 98.5
KOG1129478 consensus TPR repeat-containing protein [General f 98.49
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.49
KOG2003840 consensus TPR repeat-containing protein [General f 98.48
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.42
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.38
KOG1129478 consensus TPR repeat-containing protein [General f 98.37
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.36
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.34
PLN03218 1060 maturation of RBCL 1; Provisional 98.32
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.32
PLN03218 1060 maturation of RBCL 1; Provisional 98.3
PRK15359144 type III secretion system chaperone protein SscB; 98.27
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.26
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.26
KOG0547606 consensus Translocase of outer mitochondrial membr 98.26
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.25
PRK10370198 formate-dependent nitrite reductase complex subuni 98.24
KOG2003 840 consensus TPR repeat-containing protein [General f 98.24
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.23
PRK15359144 type III secretion system chaperone protein SscB; 98.18
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.17
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.11
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.09
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.09
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 98.09
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.04
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.03
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.02
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.02
PF1286294 Apc5: Anaphase-promoting complex subunit 5 98.01
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.97
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.96
PF12688120 TPR_5: Tetratrico peptide repeat 97.92
KOG2076 895 consensus RNA polymerase III transcription factor 97.91
PRK14574 822 hmsH outer membrane protein; Provisional 97.91
PRK14574 822 hmsH outer membrane protein; Provisional 97.89
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.87
KOG1125579 consensus TPR repeat-containing protein [General f 97.84
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.82
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.8
PLN03077 857 Protein ECB2; Provisional 97.79
PF12688120 TPR_5: Tetratrico peptide repeat 97.77
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.77
KOG0547606 consensus Translocase of outer mitochondrial membr 97.76
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.76
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.75
KOG1125579 consensus TPR repeat-containing protein [General f 97.74
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.74
PLN03077 857 Protein ECB2; Provisional 97.74
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.73
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.71
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.71
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.68
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.67
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.67
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 97.64
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.61
KOG2076 895 consensus RNA polymerase III transcription factor 97.6
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.59
KOG1586288 consensus Protein required for fusion of vesicles 97.59
KOG1128777 consensus Uncharacterized conserved protein, conta 97.58
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.56
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.56
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.53
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.51
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.48
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.47
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.45
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.45
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.44
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.39
PLN02789320 farnesyltranstransferase 97.36
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.36
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.33
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 97.3
KOG4555175 consensus TPR repeat-containing protein [Function 97.27
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.25
KOG1585308 consensus Protein required for fusion of vesicles 97.22
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.22
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.21
PRK10803263 tol-pal system protein YbgF; Provisional 97.2
KOG4555175 consensus TPR repeat-containing protein [Function 97.2
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.19
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.13
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.07
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.03
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.02
COG4700251 Uncharacterized protein conserved in bacteria cont 96.96
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.96
KOG1586288 consensus Protein required for fusion of vesicles 96.96
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.89
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.89
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.89
KOG2376652 consensus Signal recognition particle, subunit Srp 96.88
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.85
KOG2471696 consensus TPR repeat-containing protein [General f 96.83
KOG0553304 consensus TPR repeat-containing protein [General f 96.8
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.75
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.73
KOG0553304 consensus TPR repeat-containing protein [General f 96.72
KOG0495913 consensus HAT repeat protein [RNA processing and m 96.71
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.71
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 96.7
KOG1585308 consensus Protein required for fusion of vesicles 96.68
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.67
KOG0495913 consensus HAT repeat protein [RNA processing and m 96.65
PLN02789320 farnesyltranstransferase 96.64
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.63
PRK10803263 tol-pal system protein YbgF; Provisional 96.58
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.56
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 96.54
PRK15331165 chaperone protein SicA; Provisional 96.5
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.5
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.47
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.39
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.39
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.32
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.31
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.29
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.25
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.25
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.22
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.21
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.2
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.07
PF1337173 TPR_9: Tetratricopeptide repeat 96.01
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.98
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.88
PRK11906458 transcriptional regulator; Provisional 95.88
PF1337173 TPR_9: Tetratricopeptide repeat 95.86
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.82
KOG3060289 consensus Uncharacterized conserved protein [Funct 95.76
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.73
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 95.73
PRK15331165 chaperone protein SicA; Provisional 95.7
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.54
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 95.51
KOG2047 835 consensus mRNA splicing factor [RNA processing and 95.5
KOG3616 1636 consensus Selective LIM binding factor [Transcript 95.44
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.42
KOG2471 696 consensus TPR repeat-containing protein [General f 95.36
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.33
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.3
COG4700251 Uncharacterized protein conserved in bacteria cont 95.26
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.1
PRK11906458 transcriptional regulator; Provisional 95.09
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.02
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 94.87
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.77
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.72
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.66
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.64
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.51
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.43
COG4235287 Cytochrome c biogenesis factor [Posttranslational 94.34
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 94.29
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.23
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 94.21
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.19
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.07
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.05
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.85
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 93.61
PF03704146 BTAD: Bacterial transcriptional activator domain; 93.59
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 93.55
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.39
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 92.96
KOG4234271 consensus TPR repeat-containing protein [General f 92.54
KOG3616 1636 consensus Selective LIM binding factor [Transcript 92.52
KOG3785 557 consensus Uncharacterized conserved protein [Funct 92.41
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 92.35
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 91.59
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 91.47
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 91.44
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 91.42
KOG4340 459 consensus Uncharacterized conserved protein [Funct 91.35
PF13512142 TPR_18: Tetratricopeptide repeat 91.32
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 91.1
KOG3783546 consensus Uncharacterized conserved protein [Funct 91.06
PF1342844 TPR_14: Tetratricopeptide repeat 91.03
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 90.3
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 90.12
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 90.06
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.04
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 89.94
KOG3785 557 consensus Uncharacterized conserved protein [Funct 89.8
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 89.72
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 89.29
PF13512142 TPR_18: Tetratricopeptide repeat 89.17
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.75
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.46
COG4649221 Uncharacterized protein conserved in bacteria [Fun 88.3
KOG4648536 consensus Uncharacterized conserved protein, conta 88.09
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 87.46
COG3898531 Uncharacterized membrane-bound protein [Function u 87.43
PF1342844 TPR_14: Tetratricopeptide repeat 87.32
KOG4648 536 consensus Uncharacterized conserved protein, conta 87.31
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 87.21
KOG1915677 consensus Cell cycle control protein (crooked neck 87.14
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 86.61
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 86.32
PF06552186 TOM20_plant: Plant specific mitochondrial import r 86.14
COG5159421 RPN6 26S proteasome regulatory complex component [ 85.79
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 85.56
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 85.23
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 85.13
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 84.73
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 84.67
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 84.04
KOG2796366 consensus Uncharacterized conserved protein [Funct 83.77
KOG4234271 consensus TPR repeat-containing protein [General f 83.75
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 83.39
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 82.62
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 82.59
COG3118304 Thioredoxin domain-containing protein [Posttransla 82.0
KOG1550552 consensus Extracellular protein SEL-1 and related 81.49
KOG4507886 consensus Uncharacterized conserved protein, conta 81.36
COG4105254 ComL DNA uptake lipoprotein [General function pred 80.86
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 80.49
KOG1463411 consensus 26S proteasome regulatory complex, subun 80.25
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=3.9e-75  Score=610.61  Aligned_cols=455  Identities=38%  Similarity=0.603  Sum_probs=419.9

Q ss_pred             CchhhhhHHhhhhccCCchHHHHHHHHhhHHhhhcCcccccccchHHHHHHHHHHHHHHHhccccchhhhhhhHHHHHHH
Q 008796            1 MFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKA   80 (553)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~ld~~~~~   80 (553)
                      |||..|++|+|+|+| |.+.|++.+++|+++|+.+.+|+.+        ||.||+||                       
T Consensus       167 ~~ftls~~~ll~me~-d~~dV~~ll~~~~qi~~n~~sdk~~--------~E~LkvFy-----------------------  214 (629)
T KOG2300|consen  167 MLFTLSMLMLLIMER-DDYDVEKLLQRCGQIWQNISSDKTQ--------KEMLKVFY-----------------------  214 (629)
T ss_pred             HHHHHHHHHHHHhCc-cHHHHHHHHHHHHHHHhccCCChHH--------HHHHHHHH-----------------------
Confidence            689999999999999 8899999999999999999999987        99999999                       


Q ss_pred             HHHHhHHHHHHHHHHHHHHhhcCCCCCChhhhhhhhhhHHHHHHHHHhcccCCCccccccccccccccccccccccccCC
Q 008796           81 DKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAP  160 (553)
Q Consensus        81 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (553)
                                       |+.+|+...++.|.|+.....+ |||+.+.+++.+|                ++|++|+...|
T Consensus       215 -----------------l~lql~yy~~~gq~rt~k~~lk-QLQ~siqtist~~----------------~~h~e~ilgsp  260 (629)
T KOG2300|consen  215 -----------------LVLQLSYYLLPGQVRTVKPALK-QLQDSIQTISTSS----------------RGHDEKILGSP  260 (629)
T ss_pred             -----------------HHHHHHHHhcccchhhhHHHHH-HHHHHHhccCCCC----------------CCccccccCCC
Confidence                             8889999999999999999988 9999999966655                57999999999


Q ss_pred             CCCCccccchhhHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHcCCCCCcccccchhhHHHHHHHHHHHHHH
Q 008796          161 SPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQ  240 (553)
Q Consensus       161 ~~~~~~WLp~~~~~~Lv~l~tv~~~~~~G~~dka~ky~ekAL~~~~~~l~klG~~~~~~e~~l~~~~~~~a~vy~~L~a~  240 (553)
                      +|+.|+|||||++|||||++||+++|+.|+|++|.||.++++..    .+|++..++            +.+|++|++++
T Consensus       261 s~~l~~wlpkeqicaLV~l~tv~hsm~~gy~~~~~K~tDe~i~q----~eklkq~d~------------~srilsm~km~  324 (629)
T KOG2300|consen  261 SPILFEWLPKEQICALVYLVTVIHSMPAGYFKKAQKYTDEAIKQ----TEKLKQADL------------MSRILSMFKMI  324 (629)
T ss_pred             ChHHHhhccHhhhHhhhhhhHHhhhhhhHHHHHHHHHHHHHHHH----Hhhcccccc------------hhHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999    788776665            56899999999


Q ss_pred             HHHHHHHHHHhhCCHHHHHHHHHHHHHHHHHCCc--hhhhhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHccchhhHH
Q 008796          241 FLENKVAVELTRSGFVEAQEALVQMKNWFIRFPT--ILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQA  318 (553)
Q Consensus       241 lLenLg~~~l~~Gr~aeAl~~l~qAL~L~r~~~d--l~~~~~A~~~~lLG~~~~alG~yeeAl~~f~~AL~l~~d~~g~A  318 (553)
                      +||++++|++.+|++.+|++.+.++++||.++|.  +++..++++|+++|+|+++.|+|++|+.||..|.+.+.....+|
T Consensus       325 ~LE~iv~c~lv~~~~~~al~~i~dm~~w~~r~p~~~Llr~~~~~ih~LlGlys~sv~~~enAe~hf~~a~k~t~~~dl~a  404 (629)
T KOG2300|consen  325 LLEHIVMCRLVRGDYVEALEEIVDMKNWCTRFPTPLLLRAHEAQIHMLLGLYSHSVNCYENAEFHFIEATKLTESIDLQA  404 (629)
T ss_pred             HHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhCCchHHHHHhHHHHHHHHhhHhhhcchHHHHHHHHHHHHHhhhHHHHHH
Confidence            9999999999999999999999999999999999  99999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhCChHHHHHHHHhhcccccccccccchhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhccCh
Q 008796          319 MCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNL  398 (553)
Q Consensus       319 ~aL~NLA~vyl~~Gd~e~~~qAL~L~r~lgd~~g~~~~lr~eA~aL~~LG~~~~~qGr~~EA~~~L~eAL~Lar~elGdr  398 (553)
                      +|..|+|++|++.|+.+.+.++|+.+.+......+  +.+.+|.++++.|+..+.+|+++||+++++++|++++. .+.-
T Consensus       405 ~~nlnlAi~YL~~~~~ed~y~~ld~i~p~nt~s~s--sq~l~a~~~~v~glfaf~qn~lnEaK~~l~e~Lkmana-ed~~  481 (629)
T KOG2300|consen  405 FCNLNLAISYLRIGDAEDLYKALDLIGPLNTNSLS--SQRLEASILYVYGLFAFKQNDLNEAKRFLRETLKMANA-EDLN  481 (629)
T ss_pred             HHHHhHHHHHHHhccHHHHHHHHHhcCCCCCCcch--HHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHhhcch-hhHH
Confidence            99999999999999999999999999998543333  33459999999999999999999999999999999974 5666


Q ss_pred             HhHHHHHHHHHHHHHHCCChHHHHHHHHHHHHHHHHhCChHHHHHHHHHHHHHHHHcCC--chHHHHHHHHHHHHHHHHh
Q 008796          399 QLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGD--RGNEMENDEYRRKKLDELQ  476 (553)
Q Consensus       399 ~leA~aL~~LG~i~lalGd~~eA~~~l~~AL~LArklgD~~~qa~aL~~Lg~ly~alGd--~~~A~e~~e~a~~~~d~L~  476 (553)
                      +++|+.|..||.+++..||+.++++++++|+++|+|++|.+.|.|++..+.++|.++|+  ...+.+.++.+...++.+.
T Consensus       482 rL~a~~LvLLs~v~lslgn~~es~nmvrpamqlAkKi~Di~vqLws~si~~~L~~a~g~~~~~~e~e~~~~~ql~Sr~ll  561 (629)
T KOG2300|consen  482 RLTACSLVLLSHVFLSLGNTVESRNMVRPAMQLAKKIPDIPVQLWSSSILTDLYQALGEKGNEMENEAFRKHQLQSRLLL  561 (629)
T ss_pred             HHHHHHHHHHHHHHHHhcchHHHHhccchHHHHHhcCCCchHHHHHHHHHHHHHHHhCcchhhHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999  6777888888777777777


Q ss_pred             hHH---HHhhcchhhHHHHhhhcchhhccchhhHHHhhhcccccccccCCcccCCCCCCCCcccccccccCC-CCcccc
Q 008796          477 KRL---ADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDG-GRRGKR  551 (553)
Q Consensus       477 ~~~---~~A~~~~~h~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~  551 (553)
                      .+.   -.+..+|+|+ |+.|....      ++   ...+|+|+.|||||| +||.+|.|+|||+|+|.+|+ +|||||
T Consensus       562 a~~~i~~~~~~~pa~~-ll~wfdgd------Pp---v~s~p~~~~~l~~pe-t~l~~~~p~~~ss~~~~~~~g~~~~~~  629 (629)
T KOG2300|consen  562 ADGSIHHIELVAPAHI-LLYWFDGD------PP---VASAPSMQGNLDIPE-TSLEGPSPAPSSSRLVGLDTGKRWGKR  629 (629)
T ss_pred             hccCcchHhhcccHHh-hhhhccCC------Cc---cccCCccCCccCCCc-ccccCCCCCccccccccCcccccccCC
Confidence            777   7777888888 68885543      22   446899999999999 99999999999999999999 788886

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query553
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-09
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 8e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 5e-09
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-08
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 9e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-07
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-05
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 5e-05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 6e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 68.3 bits (166), Expect = 4e-12
 Identities = 78/525 (14%), Positives = 156/525 (29%), Gaps = 170/525 (32%)

Query: 69  HHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRS 128
           HH  ++D      + + ++I  LS   DA   +    D+    +S L             
Sbjct: 2   HHHHHMDFETGEHQYQYKDI--LSVFEDAFVDNFDCKDVQDMPKSIL------------- 46

Query: 129 LEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGE----WL----PKSAVYALVD-- 178
                 + +E               D ++++   + G     W      +  V   V+  
Sbjct: 47  ------SKEEI--------------DHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEV 86

Query: 179 -------LMVVILGRPKG------LFKECMQRIQSGMQ--------------TIQDALLK 211
                  LM  I    +       ++ E   R+ +  Q               ++ ALL+
Sbjct: 87  LRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLE 146

Query: 212 LGITDGVREVDLQHSAIWMAGVYLMLLMQFLENK--VAVELTRSGFVEAQEALVQMKN-- 267
           L     V    L      + G            K  VA+++  S  V+ +     M    
Sbjct: 147 LRPAKNV----LIDG---VLGS----------GKTWVALDVCLSYKVQCK-----MDFKI 184

Query: 268 -WFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHY------VEAAKITESKSMQAMC 320
            W +         E+++EML+         ++  + H       + + +    + +++  
Sbjct: 185 FW-LNLKNCNSP-ETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKP 242

Query: 321 HAYA-----------AVSYFCIG--------DAESSSQAIDLIGPVYQMKDTINGVREEA 361
           +              A + F +           + +            +      +  + 
Sbjct: 243 YENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDE 302

Query: 362 SLHFAYGLLL----MRQQDF-QEAR--NRLAKGLQIAHNHMGNLQLVSQYLTILGNLALA 414
                  LLL     R QD  +E    N     + IA       + +   L    N    
Sbjct: 303 VK----SLLLKYLDCRPQDLPREVLTTNPRRLSI-IA-------ESIRDGLATWDNWKHV 350

Query: 415 LHDTVQAREILRSSL-----TLAKKLY----------DIPTQIWALSVLTALYQQLGDRG 459
             D +    I+ SSL        +K++           IPT      +L+ ++  +    
Sbjct: 351 NCDKLT--TIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTI-----LLSLIWFDVIKSD 403

Query: 460 NEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLE-VQQFH 503
             +  ++  +  L  ++K+  ++  SI  I L  KVKLE     H
Sbjct: 404 VMVVVNKLHKYSL--VEKQPKESTISIPSIYLELKVKLENEYALH 446
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query553
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.93
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.93
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.93
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.92
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.92
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.91
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.9
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.86
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.85
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.83
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.83
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.83
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.82
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.81
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.81
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.8
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.8
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.78
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.77
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.77
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.74
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.74
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.73
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.71
3u4t_A272 TPR repeat-containing protein; structural genomics 99.7
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.7
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.69
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.69
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.69
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.68
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.68
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.67
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.67
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.67
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.67
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.66
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.66
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.63
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.63
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.62
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.62
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.62
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.62
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.61
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.6
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.6
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.59
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.59
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.58
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.57
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.55
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.55
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.54
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.54
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.54
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.53
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.53
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.52
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.52
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.51
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.5
3u4t_A272 TPR repeat-containing protein; structural genomics 99.49
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.49
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.48
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.48
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.47
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.45
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.44
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.44
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.44
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.39
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.38
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.37
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.34
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.31
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.28
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.28
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.27
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.26
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.26
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.26
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.23
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.22
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.21
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.2
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.18
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.15
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.12
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.08
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.07
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.04
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.03
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.96
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.96
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.95
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.94
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.94
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.92
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.92
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.91
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.91
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.89
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.87
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.85
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.85
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.85
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.84
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.82
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.81
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.79
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.79
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.78
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.78
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.78
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.77
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.76
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.73
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.73
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.73
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.73
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.72
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.72
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.71
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.68
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.67
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.67
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.66
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.65
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.65
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.62
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.61
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.61
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.57
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.57
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.55
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.55
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.55
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.54
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.54
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.53
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.53
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.52
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.5
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.49
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.48
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.47
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.46
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.46
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.44
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.43
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.41
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.41
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.41
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.39
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.39
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.38
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.37
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.34
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.33
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.32
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.31
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.31
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.3
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.28
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.28
3k9i_A117 BH0479 protein; putative protein binding protein, 98.2
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.2
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.19
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.18
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.14
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.13
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.11
3k9i_A117 BH0479 protein; putative protein binding protein, 98.08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.03
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.99
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.89
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.88
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.81
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.81
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.71
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.66
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.63
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 97.52
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.47
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.46
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.45
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.29
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.28
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 97.11
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.06
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 96.8
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.77
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.74
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.7
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 96.68
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 96.61
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.54
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.48
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.26
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.2
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 96.19
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 95.92
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 95.87
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.71
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.68
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 95.43
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 95.4
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.81
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.74
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.05
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 93.35
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 93.3
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.98
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 92.95
1pc2_A152 Mitochondria fission protein; unknown function; NM 92.57
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 92.48
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 92.44
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 90.06
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.85
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 88.59
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.24
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 87.74
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 86.15
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 85.56
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 85.02
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 81.87
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
Probab=99.93  E-value=2.4e-23  Score=208.41  Aligned_cols=277  Identities=15%  Similarity=0.072  Sum_probs=246.1

Q ss_pred             HHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHcCCCCCcccccchhhHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 008796          173 VYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTR  252 (553)
Q Consensus       173 ~~~Lv~l~tv~~~~~~G~~dka~ky~ekAL~~~~~~l~klG~~~~~~e~~l~~~~~~~a~vy~~L~a~lLenLg~~~l~~  252 (553)
                      ..+.++...+.++...|++++|.+++++++..    .++.++.+.                    .+..+.++|.++..+
T Consensus        45 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~----~~~~~~~~~--------------------~~~~~~~la~~~~~~  100 (406)
T 3sf4_A           45 TLSAIYSQLGNAYFYLHDYAKALEYHHHDLTL----ARTIGDQLG--------------------EAKASGNLGNTLKVL  100 (406)
T ss_dssp             HHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH----HHHTTCHHH--------------------HHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHH----HHhccccHH--------------------HHHHHHHHHHHHHHc
Confidence            45567777788888999999999999999999    666554333                    456678999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCchhhhhHHHHHHHHHHHHHHcCC--------------------HHHHHHHHHHHHHHcc
Q 008796          253 SGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGC--------------------YSEAAFHYVEAAKITE  312 (553)
Q Consensus       253 Gr~aeAl~~l~qAL~L~r~~~dl~~~~~A~~~~lLG~~~~alG~--------------------yeeAl~~f~~AL~l~~  312 (553)
                      |++++|++.+.++++++...++.  ...+.++..+|.++...|+                    +++|..+|.+|+++..
T Consensus       101 g~~~~A~~~~~~al~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~a~~~~~~A~~~~~~al~~~~  178 (406)
T 3sf4_A          101 GNFDEAIVCCQRHLDISRELNDK--VGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQAAVDFYEENLSLVT  178 (406)
T ss_dssp             TCHHHHHHHHHHHHHHHHHHTCH--HHHHHHHHHHHHHHHHHHHTCC-------CCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHhcccc--cchHHHHHHHHHHHHHcCCcccccccchhhhhhhhHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999998884  5568899999999999999                    9999999999998764


Q ss_pred             c---hhhHHHHHHHHHHHHHHhCChHH----HHHHHHhhcccccccccccchhHHHHHHHHHHHHHHHcCCHHHHHHHHH
Q 008796          313 S---KSMQAMCHAYAAVSYFCIGDAES----SSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLA  385 (553)
Q Consensus       313 d---~~g~A~aL~NLA~vyl~~Gd~e~----~~qAL~L~r~lgd~~g~~~~lr~eA~aL~~LG~~~~~qGr~~EA~~~L~  385 (553)
                      .   ....+.++.++|.+|...|++++    +.+++.+....+       .....+.+++++|.++..+|++++|..++.
T Consensus       179 ~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~-------~~~~~~~~~~~la~~~~~~g~~~~A~~~~~  251 (406)
T 3sf4_A          179 ALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFG-------DKAAERRAYSNLGNAYIFLGEFETASEYYK  251 (406)
T ss_dssp             HTTCHHHHHHHHHHHHHHHHHHTBHHHHHHHHHHHHHHHHHTT-------CHHHHHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             hccCcHHHHHHHHHHHHHHHHccCHHHHHHHHHHHHHHHHhcC-------CcHHHHHHHHHHHHHHHHcCChHHHHHHHH
Confidence            3   56788999999999999999987    888888877763       334578899999999999999999999999


Q ss_pred             HHHHHHHHhccChHhHHHHHHHHHHHHHHCCChHHHHHHHHHHHHHHHHhCChHHHHHHHHHHHHHHHHcCCchHHHHHH
Q 008796          386 KGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMEND  465 (553)
Q Consensus       386 eAL~Lar~elGdr~leA~aL~~LG~i~lalGd~~eA~~~l~~AL~LArklgD~~~qa~aL~~Lg~ly~alGd~~~A~e~~  465 (553)
                      +++++.. ..++....+.++..+|.++...|++++|..++++|+.+..+.++......++..+|.+|...|++++|.+++
T Consensus       252 ~al~~~~-~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~  330 (406)
T 3sf4_A          252 KTLLLAR-QLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTALGNHDQAMHFA  330 (406)
T ss_dssp             HHHHHHH-HTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTCHHHHHHHH
T ss_pred             HHHHHHH-hCcCchHHHHHHHHHHHHHHHhCcHHHHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHcCCHHHHHHHH
Confidence            9999985 789999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhHHHHhh
Q 008796          466 EYRRKKLDELQKRLADAY  483 (553)
Q Consensus       466 e~a~~~~d~L~~~~~~A~  483 (553)
                      +.+.....+++.....+.
T Consensus       331 ~~al~~~~~~~~~~~~~~  348 (406)
T 3sf4_A          331 EKHLEISREVGDKSGELT  348 (406)
T ss_dssp             HHHHHHHHHTTCHHHHHH
T ss_pred             HHHHHHHHHhcCCcchhH
Confidence            999999988865554433
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 553
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.7 bits (86), Expect = 0.003
 Identities = 22/182 (12%), Positives = 52/182 (28%), Gaps = 25/182 (13%)

Query: 276 LQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAE 335
           L    +++        +  G    A   Y  A ++   +      +   A +    G   
Sbjct: 232 LSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL---QPHFPDAYCNLANALKEKGSVA 288

Query: 336 SSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHM 395
              +A D           +      A        +   Q + +EA     K L++     
Sbjct: 289 ---EAED------CYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF- 338

Query: 396 GNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQL 455
                 +   + L ++        +A    + ++ ++      PT   A S +    +++
Sbjct: 339 ------AAAHSNLASVLQQQGKLQEALMHYKEAIRIS------PTFADAYSNMGNTLKEM 386

Query: 456 GD 457
            D
Sbjct: 387 QD 388

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query553
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.83
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.77
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.62
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.6
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.58
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.54
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.5
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.45
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.23
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.21
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.11
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.09
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.08
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.0
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.91
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.9
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.83
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.66
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.66
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.63
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.58
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.58
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.54
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.54
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.51
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.49
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.46
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.46
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.45
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.43
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.43
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.41
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.39
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.36
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.34
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.31
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.27
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.19
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.16
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.08
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.02
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.93
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.9
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.76
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.41
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.33
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.24
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.21
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.65
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.05
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.57
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.22
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 91.0
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Transcription factor MalT domain III
domain: Transcription factor MalT domain III
species: Escherichia coli [TaxId: 562]

Probab=99.83  E-value=4.8e-18  Score=161.58  Aligned_cols=270  Identities=13%  Similarity=0.033  Sum_probs=231.3

Q ss_pred             HHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHcCCCCCcccccchhhHHHHHHHHHHHHHHHHHHHHHHHHhhC
Q 008796          174 YALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRS  253 (553)
Q Consensus       174 ~~Lv~l~tv~~~~~~G~~dka~ky~ekAL~~~~~~l~klG~~~~~~e~~l~~~~~~~a~vy~~L~a~lLenLg~~~l~~G  253 (553)
                      .+.++.+.+.++...|++++|.++++++++.    ..+.+....                    .+..+.+++.++...|
T Consensus        50 ~~~a~~~lg~~~~~~g~~~~A~~~~~~a~~~----~~~~~~~~~--------------------~~~~~~~~~~~~~~~~  105 (366)
T d1hz4a_          50 RIVATSVLGEVLHCKGELTRSLALMQQTEQM----ARQHDVWHY--------------------ALWSLIQQSEILFAQG  105 (366)
T ss_dssp             HHHHHHHHHHHHHHHTCHHHHHHHHHHHHHH----HHHTTCHHH--------------------HHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH----HHhhcchHH--------------------HHHHHHHHHHHHHHHH
Confidence            3456677788888999999999999999998    555443322                    4556778899999999


Q ss_pred             CHHHHHHHHHHHHHHHHHCCchhhhhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHccc--hhhHHHHHHHHHHHHHHh
Q 008796          254 GFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITES--KSMQAMCHAYAAVSYFCI  331 (553)
Q Consensus       254 r~aeAl~~l~qAL~L~r~~~dl~~~~~A~~~~lLG~~~~alG~yeeAl~~f~~AL~l~~d--~~g~A~aL~NLA~vyl~~  331 (553)
                      ++.+|...+.+++.++...+.......+.++..+|.++...|+++.|...+.+++.....  ....+.++.+.+.++...
T Consensus       106 ~~~~a~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  185 (366)
T d1hz4a_         106 FLQTAWETQEKAFQLINEQHLEQLPMHEFLVRIRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQLQCLAMLIQCSLAR  185 (366)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCTTSTHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTTTSCGGGGHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhHhcccchhhHHHHHHHHHHHHHHHhcchhhhHHHHHHHHHHhhhhhhhhHHHHHHHHHHHHHhh
Confidence            999999999999999999766445567788999999999999999999999999987765  345678889999999999


Q ss_pred             CChHH----HHHHHHhhcccccccccccchhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhccChHhHHHHHHH
Q 008796          332 GDAES----SSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTI  407 (553)
Q Consensus       332 Gd~e~----~~qAL~L~r~lgd~~g~~~~lr~eA~aL~~LG~~~~~qGr~~EA~~~L~eAL~Lar~elGdr~leA~aL~~  407 (553)
                      |++..    +.++..+.......      ....+.++...|.++...|++++|...+++++++.   .++.........+
T Consensus       186 ~~~~~a~~~~~~a~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~---~~~~~~~~~~~~~  256 (366)
T d1hz4a_         186 GDLDNARSQLNRLENLLGNGKYH------SDWISNANKVRVIYWQMTGDKAAAANWLRHTAKPE---FANNHFLQGQWRN  256 (366)
T ss_dssp             TCHHHHHHHHHHHHHHHTTSCCC------HHHHHHHHHHHHHHHHHTTCHHHHHHHHHHSCCCC---CTTCGGGHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHHHhccc------CchHHHHHHHHHHHHHhcccHHHHHHHHHHHHHhc---cccchHHHHHHHH
Confidence            99886    77788877776432      23367788999999999999999999999998874   3455667778899


Q ss_pred             HHHHHHHCCChHHHHHHHHHHHHHHHHhCChHHHHHHHHHHHHHHHHcCCchHHHHHHHHHHHHHHHHh
Q 008796          408 LGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQ  476 (553)
Q Consensus       408 LG~i~lalGd~~eA~~~l~~AL~LArklgD~~~qa~aL~~Lg~ly~alGd~~~A~e~~e~a~~~~d~L~  476 (553)
                      ||.++...|++.+|...+++++..+++.++.+....++..+|.+|...|++++|.+.++.+..+....+
T Consensus       257 la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~l~~Al~l~~~~~  325 (366)
T d1hz4a_         257 IARAQILLGEFEPAEIVLEELNENARSLRLMSDLNRNLLLLNQLYWQAGRKSDAQRVLLDALKLANRTG  325 (366)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHHHhhcccChHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHhhhcC
Confidence            999999999999999999999999999999999999999999999999999999999999999877654
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure