Citrus Sinensis ID: 008820

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550--
MILVMGRRVTKSVAKVGCVGSRICDKEVGLFLSDFLESNVFFSPEVLYELFKKEGIWVECEESEFSVGYGSDVWPVACILLSLLIGEQFTKELIDYIRCVSTKASDDNIACLGMYMAWMEKVTYLLENKFGSEFVSLQLMFCQCLNFDPGCRPLLTNVWKCIRELIIKPEFDKMIRFAGPVNLENENHCLVLGELSCLPKERLETEDKDELLGAENSDGADIDQARAAGGVKDLVNGLSKGNVKFKDLQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQPLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVCNGVLYSGSRDGTIRLWSLSDHSLLTVLEEDSSGAVSSVLSLTAVQHTLVVSHESGSIKVWRNDKFMKSMQTHKGSVFAVFLEGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQGKLFVGCADRTVKIALCNRQIPEIFSLLLHINL
cEEEccccEEEEEccccccccccccccccEEEEccccccEEccccEEEEEEEccccEEEEccccEEEEEcccccccEEEEEEEEEcccEEEEEEEEEEEEEccccccccEEEEEEcHHHHHHHHHHHHccccEEccccEEEEEEEEEccccccEEEEEcccEEEEEEcccccEEEcccccEEEEEcccEEEEEEccccccEEEccccccEEEEEEccccccEEEEEcccccccEEEEEccccEEEEEcccccccEEEEEEcccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEccccccEEEEEcccccEEEEEcccccccccEEccccccccEEEEEEEEcccccEEEEccccccEEEEEcccccEEEEcccccccEEEEEEcccEEEEEcccccEEEEEcccccEEEEcccccccEEEEEEEEcccccEEEEEEccccEEEEEcccccEEEEcccccEEEEEEcccEEEEEcccccEEEEEccccccccccccccccccccEEEEEEcccccEEEEEccccEEEEEccccccEEEcccccccc
cEEEEcccEEEEEEEcccccccccHcHcEEEEcccccccEEccHHHHHHHHHHcccEEcccccccEEEcccccEEEEEEccccccccccHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHEEccccccEEEEccccccEEEEEccccccccEEEEEEEccccccEEEEcccccEEEEEEccccEEEEEccccEEEcccccEEEEEccccEEEEEcccccEEEEEEcccccEEEEEccccEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEcccccccEEEEEEccccccEEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEEEcccccEEEEEccccEEEEEccccEEEEEccccccEEEEcccccEEEEEccccEEEEEEcccccHHHHHHHHcccccccEEEEEEcccccEEEEccccEEEEEEccccccEEEEEcccccc
milvmgrrVTKSVAKVgcvgsricdkeVGLFLsdflesnvffsPEVLYELFKKEgiwveceesefsvgygsdvwPVACILLSLLIGEQFTKELIDYIRCVstkasddnIACLGMYMAWMEKVTYLLENKFGSEFVSLQLMFCQclnfdpgcrplLTNVWKCIRELIIKpefdkmirfagpvnlenenhclvlgelsclpkerletedkdellgaensdgadidqaraaggvKDLVNglskgnvkfkdlqghrdcvtglavgggflfsssfdksihvwslkdfshvhtfkghdhKVMAVVYvdedqplcisgdsgggifvwsfsfplgheplkkwneekdwrysGIHALTTsgrylytgsgdrtIKAWSLLDgtlsctmsghksAVSTLAVCNGvlysgsrdgtirlWSLSDHSLLTVleedssgavSSVLSLTAVQHTLVVSHESGSIKVWRNDKFMKSMQTHKGSVFAVFLEgkwlftggwdktVSVQElagdefeedviptgaipcgSVITALLYWQGKLFVGCADRTVKIALCNRQIPEIFSLLLHINL
milvmgrrvtksvakvgcvgsriCDKEVGLFLSDFLESNVFFSPEVLYELFKKEGIWVECEESEFSVGYGSDVWPVACILLSLLIGEQFTKELIDYIRCVSTKASDDNIACLGMYMAWMEKVTYLLENKFGSEFVSLQLMFCQCLNFDPGCRPLLTNVWKCIRELIIKPEFDKMIRFAGPVNLENENHCLVLGELSCLPKERLETEDKDEllgaensdgadidQARAAGGVKDLVNGLSKGNVKFKDLQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQPLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVCNGVLYSGSRDGTIRLWSLSDHSLLTVLEEDSSGAVSSVLSLTAVQHTLvvshesgsikvWRNDKFMKSMQTHKGSVFAVFLEGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQGKLFVGCADRTVKIALCNRQIPEIFSLLLHINL
MILVMGRRVTKSVAKVGCVGSRICDKEVGLFLSDFLESNVFFSPEVLYELFKKEGIWVECEESEFSVGYGSDVWPVACILLSLLIGEQFTKELIDYIRCVSTKASDDNIACLGMYMAWMEKVTYLLENKFGSEFVSLQLMFCQCLNFDPGCRPLLTNVWKCIRELIIKPEFDKMIRFAGPVNLENENHCLVLGELSCLPKERLETEDKDELLGAENSDGADIDQARAAGGVKDLVNGLSKGNVKFKDLQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQPLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVCNGVLYSGSRDGTIRLWSLSDHSLLTVLEEDSSGAVSSVLSLTAVQHTLVVSHESGSIKVWRNDKFMKSMQTHKGSVFAVFLEGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQGKLFVGCADRTVKIALCNRQIPEIFSLLLHINL
**LVMGRRVTKSVAKVGCVGSRICDKEVGLFLSDFLESNVFFSPEVLYELFKKEGIWVECEESEFSVGYGSDVWPVACILLSLLIGEQFTKELIDYIRCVSTKASDDNIACLGMYMAWMEKVTYLLENKFGSEFVSLQLMFCQCLNFDPGCRPLLTNVWKCIRELIIKPEFDKMIRFAGPVNLENENHCLVLGELSCLP******************************GVKDLVNGLSKGNVKFKDLQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQPLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVCNGVLYSGSRDGTIRLWSLSDHSLLTVLEEDSSGAVSSVLSLTAVQHTLVVSHESGSIKVWRNDKFMKSMQTHKGSVFAVFLEGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQGKLFVGCADRTVKIALCNRQIPEIFSLLLHI**
*******RVT**************DKEVGLFLSDFLESNVFFSPEVLYELF***************VGYGSDVWPVACILLSLLIGEQFTKELIDYIRCVSTKASDDNIACLGMYMAWMEKVTYLLENKFGSEFVSLQLMFCQCLNFDPGCRPLLTNVWKCIRELIIKPEFDKMIRFAG*VNLENENHCLVLGELSCLPKERLETEDKDELLGAENSDGADIDQARAAGGVKDLVNGLSKGNVKFKDLQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQPLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVCNGVLYSGSRDGTIRLWSLSDHSLLTVLEEDSSGAVSSVLSLTAVQHTLVVSHESGSIKVWRNDKFMKSMQTHKGSVFAVFLEGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQGKLFVGCADRTVKIALCNRQIPEIFSLLL****
********VTKSVAKVGCVGSRICDKEVGLFLSDFLESNVFFSPEVLYELFKKEGIWVECEESEFSVGYGSDVWPVACILLSLLIGEQFTKELIDYIRCVSTKASDDNIACLGMYMAWMEKVTYLLENKFGSEFVSLQLMFCQCLNFDPGCRPLLTNVWKCIRELIIKPEFDKMIRFAGPVNLENENHCLVLGELSCLPKERLETEDKDELLGAENSDGADIDQARAAGGVKDLVNGLSKGNVKFKDLQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQPLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVCNGVLYSGSRDGTIRLWSLSDHSLLTVLEEDSSGAVSSVLSLTAVQHTLVVSHESGSIKVWRNDKFMKSMQTHKGSVFAVFLEGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQGKLFVGCADRTVKIALCNRQIPEIFSLLLHINL
MILVMGRRVTKSVAKVGCVGSRICDKEVGLFLSDFLESNVFFSPEVLYELFKKEGIWVECEESEFSVGYGSDVWPVACILLSLLIGEQFTKELIDYIRCVSTKASDDNIACLGMYMAWMEKVTYLLENKFGSEFVSLQLMFCQCLNFDPGCRPLLTNVWKCIRELIIKPEFDKMIRFAGPVNLENENHCLVLGELSCLPKERLETEDKDELLGAENSDGADIDQARAAGGVKDLVNGLSKGNVKFKDLQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQPLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVCNGVLYSGSRDGTIRLWSLSDHSLLTVLEEDSSGAVSSVLSLTAVQHTLVVSHESGSIKVWRNDKFMKSMQTHKGSVFAVFLEGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQGKLFVGCADRTVKIALCNRQIPEIFSLLL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILVMGRRVTKSVAKVGCVGSRICDKEVGLFLSDFLESNVFFSPEVLYELFKKEGIWVECEESEFSVGYGSDVWPVACILLSLLIGEQFTKELIDYIRCVSTKASDDNIACLGMYMAWMEKVTYLLENKFGSEFVSLQLMFCQCLNFDPGCRPLLTNVWKCIRELIIKPEFDKMIRFAGPVNLENENHCLVLGELSCLPKERLETEDKDELLGAENSDGADIDQARAAGGVKDLVNGLSKGNVKFKDLQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQPLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVCNGVLYSGSRDGTIRLWSLSDHSLLTVLEEDSSGAVSSVLSLTAVQHTLVVSHESGSIKVWRNDKFMKSMQTHKGSVFAVFLEGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQGKLFVGCADRTVKIALCNRQIPEIFSLLLHINL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query552 2.2.26 [Sep-21-2011]
P90648732 Myosin heavy chain kinase yes no 0.409 0.308 0.304 4e-19
Q93794587 F-box/WD repeat-containin yes no 0.485 0.456 0.23 4e-14
P87053605 F-box/WD repeat-containin yes no 0.442 0.403 0.270 4e-14
Q922B6594 E3 ubiquitin-protein liga yes no 0.411 0.382 0.290 5e-14
Q61FW2589 F-box/WD repeat-containin N/A no 0.463 0.434 0.239 8e-14
Q6Q0C0670 E3 ubiquitin-protein liga yes no 0.411 0.338 0.290 1e-13
O14170703 WD repeat-containing prot no no 0.394 0.310 0.249 8e-13
Q8YV57 1683 Uncharacterized WD repeat no no 0.469 0.153 0.253 9e-13
P425271146 Myosin heavy chain kinase no no 0.336 0.162 0.289 1e-12
Q8YRI1 1526 Uncharacterized WD repeat no no 0.320 0.115 0.310 2e-12
>sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 114/246 (46%), Gaps = 20/246 (8%)

Query: 248 LQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQPL 307
           L+GH   V  +     +LFS S D SI VW LK    + T +GHD  V  V+  D+    
Sbjct: 498 LKGHEGPVESICYNDQYLFSGSSDHSIKVWDLKKLRCIFTLEGHDKPVHTVLLNDK---Y 554

Query: 308 CISGDSGGGIFVWSFSFPLGHEPLK-KWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKA 366
             SG S   I VW        + L+ K+  E   R   +  L  SG+YL++GS D+TIK 
Sbjct: 555 LFSGSSDKTIKVWDL------KTLECKYTLESHAR--AVKTLCISGQYLFSGSNDKTIKV 606

Query: 367 WSLLDGTLSCTMSGHKSAVSTLAVCNGVLYSGSRDGTIRLWSLSDHSLLTVLEEDSSGAV 426
           W L     + T+ GH   V+T+ +    LYSGS D TIR+W+L        L     G  
Sbjct: 607 WDLKTFRCNYTLKGHTKWVTTICILGTNLYSGSYDKTIRVWNLKSLECSATLR----GHD 662

Query: 427 SSVLSLTAVQHTLVVSHESGSIKVWRNDKFM--KSMQTHKGSV--FAVFLEGKWLFTGGW 482
             V  +      L  + +  +IK+W  +      +++ H  +V   AV+ + K + +   
Sbjct: 663 RWVEHMVICDKLLFTASDDNTIKIWDLETLRCNTTLEGHNATVQCLAVWEDKKCVISCSH 722

Query: 483 DKTVSV 488
           D+++ V
Sbjct: 723 DQSIRV 728
Phosphorylates threonine in the C-terminal tail region of myosin II heavy chain. This phosphorylation is critical in regulating the assembly and disassembly of myosin II filament.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 7
>sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 Back     alignment and function description
>sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 Back     alignment and function description
>sp|Q922B6|TRAF7_MOUSE E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 Back     alignment and function description
>sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 Back     alignment and function description
>sp|Q6Q0C0|TRAF7_HUMAN E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 Back     alignment and function description
>sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 Back     alignment and function description
>sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=4 SV=1 Back     alignment and function description
>sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 Back     alignment and function description
>sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query552
359492369 1817 PREDICTED: uncharacterized protein LOC10 0.942 0.286 0.601 1e-180
302141770 734 unnamed protein product [Vitis vinifera] 0.878 0.660 0.563 1e-165
356518567 1815 PREDICTED: uncharacterized protein LOC10 0.887 0.269 0.540 1e-153
255558580 1794 F-box and wd40 domain protein, putative 0.822 0.253 0.545 1e-150
334182750 1805 preprotein translocase secA-like protein 0.945 0.289 0.495 1e-140
186478734 811 zinc ion binding protein [Arabidopsis th 0.958 0.652 0.488 1e-139
5263316 860 Contains PF|00097 Zinc finger C3HC4 type 0.972 0.624 0.480 1e-139
449459378 761 PREDICTED: uncharacterized protein LOC10 0.778 0.565 0.479 1e-109
449500824 741 PREDICTED: uncharacterized LOC101212974, 0.777 0.578 0.477 1e-109
242056063 823 hypothetical protein SORBIDRAFT_03g00277 0.860 0.577 0.432 1e-105
>gi|359492369|ref|XP_002284600.2| PREDICTED: uncharacterized protein LOC100248990 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 320/532 (60%), Positives = 392/532 (73%), Gaps = 12/532 (2%)

Query: 2   ILVMGRRVTKSVAKVGCVGSRICDKEVGLFLSDFLESNVFFSPEVLYELFKKEGIWVECE 61
           +LV GR++ +S+ +      RI DKE+G+  ++ ++   F SPEV  EL +KEGI +EC+
Sbjct: 297 MLVTGRKIHRSLVESVSGRRRIDDKEMGIISTNLIKREAFLSPEVFIELLQKEGIELECD 356

Query: 62  ESEFSVGYGSDVWPVACILLSLLIGEQFTKELIDYIRCVSTKASDDNIACLGMYMAWMEK 121
              +SVGY SDVW +AC+LL L IG  FT EL  +IR  S K   D    L +YM   E+
Sbjct: 357 SLSYSVGYSSDVWSLACMLLRLFIGNPFT-EL--HIR--SAKRHSD---YLEVYMDCREE 408

Query: 122 VTYLLENKFGSEFVSLQLMFCQCLNFDPGCRPLLTNVWKCIRELIIKPEFDKMIRFAGPV 181
           V+ LLE K G+ FV+LQ + C+CLN DP  RPL+ +VWKCIREL+IKP+FD M+   G V
Sbjct: 409 VSSLLETKLGTNFVALQKILCECLNLDPKSRPLVADVWKCIRELVIKPQFDIMVSQEGTV 468

Query: 182 NLENENHCLVLGELSCLPKERLETEDKDELLGAENSDGADIDQARAAGGVKDLVNGLSKG 241
           N  N  HCLVLGEL  LPKE   T    + +  + S   ++DQA      KD + GLS  
Sbjct: 469 NEGNNVHCLVLGELCQLPKE---TNKGSKAVKTDESGRENVDQAGELQDDKDFIEGLSGS 525

Query: 242 NVKFKDLQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYV 301
            VK  +LQGH DC+TGLAVGGGFLFSSSFDK+IHVWSL+DF+ VH F+GH+H+VMAVV+V
Sbjct: 526 TVKSINLQGHLDCITGLAVGGGFLFSSSFDKTIHVWSLQDFTLVHQFRGHEHRVMAVVFV 585

Query: 302 DEDQPLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGR-YLYTGSG 360
           DE+QPLCISGD GGGIFVW  S PLG EPLKKW E+KDWRYSGIHAL  SG  YLYTGSG
Sbjct: 586 DEEQPLCISGDIGGGIFVWGISIPLGQEPLKKWFEQKDWRYSGIHALAISGTGYLYTGSG 645

Query: 361 DRTIKAWSLLDGTLSCTMSGHKSAVSTLAVCNGVLYSGSRDGTIRLWSLSDHSLLTVLEE 420
           D++IKAWSL D TLSCTM+GHKS VS LAV +GVLYSGS DGTIRLWSL+DHS LTVL E
Sbjct: 646 DKSIKAWSLQDCTLSCTMNGHKSVVSALAVSDGVLYSGSWDGTIRLWSLNDHSPLTVLGE 705

Query: 421 DSSGAVSSVLSLTAVQHTLVVSHESGSIKVWRNDKFMKSMQTHKGSVFAVFLEGKWLFTG 480
           D+ G V SVLSL A  H L+ +HE G +K+WRND FMKS+Q H G+VFAV + GKWLFTG
Sbjct: 706 DTPGNVISVLSLKADHHMLLAAHEDGCLKIWRNDVFMKSIQAHDGAVFAVAMGGKWLFTG 765

Query: 481 GWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQGKLFVGCADRTVK 532
           GWDK+V+VQE++GD+ + + +P G+I   S +TALLYWQGKLFVGCADR +K
Sbjct: 766 GWDKSVNVQEISGDDLQIEALPVGSIASDSAVTALLYWQGKLFVGCADRIIK 817

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302141770|emb|CBI18973.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356518567|ref|XP_003527950.1| PREDICTED: uncharacterized protein LOC100793437 [Glycine max] Back     alignment and taxonomy information
>gi|255558580|ref|XP_002520315.1| F-box and wd40 domain protein, putative [Ricinus communis] gi|223540534|gb|EEF42101.1| F-box and wd40 domain protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|334182750|ref|NP_001185058.1| preprotein translocase secA-like protein [Arabidopsis thaliana] gi|332192012|gb|AEE30133.1| preprotein translocase secA-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|186478734|ref|NP_001117325.1| zinc ion binding protein [Arabidopsis thaliana] gi|17529236|gb|AAL38845.1| putative SecA-type chloroplast protein transport factor [Arabidopsis thaliana] gi|20465933|gb|AAM20152.1| putative SecA-type chloroplast transport factor protein [Arabidopsis thaliana] gi|110739333|dbj|BAF01579.1| hypothetical protein [Arabidopsis thaliana] gi|332192014|gb|AEE30135.1| zinc ion binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|5263316|gb|AAD41418.1|AC007727_7 Contains PF|00097 Zinc finger C3HC4 type and 4 WD40 PF|00400 (G beta) domains [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449459378|ref|XP_004147423.1| PREDICTED: uncharacterized protein LOC101212974 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449500824|ref|XP_004161204.1| PREDICTED: uncharacterized LOC101212974, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|242056063|ref|XP_002457177.1| hypothetical protein SORBIDRAFT_03g002770 [Sorghum bicolor] gi|241929152|gb|EES02297.1| hypothetical protein SORBIDRAFT_03g002770 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query552
TAIR|locus:4515102561811 AT1G21651 [Arabidopsis thalian 0.947 0.644 0.494 4e-138
DICTYBASE|DDB_G0289115732 mhkB "myosin heavy chain kinas 0.409 0.308 0.304 1.7e-18
TAIR|locus:2085929473 AT3G18950 "AT3G18950" [Arabido 0.297 0.346 0.252 2e-15
UNIPROTKB|I3LMJ3512 LOC100738291 "Uncharacterized 0.416 0.449 0.298 2.1e-15
UNIPROTKB|F1P0J6660 TRAF7 "Uncharacterized protein 0.416 0.348 0.294 3.6e-15
UNIPROTKB|F1NEH1670 TRAF7 "Uncharacterized protein 0.416 0.343 0.294 3.7e-15
UNIPROTKB|F1RFA9670 TRAF7 "Uncharacterized protein 0.416 0.343 0.298 3.7e-15
POMBASE|SPAC57A10.05c605 pof1 "F-box/WD repeat protein 0.452 0.413 0.265 3.9e-15
MGI|MGI:3042141594 Traf7 "TNF receptor-associated 0.416 0.387 0.294 4.9e-15
RGD|1559653629 Traf7 "TNF receptor-associated 0.416 0.365 0.294 5.4e-15
TAIR|locus:4515102561 AT1G21651 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1352 (481.0 bits), Expect = 4.0e-138, P = 4.0e-138
 Identities = 265/536 (49%), Positives = 366/536 (68%)

Query:     2 ILVMGRRVTKSVAK-VGCVGSRICDKEVGLFLSDFLESNVFFSPEVLYELFKKEGIWVEC 60
             ++  GR V + +A+    +   +   E+GL      +  +F S EVL+E  K++ + ++ 
Sbjct:   280 LIETGRNVYRIIAEETSSLRKPVGASEMGLIFVGLQQKGIFISSEVLFEFLKEQNMLIKN 339

Query:    61 EESEFSVGYGSDVWPVACILLSLLIGEQFTKELIDYIRCVSTKASDDNIA-CLGMYMAWM 119
               S+  V + SDVWPV  +LL L +G++ T+E I+ + CV  K  ++ I   L +Y    
Sbjct:   340 TSSKSFVSHNSDVWPVCFLLLKLRLGKRCTEEFIESVNCVDGKGCEEGIEDILVLYTGIT 399

Query:   120 EKVTYLLENKFGSEFVSLQLMFCQCLNFDPGCRPLLTNVWKCIRELIIKPEFDKMIRFAG 179
             EK++  LE++   +F S+  +  QC   DP  RP+LT++WKCIREL++KP F+ M R   
Sbjct:   400 EKLS--LESELQGKFKSMVEILRQCCCLDPQARPVLTDLWKCIRELVMKPRFNSMSRLHK 457

Query:   180 PVNLENENHCLVLGELSCLPKERLETEDKDELLGAENSDGADIDQARAAGGVK-DLVNGL 238
              +  + +  CL   EL  L +   +  DK EL G +  D A+       G V  D    +
Sbjct:   458 TIYGKRKQFCLAQSELCRLVEVESKEVDK-ELPGMKIGDEAE------EGKVDIDFPGRV 510

Query:   239 SKGNVKFKDLQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAV 298
             S+G V+ KD++GH+D VTGLAVGGGFLFSSS+D++I +WSLKDFSHVHTFKGH  KVMA+
Sbjct:   511 SEGKVRSKDMRGHQDSVTGLAVGGGFLFSSSYDRTILIWSLKDFSHVHTFKGHQDKVMAL 570

Query:   299 VYVDEDQPLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGR-YLYT 357
             ++++  +P+C+SGD GGGIFVWS +FPL  +PL+KW E KDWRY+GIHAL  S   ++YT
Sbjct:   571 IHIEGTEPVCVSGDGGGGIFVWSTTFPLEEQPLRKWYEPKDWRYTGIHALAYSEYGHVYT 630

Query:   358 GSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVCNGVLYSGSRDGTIRLWSLSDHSLLTV 417
             GSGD TIKAWSL DG+L CTMSGHKS VSTL V NGVLYSGS DGT+RLWSLSD+SLLTV
Sbjct:   631 GSGDNTIKAWSLQDGSLLCTMSGHKSVVSTLVVVNGVLYSGSWDGTVRLWSLSDNSLLTV 690

Query:   418 LEEDSSGAVSSVLSLTAVQHTLVVSHESGSIKVWRNDKFMKSMQTHKGSVFAVFLEGKWL 477
             L E++ G V S+LSL A   TLV ++++G I++WR+D  MKSM+   G++ ++ + GKWL
Sbjct:   691 LGEETPGIVRSILSLAADDQTLVAAYQNGDIQIWRDDTLMKSMKIQNGAILSIAVNGKWL 750

Query:   478 FTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQGKLFVGCADRTVKI 533
             FTGGWDKT++VQEL+GDE   +    G+IP  SVIT+LLYW+GKLF G AD+T+K+
Sbjct:   751 FTGGWDKTINVQELSGDEISVNCAHVGSIPGSSVITSLLYWEGKLFAGFADKTIKV 806
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
DICTYBASE|DDB_G0289115 mhkB "myosin heavy chain kinase B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2085929 AT3G18950 "AT3G18950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I3LMJ3 LOC100738291 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0J6 TRAF7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEH1 TRAF7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFA9 TRAF7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
POMBASE|SPAC57A10.05c pof1 "F-box/WD repeat protein protein Pof1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
MGI|MGI:3042141 Traf7 "TNF receptor-associated factor 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1559653 Traf7 "TNF receptor-associated factor 7, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00015442001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (840 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-32
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-30
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-24
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-24
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-21
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-19
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-14
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-14
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-09
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 1e-08
smart0032040 smart00320, WD40, WD40 repeats 1e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-04
pfam13360234 pfam13360, PQQ_2, PQQ-like domain 1e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score =  125 bits (317), Expect = 2e-32
 Identities = 72/249 (28%), Positives = 111/249 (44%), Gaps = 16/249 (6%)

Query: 248 LQGHRDCVTGLAV--GGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQ 305
           L+GH   VT +A    G  L + S D +I VW L+    + T KGH   V  V    +  
Sbjct: 5   LKGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGT 64

Query: 306 PLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIK 365
            L     S   I +W        E ++       +  S   A +  GR L + S D+TIK
Sbjct: 65  YLASGS-SDKTIRLWDLETG---ECVRTLTGHTSYVSSV--AFSPDGRILSSSSRDKTIK 118

Query: 366 AWSLLDGTLSCTMSGHKSAVSTLAV--CNGVLYSGSRDGTIRLWSLSDHSLLTVLEEDSS 423
            W +  G    T+ GH   V+++A       + S S+DGTI+LW L     +  L    +
Sbjct: 119 VWDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKCVATL-TGHT 177

Query: 424 GAVSSVLSLTAVQHTLVVSHESGSIKVW--RNDKFMKSMQTHKGSVFAV--FLEGKWLFT 479
           G V+SV + +     L+ S   G+IK+W     K + +++ H+  V +V    +G  L +
Sbjct: 178 GEVNSV-AFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENGVNSVAFSPDGYLLAS 236

Query: 480 GGWDKTVSV 488
           G  D T+ V
Sbjct: 237 GSEDGTIRV 245

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|222072 pfam13360, PQQ_2, PQQ-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 552
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0313423 consensus Microtubule binding protein YTM1 (contai 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 99.98
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.98
KOG0293519 consensus WD40 repeat-containing protein [Function 99.98
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.98
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.97
KOG0645312 consensus WD40 repeat protein [General function pr 99.97
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.97
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.97
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.97
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.96
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.96
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.96
KOG0318 603 consensus WD40 repeat stress protein/actin interac 99.96
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.96
KOG0293519 consensus WD40 repeat-containing protein [Function 99.96
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.96
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.96
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.96
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.96
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.96
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.96
KOG0300481 consensus WD40 repeat-containing protein [Function 99.96
KOG0294362 consensus WD40 repeat-containing protein [Function 99.95
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.95
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.95
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.95
KOG0643327 consensus Translation initiation factor 3, subunit 99.95
PTZ00421 493 coronin; Provisional 99.95
PTZ00420 568 coronin; Provisional 99.95
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.95
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.95
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.95
KOG0289506 consensus mRNA splicing factor [General function p 99.95
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.94
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.94
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.94
KOG0643327 consensus Translation initiation factor 3, subunit 99.94
PTZ00421 493 coronin; Provisional 99.94
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.94
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.94
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.94
KOG0283712 consensus WD40 repeat-containing protein [Function 99.94
KOG0641350 consensus WD40 repeat protein [General function pr 99.94
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.94
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.93
KOG1539 910 consensus WD repeat protein [General function pred 99.93
PTZ00420 568 coronin; Provisional 99.93
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.93
KOG0772641 consensus Uncharacterized conserved protein, conta 99.93
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.93
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.93
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.93
KOG0289506 consensus mRNA splicing factor [General function p 99.93
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.93
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.93
KOG0639705 consensus Transducin-like enhancer of split protei 99.93
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.93
KOG4283397 consensus Transcription-coupled repair protein CSA 99.92
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.92
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.92
KOG2055514 consensus WD40 repeat protein [General function pr 99.92
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.92
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.91
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.91
KOG0646 476 consensus WD40 repeat protein [General function pr 99.91
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.91
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.91
KOG0300481 consensus WD40 repeat-containing protein [Function 99.91
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.91
KOG0641350 consensus WD40 repeat protein [General function pr 99.91
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.9
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.9
KOG2096420 consensus WD40 repeat protein [General function pr 99.9
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.9
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.9
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.9
KOG0294362 consensus WD40 repeat-containing protein [Function 99.9
KOG0270463 consensus WD40 repeat-containing protein [Function 99.89
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.89
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.89
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.89
KOG1274 933 consensus WD40 repeat protein [General function pr 99.89
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.89
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.88
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.88
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.87
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.87
KOG0302440 consensus Ribosome Assembly protein [General funct 99.87
KOG4328498 consensus WD40 protein [Function unknown] 99.86
KOG1273405 consensus WD40 repeat protein [General function pr 99.86
KOG0646 476 consensus WD40 repeat protein [General function pr 99.86
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.86
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.86
KOG2048 691 consensus WD40 repeat protein [General function pr 99.86
KOG0270463 consensus WD40 repeat-containing protein [Function 99.86
KOG1539 910 consensus WD repeat protein [General function pred 99.86
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.86
KOG0267 825 consensus Microtubule severing protein katanin p80 99.85
KOG2048 691 consensus WD40 repeat protein [General function pr 99.85
KOG2106626 consensus Uncharacterized conserved protein, conta 99.85
KOG0267 825 consensus Microtubule severing protein katanin p80 99.85
KOG1273405 consensus WD40 repeat protein [General function pr 99.84
KOG2096420 consensus WD40 repeat protein [General function pr 99.84
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.84
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.84
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.84
KOG0649325 consensus WD40 repeat protein [General function pr 99.84
KOG4283397 consensus Transcription-coupled repair protein CSA 99.84
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.83
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.83
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.82
KOG0639705 consensus Transducin-like enhancer of split protei 99.82
KOG1188376 consensus WD40 repeat protein [General function pr 99.82
KOG0302440 consensus Ribosome Assembly protein [General funct 99.81
KOG1274 933 consensus WD40 repeat protein [General function pr 99.81
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.81
KOG1063 764 consensus RNA polymerase II elongator complex, sub 99.8
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.79
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.79
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.79
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.78
KOG4328498 consensus WD40 protein [Function unknown] 99.77
KOG1334559 consensus WD40 repeat protein [General function pr 99.76
KOG0303472 consensus Actin-binding protein Coronin, contains 99.76
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.75
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.75
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.74
COG2319466 FOG: WD40 repeat [General function prediction only 99.74
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.74
KOG4227 609 consensus WD40 repeat protein [General function pr 99.74
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.73
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.72
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 99.72
COG2319466 FOG: WD40 repeat [General function prediction only 99.71
KOG2110391 consensus Uncharacterized conserved protein, conta 99.71
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.7
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.7
KOG0575592 consensus Polo-like serine/threonine protein kinas 99.69
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.69
KOG2055514 consensus WD40 repeat protein [General function pr 99.68
KOG0598357 consensus Ribosomal protein S6 kinase and related 99.68
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.67
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.67
KOG1188 376 consensus WD40 repeat protein [General function pr 99.66
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 99.66
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.66
KOG4227 609 consensus WD40 repeat protein [General function pr 99.65
KOG0581364 consensus Mitogen-activated protein kinase kinase 99.65
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.65
PRK11028330 6-phosphogluconolactonase; Provisional 99.65
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.64
KOG0649325 consensus WD40 repeat protein [General function pr 99.64
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.64
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 99.64
KOG1963 792 consensus WD40 repeat protein [General function pr 99.63
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.63
KOG1963 792 consensus WD40 repeat protein [General function pr 99.62
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.61
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.6
KOG0616355 consensus cAMP-dependent protein kinase catalytic 99.6
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.6
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.6
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.58
KOG0595429 consensus Serine/threonine-protein kinase involved 99.57
KOG0596677 consensus Dual specificity; serine/threonine and t 99.57
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.56
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.56
KOG1310 758 consensus WD40 repeat protein [General function pr 99.56
KOG0605550 consensus NDR and related serine/threonine kinases 99.55
KOG0589426 consensus Serine/threonine protein kinase [General 99.55
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.55
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 99.55
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.55
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.55
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.54
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.53
KOG0583370 consensus Serine/threonine protein kinase [Signal 99.53
KOG0198313 consensus MEKK and related serine/threonine protei 99.53
KOG0201467 consensus Serine/threonine protein kinase [Signal 99.53
KOG0578550 consensus p21-activated serine/threonine protein k 99.52
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.52
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.52
KOG0771398 consensus Prolactin regulatory element-binding pro 99.52
KOG0771398 consensus Prolactin regulatory element-binding pro 99.51
KOG2111346 consensus Uncharacterized conserved protein, conta 99.5
PHA02988283 hypothetical protein; Provisional 99.5
KOG1334559 consensus WD40 repeat protein [General function pr 99.49
PRK11028330 6-phosphogluconolactonase; Provisional 99.48
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 99.48
KOG2111346 consensus Uncharacterized conserved protein, conta 99.47
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.47
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.47
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.47
PRK01742429 tolB translocation protein TolB; Provisional 99.47
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.46
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 99.46
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.46
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.45
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.44
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.43
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.43
KOG2321 703 consensus WD40 repeat protein [General function pr 99.43
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.43
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.43
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.42
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.42
KOG0582516 consensus Ste20-like serine/threonine protein kina 99.42
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.42
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.42
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.42
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.42
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.41
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.41
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.41
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.41
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.41
PTZ00283496 serine/threonine protein kinase; Provisional 99.41
PTZ00267478 NIMA-related protein kinase; Provisional 99.4
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.4
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.4
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.4
KOG42791226 consensus Serine/threonine protein kinase [Signal 99.39
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.39
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.39
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.39
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.39
KOG0986591 consensus G protein-coupled receptor kinase [Signa 99.39
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.39
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.39
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.39
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.39
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.39
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.39
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.38
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.38
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.38
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.38
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.38
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.38
KOG0610459 consensus Putative serine/threonine protein kinase 99.38
PRK01742429 tolB translocation protein TolB; Provisional 99.37
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.37
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.37
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.37
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.37
KOG1310 758 consensus WD40 repeat protein [General function pr 99.37
PTZ00284467 protein kinase; Provisional 99.37
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.37
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.37
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.37
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.36
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.36
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.36
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.35
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.35
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.35
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.35
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.35
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.35
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.35
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.34
PTZ00036440 glycogen synthase kinase; Provisional 99.34
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.34
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.34
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.34
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.33
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.33
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.33
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.33
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.33
KOG0584632 consensus Serine/threonine protein kinase [General 99.33
PHA03207392 serine/threonine kinase US3; Provisional 99.32
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.32
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.32
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.32
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.32
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.32
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.32
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.32
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.32
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.31
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.31
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.31
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.31
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.31
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.31
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.31
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.31
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.31
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.3
KOG4547 541 consensus WD40 repeat-containing protein [General 99.3
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.3
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.3
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.3
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.3
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.3
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.3
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.3
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.29
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.29
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.29
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.29
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.29
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.29
PHA02882294 putative serine/threonine kinase; Provisional 99.29
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.29
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.28
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.28
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.28
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.28
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.28
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.28
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.28
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.28
PHA03212391 serine/threonine kinase US3; Provisional 99.28
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.27
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.27
PRK03629429 tolB translocation protein TolB; Provisional 99.27
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.27
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.27
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.27
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.27
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.27
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.26
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.26
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.26
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.26
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.26
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.26
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.26
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.26
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.26
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.26
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.26
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.26
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.26
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.26
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.25
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.25
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.25
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.25
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.25
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.25
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.25
KOG2139445 consensus WD40 repeat protein [General function pr 99.25
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.24
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.24
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.24
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.24
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.24
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.24
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.24
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 99.24
PRK04922433 tolB translocation protein TolB; Provisional 99.23
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.23
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.23
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.23
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.23
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.23
PHA03211461 serine/threonine kinase US3; Provisional 99.23
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.23
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.23
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.23
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.23
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.23
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.23
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.22
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.22
KOG1409404 consensus Uncharacterized conserved protein, conta 99.22
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.22
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.22
KOG0586596 consensus Serine/threonine protein kinase [General 99.22
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.22
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.22
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.22
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.22
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.21
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.21
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.21
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.21
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.21
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.21
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.21
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.21
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.21
KOG1989738 consensus ARK protein kinase family [Signal transd 99.21
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.21
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.21
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.21
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.21
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.2
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.2
PRK05137435 tolB translocation protein TolB; Provisional 99.2
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.2
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.2
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.2
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.2
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.2
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.2
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.2
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.2
PRK03629429 tolB translocation protein TolB; Provisional 99.19
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.19
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.19
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.19
KOG0661538 consensus MAPK related serine/threonine protein ki 99.19
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.19
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.19
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.19
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.19
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.19
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.19
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.19
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.19
KOG2139445 consensus WD40 repeat protein [General function pr 99.19
PRK02889427 tolB translocation protein TolB; Provisional 99.19
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.19
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.19
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.18
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.18
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.18
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.18
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.18
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.18
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.18
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.18
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.18
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.18
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.18
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.18
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.17
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.17
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.17
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.17
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.17
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.17
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.17
KOG2321 703 consensus WD40 repeat protein [General function pr 99.17
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.17
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.17
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.16
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.16
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.16
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.16
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.16
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.16
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.16
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.16
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.16
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.15
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.15
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.15
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.15
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.15
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.15
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.15
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.15
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.14
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.14
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.14
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=3.9e-44  Score=322.33  Aligned_cols=312  Identities=23%  Similarity=0.369  Sum_probs=268.8

Q ss_pred             hhcCCCCCCCccccceeeecCcceEEEeeCCCeEEEEE---------eecCccceEEEEEc--CCEEEEEeCCCcEEEEe
Q 008820          210 ELLGAENSDGADIDQARAAGGVKDLVNGLSKGNVKFKD---------LQGHRDCVTGLAVG--GGFLFSSSFDKSIHVWS  278 (552)
Q Consensus       210 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------l~~H~~~V~~l~~s--~~~l~s~s~dg~I~iwd  278 (552)
                      +..++...++..+.++.|++.+..++++..|.++++|+         .+||..+|.|++|+  |+.||+|+.||+|++||
T Consensus       106 rCssS~~GH~e~Vl~~~fsp~g~~l~tGsGD~TvR~WD~~TeTp~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lwd  185 (480)
T KOG0271|consen  106 RCSSSIAGHGEAVLSVQFSPTGSRLVTGSGDTTVRLWDLDTETPLFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLWD  185 (480)
T ss_pred             eeccccCCCCCcEEEEEecCCCceEEecCCCceEEeeccCCCCcceeecCCccEEEEEEECCCcchhhccccCCeEEEec
Confidence            34455667788899999999999999999999999998         47999999999999  99999999999999999


Q ss_pred             CCCCeEE-EEEeCCCCCeEEEEEecC----CCCEEEEEcCCCcEEEEeCCCCCCCccccccccCCCceeeeEEEEeeCCC
Q 008820          279 LKDFSHV-HTFKGHDHKVMAVVYVDE----DQPLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGR  353 (552)
Q Consensus       279 ~~~~~~~-~~~~~h~~~v~~v~~~~~----~~~~l~s~~~dg~i~vwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  353 (552)
                      .++|+++ ..+.+|...|++++|.|-    ...+|++++.||+++|||+..+.....   ..+    +..++.|+.+.|.
T Consensus       186 pktg~~~g~~l~gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~---lsg----HT~~VTCvrwGG~  258 (480)
T KOG0271|consen  186 PKTGQQIGRALRGHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRT---LSG----HTASVTCVRWGGE  258 (480)
T ss_pred             CCCCCcccccccCcccceeEEeecccccCCCccceecccCCCCEEEEEccCceEEEE---ecc----CccceEEEEEcCC
Confidence            9998765 678999999999999862    345889999999999999986543333   333    3446788899866


Q ss_pred             -EEEEeeCCCcEEEEECCCCceeEEecCCCCCeEEEEEe-------------CC-------------------------E
Q 008820          354 -YLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVC-------------NG-------------------------V  394 (552)
Q Consensus       354 -~l~sgs~dg~i~iwd~~~~~~~~~~~~h~~~v~~l~~~-------------~~-------------------------~  394 (552)
                       ++++|+.|++|++|+...|.+...+++|...|+.++.+             +.                         .
T Consensus       259 gliySgS~DrtIkvw~a~dG~~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~er  338 (480)
T KOG0271|consen  259 GLIYSGSQDRTIKVWRALDGKLCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGER  338 (480)
T ss_pred             ceEEecCCCceEEEEEccchhHHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcce
Confidence             99999999999999999999999999999999999876             22                         3


Q ss_pred             EEEEeCCCcEEEEECCCCc-eeEEEecCCCCceEEEEEEcCCCCEEEEEECCCcEEEEe--CCcceeeeecccceEEEEE
Q 008820          395 LYSGSRDGTIRLWSLSDHS-LLTVLEEDSSGAVSSVLSLTAVQHTLVVSHESGSIKVWR--NDKFMKSMQTHKGSVFAVF  471 (552)
Q Consensus       395 l~s~~~dg~i~iwd~~~~~-~~~~~~~~~~~~~~~~~~~s~~~~~l~~g~~dg~i~iwd--~~~~~~~~~~h~~~v~~v~  471 (552)
                      +++|+.|.++.+|+....+ ++....+| ...+.. +.|+||++++++++.|..|++||  .++.+.++.+|-+.|+.++
T Consensus       339 lVSgsDd~tlflW~p~~~kkpi~rmtgH-q~lVn~-V~fSPd~r~IASaSFDkSVkLW~g~tGk~lasfRGHv~~VYqva  416 (480)
T KOG0271|consen  339 LVSGSDDFTLFLWNPFKSKKPITRMTGH-QALVNH-VSFSPDGRYIASASFDKSVKLWDGRTGKFLASFRGHVAAVYQVA  416 (480)
T ss_pred             eEEecCCceEEEecccccccchhhhhch-hhheee-EEECCCccEEEEeecccceeeeeCCCcchhhhhhhccceeEEEE
Confidence            9999999999999986544 66666665 345555 69999999999999999999998  5678899999999999999


Q ss_pred             e--cCCEEEEEeCCCeEEEEecCCCeeeeeeccCCCcccCcceEEEEEeC--CeEEEEeCCCeEEEEE
Q 008820          472 L--EGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQ--GKLFVGCADRTVKIAL  535 (552)
Q Consensus       472 ~--~~~~l~sgs~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~v~~l~~~~--~~l~s~s~Dg~v~iw~  535 (552)
                      |  |.++|++||.|.++++||+++.++...+..+     ...|.++.|+|  .++++|+.|..+++|.
T Consensus       417 wsaDsRLlVS~SkDsTLKvw~V~tkKl~~DLpGh-----~DEVf~vDwspDG~rV~sggkdkv~~lw~  479 (480)
T KOG0271|consen  417 WSADSRLLVSGSKDSTLKVWDVRTKKLKQDLPGH-----ADEVFAVDWSPDGQRVASGGKDKVLRLWR  479 (480)
T ss_pred             eccCccEEEEcCCCceEEEEEeeeeeecccCCCC-----CceEEEEEecCCCceeecCCCceEEEeec
Confidence            9  8889999999999999999998887765543     77899999995  3589999999999995

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 3e-13
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 4e-07
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 2e-11
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 7e-09
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 4e-11
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 4e-11
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 4e-11
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 5e-11
3zey_7318 High-resolution Cryo-electron Microscopy Structure 6e-11
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 7e-11
2g99_A308 Structural Basis For The Specific Recognition Of Me 5e-10
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-10
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 6e-10
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 6e-10
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 6e-10
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 6e-10
2h9l_A329 Wdr5delta23 Length = 329 6e-10
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 6e-10
2g9a_A311 Structural Basis For The Specific Recognition Of Me 7e-10
2g9a_A311 Structural Basis For The Specific Recognition Of Me 4e-07
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 7e-10
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 7e-10
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 7e-10
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 8e-10
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 8e-10
2gnq_A336 Structure Of Wdr5 Length = 336 1e-09
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-09
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 1e-09
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 3e-09
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 3e-09
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 3e-09
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 3e-09
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 3e-09
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 6e-09
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 7e-09
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 4e-08
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 6e-06
3mks_B 464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 4e-05
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 5e-08
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 1e-07
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 2e-05
1nex_B 464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 3e-05
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 9e-07
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 8e-06
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 1e-06
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 2e-05
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 1e-06
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 9e-06
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 2e-06
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 3e-06
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 3e-06
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 5e-05
3acp_A417 Crystal Structure Of Yeast Rpn14, A Chaperone Of Th 5e-05
3vl1_A420 Crystal Structure Of Yeast Rpn14 Length = 420 6e-05
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 7e-05
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 1e-04
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure 
Iteration: 1

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 118/300 (39%), Gaps = 49/300 (16%)
Query: 232 KDLVNGLSKGNVKFKD---------LQGHRDCVTGLAVGGGFLFSSSFDKSIHVWSLKDF 282
           + +V+GL    +K  D         L GH   V  L      + + S D ++ VW +   
Sbjct: 144 QKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTG 203
Query: 283 SHVHTFKGHDHKVMAVVYVDEDQPLCISGDSGGGIFVWSFSFP---------LGHEPLKK 333
             ++T     H   AV+++  +  + ++      I VW  + P         +GH     
Sbjct: 204 EMLNTLI---HHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHR---- 256
Query: 334 WNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVCNG 393
                    + ++ +    +Y+ + SGDRTIK W+        T++GHK  ++ L   + 
Sbjct: 257 ---------AAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDR 307
Query: 394 VLYSGSRDGTIRLWSLSDHSLLTVLEEDSSGAVSSVLSLTAVQHTLVVSHESGSIKVW-- 451
           ++ SGS D TIRLW +   + L VLE    G    V  +      +V     G IKVW  
Sbjct: 308 LVVSGSSDNTIRLWDIECGACLRVLE----GHEELVRCIRFDNKRIVSGAYDGKIKVWDL 363
Query: 452 ---------RNDKFMKSMQTHKGSVFAVFLEGKWLFTGGWDKTVSVQELAGDEFEEDVIP 502
                         ++++  H G VF +  +   + +   D T+ + +   D   +   P
Sbjct: 364 VAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPP 423
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query552
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.98
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.98
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.98
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.98
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.98
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.98
2pm7_B297 Protein transport protein SEC13, protein transport 99.97
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.97
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.97
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.96
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.96
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
3jro_A 753 Fusion protein of protein transport protein SEC13 99.96
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.95
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.95
3jrp_A379 Fusion protein of protein transport protein SEC13 99.95
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.95
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.95
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.95
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.95
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.95
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.94
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.94
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.94
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.93
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.93
3jro_A 753 Fusion protein of protein transport protein SEC13 99.93
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.93
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.89
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.86
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.86
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.86
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.85
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.84
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.84
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.83
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.81
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.81
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.8
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.79
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.79
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.79
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.78
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.78
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.77
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.77
4aoj_A329 High affinity nerve growth factor receptor; transf 99.77
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.77
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.77
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.76
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.76
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.75
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.75
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.75
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.75
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.75
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.75
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.74
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.74
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.74
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.74
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.74
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.74
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.74
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.74
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.73
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.73
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.72
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.72
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.71
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.69
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.67
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.67
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.65
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.64
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.64
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.63
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.63
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.63
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 99.62
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.62
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.61
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.6
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.6
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.6
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.6
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.6
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.58
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.57
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.56
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.55
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.55
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.55
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.54
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.53
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.53
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.53
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.52
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.52
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.52
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.52
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.51
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.51
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.51
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.51
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.5
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.5
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.5
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.5
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.5
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.5
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.5
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.49
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.49
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.49
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.49
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.49
3soc_A322 Activin receptor type-2A; structural genomics cons 99.49
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.48
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.48
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.48
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.48
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.48
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.48
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.48
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.48
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.48
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.48
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.47
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.47
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.47
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.47
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.47
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.47
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.47
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.47
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.47
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.46
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.46
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.46
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.46
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.46
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.46
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.46
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.46
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.46
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.46
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.45
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.45
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.45
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.45
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.45
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.45
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.45
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.44
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.44
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.44
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.44
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.44
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.44
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.43
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.43
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.43
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.43
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.43
3ork_A311 Serine/threonine protein kinase; structural genomi 99.43
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.43
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.43
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.43
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.43
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.43
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.43
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.43
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.43
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.42
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.42
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.42
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.42
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.42
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.42
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.42
3niz_A311 Rhodanese family protein; structural genomics, str 99.42
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.42
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.42
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.42
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.42
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.42
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.42
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.42
3bhy_A283 Death-associated protein kinase 3; death associate 99.41
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.41
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.41
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.41
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.41
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.41
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.41
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.41
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.41
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.41
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.41
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.4
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.4
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.4
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.4
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.4
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.4
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.4
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.4
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.4
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.39
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.39
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.39
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.39
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.39
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.39
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.39
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.39
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.39
3q4u_A301 Activin receptor type-1; structural genomics conso 99.39
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.39
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.39
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.39
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.38
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.38
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.38
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.38
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.38
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.38
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.38
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.38
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.38
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.37
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.37
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.37
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.37
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.37
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.37
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.37
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.37
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.37
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.37
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.37
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.37
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.36
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.36
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.36
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.36
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.36
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.36
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.36
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.36
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.36
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.36
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.36
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.36
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.36
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.36
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.36
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.35
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.35
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.35
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.35
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.35
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.35
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.35
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.35
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.35
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.35
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.35
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.34
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.34
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.34
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.34
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.34
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.34
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.34
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.34
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.34
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.34
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.34
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.34
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.34
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.33
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.33
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.33
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.33
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.33
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.33
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.33
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.33
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.33
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.33
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.33
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.33
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.33
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.33
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.32
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.32
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.32
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.32
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.32
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.32
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.32
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.32
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.32
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.32
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.32
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.32
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.32
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.31
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.31
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.31
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.31
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.31
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.3
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.3
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.3
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.3
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.3
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.3
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.3
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.3
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.3
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.29
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.29
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.29
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.28
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.28
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.28
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.28
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.28
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.28
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.28
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.27
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.27
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.27
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.26
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.26
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.26
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.26
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.25
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.25
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.25
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.24
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.24
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.24
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.23
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.23
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.23
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.22
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.2
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.2
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.2
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.19
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.19
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.14
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.13
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.13
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.13
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.12
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.11
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.11
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.08
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.07
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.06
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.05
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.04
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 99.04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.0
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.98
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 98.97
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.95
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.95
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.94
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.93
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.93
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.92
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.92
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.91
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.9
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.84
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.83
3uqc_A286 Probable conserved transmembrane protein; structur 98.82
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.82
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.8
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.79
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.79
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.78
2qe8_A343 Uncharacterized protein; structural genomics, join 98.75
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.74
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.73
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.72
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.71
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.71
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.67
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.67
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.6
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.59
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 98.58
2ece_A462 462AA long hypothetical selenium-binding protein; 98.56
2ece_A462 462AA long hypothetical selenium-binding protein; 98.52
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.49
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
Probab=100.00  E-value=1.1e-39  Score=329.21  Aligned_cols=279  Identities=23%  Similarity=0.352  Sum_probs=239.9

Q ss_pred             EEeecCccceEEEEEc--CCEEEEEeCCCcEEEEeCCCCeEEEEEeCCCCCeEEEEEecCCCCEEEEEcCCCcEEEEeCC
Q 008820          246 KDLQGHRDCVTGLAVG--GGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQPLCISGDSGGGIFVWSFS  323 (552)
Q Consensus       246 ~~l~~H~~~V~~l~~s--~~~l~s~s~dg~I~iwd~~~~~~~~~~~~h~~~v~~v~~~~~~~~~l~s~~~dg~i~vwd~~  323 (552)
                      ..+.+|.++|++++|+  +++|++|+.||+|++||+.+++...++.+|.+.|.+++|+|++. ++++|+.|++|++||+.
T Consensus       102 ~~l~gh~~~V~~~~~~p~~~~l~s~s~Dg~i~vwd~~~~~~~~~l~~h~~~V~~v~~~~~~~-~l~sgs~D~~i~iwd~~  180 (410)
T 1vyh_C          102 YALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGK-LLASCSADMTIKLWDFQ  180 (410)
T ss_dssp             CEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSS-EEEEEETTSCCCEEETT
T ss_pred             EeecccCCcEEEEEEcCCCCEEEEEeCCCeEEEEECCCCcEEEEEeccCCcEEEEEEcCCCC-EEEEEeCCCeEEEEeCC
Confidence            4578999999999999  89999999999999999999999999999999999999998655 88999999999999998


Q ss_pred             CCCCCccccccccCCCceeeeEEEEeeCCCEEEEeeCCCcEEEEECCCCceeEEecCCCCCeEEEEEe--CCEEEEEeCC
Q 008820          324 FPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVC--NGVLYSGSRD  401 (552)
Q Consensus       324 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~sgs~dg~i~iwd~~~~~~~~~~~~h~~~v~~l~~~--~~~l~s~~~d  401 (552)
                      +...   +..+..+..  .....+++|++++|++|+.|++|++||+++++++..+.+|...|.++.++  +.++++|+.|
T Consensus       181 ~~~~---~~~~~~h~~--~V~~v~~~p~~~~l~s~s~D~~i~~wd~~~~~~~~~~~~h~~~v~~~~~~~~g~~l~s~s~D  255 (410)
T 1vyh_C          181 GFEC---IRTMHGHDH--NVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSND  255 (410)
T ss_dssp             SSCE---EECCCCCSS--CEEEEEECSSSSEEEEEETTSEEEEEETTTCCEEEEEECCSSCEEEEEECTTSSEEEEEETT
T ss_pred             CCce---eEEEcCCCC--CEEEEEEeCCCCEEEEEeCCCeEEEEECCCCcEEEEEeCCCccEEEEEECCCCCEEEEEcCC
Confidence            6543   333333332  22345788899999999999999999999999999999999999999999  3499999999


Q ss_pred             CcEEEEECCCCceeEEEecCCCCceEEEEEEcCC--------------------CCEEEEEECCCcEEEEeCC--cceee
Q 008820          402 GTIRLWSLSDHSLLTVLEEDSSGAVSSVLSLTAV--------------------QHTLVVSHESGSIKVWRND--KFMKS  459 (552)
Q Consensus       402 g~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~s~~--------------------~~~l~~g~~dg~i~iwd~~--~~~~~  459 (552)
                      ++|++||+++++....+..+. ..+.+ ++|+|+                    +.++++|+.|+.|++||++  .++..
T Consensus       256 ~~v~vwd~~~~~~~~~~~~h~-~~v~~-~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~sgs~D~~i~iwd~~~~~~~~~  333 (410)
T 1vyh_C          256 QTVRVWVVATKECKAELREHR-HVVEC-ISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMT  333 (410)
T ss_dssp             SCEEEEETTTCCEEEEECCCS-SCEEE-EEECCSCGGGGGGGCCSCC-------CCEEEEEETTSEEEEEETTTTEEEEE
T ss_pred             CeEEEEECCCCceeeEecCCC-ceEEE-EEEcCcccccchhhhccccccccCCCCCEEEEEeCCCeEEEEECCCCceEEE
Confidence            999999999999988887653 44444 688886                    6789999999999999965  46778


Q ss_pred             eecccceEEEEEe--cCCEEEEEeCCCeEEEEecCCCeeeeeeccCCCcccCcceEEEEEeCC--eEEEEeCCCeEEEEE
Q 008820          460 MQTHKGSVFAVFL--EGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQG--KLFVGCADRTVKIAL  535 (552)
Q Consensus       460 ~~~h~~~v~~v~~--~~~~l~sgs~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~v~~l~~~~~--~l~s~s~Dg~v~iw~  535 (552)
                      +.+|...|.++.|  ++++|++|+.||.|++||+.+++....+..+     ...|++++|+++  .|++|+.||+|++|+
T Consensus       334 ~~~h~~~v~~v~~~~~g~~l~s~s~D~~i~vwd~~~~~~~~~~~~h-----~~~v~~l~~~~~~~~l~sgs~D~~i~vW~  408 (410)
T 1vyh_C          334 LVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAH-----EHFVTSLDFHKTAPYVVTGSVDQTVKVWE  408 (410)
T ss_dssp             EECCSSCEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEECC-----SSCEEEEEECSSSSCEEEEETTSEEEEEC
T ss_pred             EECCCCcEEEEEEcCCCCEEEEEeCCCeEEEEECCCCceEEEEcCC-----CCcEEEEEEcCCCCEEEEEeCCCcEEEEe
Confidence            8999999999887  7899999999999999999988766655432     667999999964  599999999999998


Q ss_pred             ec
Q 008820          536 CN  537 (552)
Q Consensus       536 ~~  537 (552)
                      ++
T Consensus       409 ~r  410 (410)
T 1vyh_C          409 CR  410 (410)
T ss_dssp             --
T ss_pred             CC
Confidence            63
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 552
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 9e-22
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-17
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-16
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-07
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-21
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-12
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 7e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-05
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.002
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-21
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-21
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-08
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-20
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-14
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-17
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-11
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-10
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 8e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-10
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-10
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 7e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.001
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 8e-04
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-09
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-08
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 7e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-07
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-06
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-07
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-07
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-06
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-07
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-05
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-04
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-05
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.003
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 7e-05
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-04
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.002
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-05
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.002
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-04
d2bbkh_ 355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.003
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 5e-04
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 94.0 bits (232), Expect = 9e-22
 Identities = 59/313 (18%), Positives = 101/313 (32%), Gaps = 37/313 (11%)

Query: 248 LQGHRDCVTGLAV--GGGFLFSSSFDKSIHVWSLKDFSHVHTFKGHDHKVMAVVYVDEDQ 305
           L GHR  VT +        + S+S D +I VW  +      T KGH   V  + +    +
Sbjct: 13  LSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGK 72

Query: 306 PLCISGDSGGGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIK 365
            L             +                         ++  +G ++ + S D+TIK
Sbjct: 73  LLASC------SADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIK 126

Query: 366 AWSLLDGTLSCTMSGHKSAVSTLAVCNG--VLYSGSRDGTIRLWSLSDHSLLTVLEEDSS 423
            W +  G    T +GH+  V  +       ++ S S D T+R+W ++       L E   
Sbjct: 127 MWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRH 186

Query: 424 GAVS------------------SVLSLTAVQHTLVVSHESGSIKVW--RNDKFMKSMQTH 463
                                            L+      +IK+W       + ++  H
Sbjct: 187 VVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGH 246

Query: 464 KGSVFAVFL--EGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQGK 521
              V  V     GK++ +   DKT+ V +          + T       V +   +    
Sbjct: 247 DNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR----CMKTLNAHEHFVTSLDFHKTAP 302

Query: 522 LFV-GCADRTVKI 533
             V G  D+TVK+
Sbjct: 303 YVVTGSVDQTVKV 315
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query552
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.98
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.9
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.86
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.84
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.84
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.82
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.8
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.79
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.75
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.74
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.73
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.73
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.73
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.72
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.7
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.69
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.69
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.69
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.69
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.68
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.68
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.67
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.67
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.66
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.66
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.66
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.65
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.65
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.65
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.65
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.65
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.65
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.65
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.64
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.64
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.64
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.64
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.64
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.64
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.63
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.63
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.63
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.63
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.63
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.62
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.62
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.62
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.61
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.61
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.6
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.6
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.6
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.59
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.58
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.58
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.58
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.57
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.57
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.56
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.55
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.55
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.55
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.54
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.53
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.5
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.49
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.45
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.43
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.43
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.41
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.41
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.36
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.33
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.33
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.33
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.31
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.26
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.25
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.19
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.07
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.01
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.72
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.7
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.68
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.68
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.57
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.56
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.39
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.38
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.36
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.33
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.2
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.16
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.03
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.0
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.99
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.94
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.84
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.83
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 97.8
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.64
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.63
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.49
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.41
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.41
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.2
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 97.12
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.92
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.7
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.54
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.51
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.41
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.41
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.05
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.01
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 95.3
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 94.33
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 94.32
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 93.59
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 93.35
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 93.23
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 92.65
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 91.49
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 89.36
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 88.12
d1a12a_401 Regulator of chromosome condensation RCC1 {Human ( 86.39
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 80.38
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 80.17
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.6e-35  Score=285.26  Aligned_cols=280  Identities=16%  Similarity=0.281  Sum_probs=229.6

Q ss_pred             eEEEEEeecCccceEEEEEc--CCEEEEEeCCCcEEEEeCCCCeE-----EEEEeCCCCCeEEEEEecCCCCEEEEEcCC
Q 008820          242 NVKFKDLQGHRDCVTGLAVG--GGFLFSSSFDKSIHVWSLKDFSH-----VHTFKGHDHKVMAVVYVDEDQPLCISGDSG  314 (552)
Q Consensus       242 ~~~~~~l~~H~~~V~~l~~s--~~~l~s~s~dg~I~iwd~~~~~~-----~~~~~~h~~~v~~v~~~~~~~~~l~s~~~d  314 (552)
                      ...++++ +|.+.|++++|+  +++|+||+ ||.|+|||+.++..     .....+|.+.|.+++|+|++. +|++|+.|
T Consensus        42 ~~~~~~~-~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~-~l~s~~~d  118 (337)
T d1gxra_          42 ARQINTL-NHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGC-TLIVGGEA  118 (337)
T ss_dssp             EEEEEEE-CCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSS-EEEEEESS
T ss_pred             ceEEEEC-CCCCcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCC-EEEEeecc
Confidence            3445666 899999999999  89999997 89999999976432     233457999999999999765 77999999


Q ss_pred             CcEEEEeCCCCCCCccccccccCCCceeeeEEEEeeCCCEEEEeeCCCcEEEEECCCCceeEEecCCCCCeEEEEEe--C
Q 008820          315 GGIFVWSFSFPLGHEPLKKWNEEKDWRYSGIHALTTSGRYLYTGSGDRTIKAWSLLDGTLSCTMSGHKSAVSTLAVC--N  392 (552)
Q Consensus       315 g~i~vwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~sgs~dg~i~iwd~~~~~~~~~~~~h~~~v~~l~~~--~  392 (552)
                      |.|++||+...... .......+..  .....++++++.++++++.|+.|++||+.++++.....+|...|++++|+  +
T Consensus       119 g~i~iwd~~~~~~~-~~~~~~~~~~--~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~l~~s~~~  195 (337)
T d1gxra_         119 STLSIWDLAAPTPR-IKAELTSSAP--ACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDG  195 (337)
T ss_dssp             SEEEEEECCCC--E-EEEEEECSSS--CEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECTTS
T ss_pred             cccccccccccccc-cccccccccc--ccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            99999998754322 1122222221  22345678899999999999999999999999999999999999999998  4


Q ss_pred             CEEEEEeCCCcEEEEECCCCceeEEEecCCCCceEEEEEEcCCCCEEEEEECCCcEEEEeCCc-ceeeeecccceEEEEE
Q 008820          393 GVLYSGSRDGTIRLWSLSDHSLLTVLEEDSSGAVSSVLSLTAVQHTLVVSHESGSIKVWRNDK-FMKSMQTHKGSVFAVF  471 (552)
Q Consensus       393 ~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~l~~g~~dg~i~iwd~~~-~~~~~~~h~~~v~~v~  471 (552)
                      ..+++++.|+.|++||+++++.+..+...  ..+.+ ++++|+++++++|+.|+.+++||... .......|...|.++.
T Consensus       196 ~~~~~~~~d~~v~i~d~~~~~~~~~~~~~--~~i~~-l~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~~~~~i~~v~  272 (337)
T d1gxra_         196 TKLWTGGLDNTVRSWDLREGRQLQQHDFT--SQIFS-LGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLK  272 (337)
T ss_dssp             SEEEEEETTSEEEEEETTTTEEEEEEECS--SCEEE-EEECTTSSEEEEEETTSCEEEEETTSSCEEEECCCSSCEEEEE
T ss_pred             cccccccccccccccccccceeecccccc--cceEE-EEEcccccccceeccccccccccccccccccccccccccceEE
Confidence            49999999999999999999988877643  44555 68999999999999999999999764 3446678999999998


Q ss_pred             e--cCCEEEEEeCCCeEEEEecCCCeeeeeeccCCCcccCcceEEEEEeC--CeEEEEeCCCeEEEEEe
Q 008820          472 L--EGKWLFTGGWDKTVSVQELAGDEFEEDVIPTGAIPCGSVITALLYWQ--GKLFVGCADRTVKIALC  536 (552)
Q Consensus       472 ~--~~~~l~sgs~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~v~~l~~~~--~~l~s~s~Dg~v~iw~~  536 (552)
                      |  ++++|++++.||.|++||+.+++......+      ...|.+++|++  ..|++|+.||+|+|||+
T Consensus       273 ~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~~~------~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         273 FAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKE------SSSVLSCDISVDDKYIVTGSGDKKATVYEV  335 (337)
T ss_dssp             ECTTSSEEEEEETTSEEEEEETTTCCEEEEEEC------SSCEEEEEECTTSCEEEEEETTSCEEEEEE
T ss_pred             ECCCCCEEEEEeCCCeEEEEECCCCCEEEEccC------CCCEEEEEEeCCCCEEEEEeCCCeEEEEEE
Confidence            7  889999999999999999998877655443      56799999995  35999999999999997
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a12a_ b.69.5.1 (A:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure