Citrus Sinensis ID: 008954

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------
MEIAPSPITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALADSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKGLKMDSKPAVNGSASVQSQILSSAQWFTSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPYE
ccccccccccccHHHHHHHHHHHHHHcccccccEEHHHHHHHHHHccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccHHHHHcccccccccccccccccHHHHcccccccccccccccccccHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHccccccccccccccccEEEEEEccccccccccEEEEccccccccHHHHccccccccEEEEcccccccccEEEccccccccccccccccccHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHHHHHccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccc
ccccccccccccHHHHHHHHHHHHHccccccccEccHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccHHHHcccccccccccccccHHHHcccccccccHcccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHcHcccccccccccccccccEEEEEEcccccHHHHHHHHHccccccccEcccccccEEEEEEEccccccccccEEEEccccccccHHHHHHHHHHHHHccccccHHHcEEEEEccccccccccEEEcccccHHHHHHHHHHHHcEEEEEEccccccccHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHcccHHHHHHHHHHcHHHHHHHHHHHcccccccccHHHHHHHHcccccHHcccccHHHHHHHHHHHHHHHHHHHHHcccccc
meiapspitfcskEHQKIYREWFdiadsdgdgritgndatkflglsKLSRQELKQIWALADSKRQGFLDLAEFVTAMKLVSLAQAGREITSDilksgglmenteppsmegLETFVAKnkglkmdskpavngsaSVQSQILSSAQwftsksvkktppsaVTSIIDGLKRLyseklkpleatyrfndfvspfltnsdfdakpMVMLlgqystgktTFIKHLLrcnypgahigpepttdRFVVvmsgpdertipgntiavhadlpfsglttfggaflskfecsqmshplldqvtfvdtpgvlsgekqrtqrtydfTGVISWFAAKCDLILLlfdphkldisDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLgkvlntpeVVRVYIGsfndkpingevvgpigQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQRefhlpggdfpnveHFREVLNSynidkfeklKPKMIQVVDDMLAYEIPELLKNFRNPYE
meiapspitfcsKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALADSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKGLKMDSKPAVNGSASVQSQILSSAQWftsksvkktppsavtsiidgLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVlsgekqrtqrtyDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIAslrgnddkirvvlnkadqvdtqQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSYnidkfeklKPKMIQVVDDMLAYEIPellknfrnpye
MEIAPSPITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALADSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKGLKMDSKPAVNGSASVQSQILSSAQWFTSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPYE
*******ITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALADSKRQGFLDLAEFVTAMKLVSLAQAGREITSDI*****************************************************************VTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKK*************RLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKN******
****PSP*TFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALADSKRQGFLDLAEFVTAMKLVSLAQAGREIT*********************************************QSQILSSAQWFTSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELL*NF*****
MEIAPSPITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALADSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKGLKMDS***********SQILSSAQWF***********AVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKKEMP*********QRLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPYE
*********FCSKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALADSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPS*E***TF*************************LSSAQWFTSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRN***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIAPSPITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALADSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKGLKMDSKPAVNGSASVQSQILSSAQWFTSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKKEMPTMMGKxxxxxxxxxxxxxxxxxxxxxFHLPGGDFPNVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPYE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query547 2.2.26 [Sep-21-2011]
Q5E9R3 534 EH domain-containing prot yes no 0.722 0.739 0.536 1e-130
Q641Z6 534 EH domain-containing prot yes no 0.722 0.739 0.533 1e-130
Q9WVK4 534 EH domain-containing prot yes no 0.722 0.739 0.533 1e-130
Q5RBP4 534 EH domain-containing prot yes no 0.722 0.739 0.533 1e-129
Q9H4M9 534 EH domain-containing prot yes no 0.722 0.739 0.533 1e-129
Q9EQP2 541 EH domain-containing prot no no 0.691 0.698 0.549 1e-124
Q9H223 541 EH domain-containing prot no no 0.691 0.698 0.547 1e-123
Q8BH64 543 EH domain-containing prot no no 0.723 0.729 0.52 1e-122
Q9NZN4 543 EH domain-containing prot no no 0.723 0.729 0.515 1e-121
Q9NZN3 535 EH domain-containing prot no no 0.714 0.730 0.526 1e-120
>sp|Q5E9R3|EHD1_BOVIN EH domain-containing protein 1 OS=Bos taurus GN=EHD1 PE=2 SV=1 Back     alignment and function desciption
 Score =  464 bits (1195), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 214/399 (53%), Positives = 291/399 (72%), Gaps = 4/399 (1%)

Query: 145 WFTSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVML 204
           W +  + +K  P    ++ +GL++LY++KL PLE  YRF++F SP L ++DFD KPMV+L
Sbjct: 4   WVSKDARRKKEPELFQTVSEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLL 63

Query: 205 LGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFS 264
           +GQYSTGKTTFI+HL+  ++PG  IGPEPTTD F+ VM GP E  +PGN + V    PF 
Sbjct: 64  VGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFR 123

Query: 265 GLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFAAKCD 324
            L  FG AFL++F C+Q+ +P+LD ++ +DTPG+LSGEKQR  R YDF  V+ WFA + D
Sbjct: 124 KLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVD 183

Query: 325 LILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV 384
            I+LLFD HKLDISDEF  VI +L+ ++DKIRVVLNKADQ++TQQLMRVYGALMWSLGK+
Sbjct: 184 RIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKI 243

Query: 385 LNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVK 444
           +NTPEVVRVYIGSF   P+    + P  ++LFE E+ DL  D+  +P+ A  R++N+ +K
Sbjct: 244 INTPEVVRVYIGSFWSHPL----LIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIK 299

Query: 445 RARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPNVEHF 504
           RAR AK+HAYIIS LKKEMP + GK   ++ L++NL + + K++RE  +  GDFPN+   
Sbjct: 300 RARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPNLRKM 359

Query: 505 REVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFR 543
           +E+L + +  KF+ LKPK++  VDDMLA +I  L+   R
Sbjct: 360 QELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVR 398
Acts in early endocytic membrane fusion and membrane trafficking of recycling endosomes.
Bos taurus (taxid: 9913)
>sp|Q641Z6|EHD1_RAT EH domain-containing protein 1 OS=Rattus norvegicus GN=Ehd1 PE=1 SV=1 Back     alignment and function description
>sp|Q9WVK4|EHD1_MOUSE EH domain-containing protein 1 OS=Mus musculus GN=Ehd1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RBP4|EHD1_PONAB EH domain-containing protein 1 OS=Pongo abelii GN=EHD1 PE=2 SV=1 Back     alignment and function description
>sp|Q9H4M9|EHD1_HUMAN EH domain-containing protein 1 OS=Homo sapiens GN=EHD1 PE=1 SV=2 Back     alignment and function description
>sp|Q9EQP2|EHD4_MOUSE EH domain-containing protein 4 OS=Mus musculus GN=Ehd4 PE=1 SV=1 Back     alignment and function description
>sp|Q9H223|EHD4_HUMAN EH domain-containing protein 4 OS=Homo sapiens GN=EHD4 PE=1 SV=1 Back     alignment and function description
>sp|Q8BH64|EHD2_MOUSE EH domain-containing protein 2 OS=Mus musculus GN=Ehd2 PE=1 SV=1 Back     alignment and function description
>sp|Q9NZN4|EHD2_HUMAN EH domain-containing protein 2 OS=Homo sapiens GN=EHD2 PE=1 SV=2 Back     alignment and function description
>sp|Q9NZN3|EHD3_HUMAN EH domain-containing protein 3 OS=Homo sapiens GN=EHD3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
225469630545 PREDICTED: EH domain-containing protein 0.996 1.0 0.829 0.0
297742906575 unnamed protein product [Vitis vinifera] 0.996 0.947 0.790 0.0
449455368545 PREDICTED: EH domain-containing protein 0.996 1.0 0.802 0.0
449487642545 PREDICTED: EH domain-containing protein 0.996 1.0 0.800 0.0
255554741545 EH-domain-containing protein, putative [ 0.994 0.998 0.789 0.0
225460867545 PREDICTED: EH domain-containing protein 0.996 1.0 0.793 0.0
356522037545 PREDICTED: EH domain-containing protein 0.996 1.0 0.795 0.0
356564470545 PREDICTED: EH domain-containing protein 0.994 0.998 0.793 0.0
297813815545 calcium-binding EF hand family protein [ 0.981 0.985 0.794 0.0
42566321546 EPS15 homology domain 2 protein [Arabido 0.981 0.983 0.788 0.0
>gi|225469630|ref|XP_002264320.1| PREDICTED: EH domain-containing protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  948 bits (2450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/547 (82%), Positives = 492/547 (89%), Gaps = 2/547 (0%)

Query: 1   MEIAPSPITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALA 60
           MEIA  PI+ CSK +QKIY+EWF+ ADSD DGRITGNDATKF  +S LSR ELKQ+WA+A
Sbjct: 1   MEIASVPISSCSKHNQKIYQEWFNYADSDNDGRITGNDATKFFAMSNLSRSELKQVWAIA 60

Query: 61  DSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKG 120
           DSKRQGFL   EF+TAM+LVSLAQAG EITSDILK+   +EN EPPSMEGL   +AKNK 
Sbjct: 61  DSKRQGFLGFREFITAMQLVSLAQAGNEITSDILKTTVDLENLEPPSMEGLNALLAKNKV 120

Query: 121 LKMDSKPAVNGSASVQSQILSSAQWFTSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEAT 180
              + +  +NG +  Q     SA WFTSKSVKK P ++VTSIIDGLKRLY+EKLKPLE T
Sbjct: 121 STNNGELELNGDSRPQPS--PSAPWFTSKSVKKAPLNSVTSIIDGLKRLYNEKLKPLEVT 178

Query: 181 YRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVV 240
           YR+NDFVSP LT+SDFDAKPMVMLLGQYSTGKTTFIKHLL CN+PGAHIGPEPTTDRFVV
Sbjct: 179 YRYNDFVSPLLTHSDFDAKPMVMLLGQYSTGKTTFIKHLLGCNFPGAHIGPEPTTDRFVV 238

Query: 241 VMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLS 300
           VMSGPDER+IPGNTIAV+A++PF+GLTTFGGAFLSKFECSQ+ H LL+ +TFVDTPGVLS
Sbjct: 239 VMSGPDERSIPGNTIAVNAEMPFNGLTTFGGAFLSKFECSQIPHSLLEHITFVDTPGVLS 298

Query: 301 GEKQRTQRTYDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLN 360
           GEKQRTQR+YDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLN
Sbjct: 299 GEKQRTQRSYDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLN 358

Query: 361 KADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQ 420
           KADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKP+N   VGPIG++LFEKEQ
Sbjct: 359 KADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPVNEAAVGPIGKDLFEKEQ 418

Query: 421 DDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNL 480
           DDLL DLIDIPKKACDR+INEFVKRARAAKIHAYIISHLKKEMP MMGKAKAQQRL DNL
Sbjct: 419 DDLLADLIDIPKKACDRRINEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLTDNL 478

Query: 481 EDEFAKVQREFHLPGGDFPNVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLK 540
           EDEFAK+QREFHLP GDFPNVEHFREVLN Y+IDKFEKLKPKMIQ VDDML Y+IPELLK
Sbjct: 479 EDEFAKIQREFHLPAGDFPNVEHFREVLNGYSIDKFEKLKPKMIQAVDDMLGYDIPELLK 538

Query: 541 NFRNPYE 547
           NFRNPYE
Sbjct: 539 NFRNPYE 545

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297742906|emb|CBI35707.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449455368|ref|XP_004145425.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487642|ref|XP_004157728.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255554741|ref|XP_002518408.1| EH-domain-containing protein, putative [Ricinus communis] gi|223542253|gb|EEF43795.1| EH-domain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225460867|ref|XP_002277794.1| PREDICTED: EH domain-containing protein 1 [Vitis vinifera] gi|297737489|emb|CBI26690.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356522037|ref|XP_003529656.1| PREDICTED: EH domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356564470|ref|XP_003550477.1| PREDICTED: EH domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|297813815|ref|XP_002874791.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] gi|297320628|gb|EFH51050.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42566321|ref|NP_567299.2| EPS15 homology domain 2 protein [Arabidopsis thaliana] gi|190576487|gb|ACE79044.1| At4g05520 [Arabidopsis thaliana] gi|332657129|gb|AEE82529.1| EPS15 homology domain 2 protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
TAIR|locus:2135462546 EHD2 "EPS15 homology domain 2" 0.976 0.978 0.791 1.2e-232
TAIR|locus:2092419545 EHD1 "EPS15 homology domain 1" 0.996 1.0 0.778 5.9e-231
UNIPROTKB|F1RQR4 558 EHD1 "Uncharacterized protein" 0.742 0.727 0.527 2.3e-119
WB|WBGene00004373 835 rme-1 [Caenorhabditis elegans 0.722 0.473 0.546 5.2e-119
UNIPROTKB|Q5E9R3 534 EHD1 "EH domain-containing pro 0.714 0.732 0.539 3.3e-118
MGI|MGI:1341878 534 Ehd1 "EH-domain containing 1" 0.714 0.732 0.536 5.4e-118
RGD|1309017 534 Ehd1 "EH-domain containing 1" 0.714 0.732 0.536 5.4e-118
UNIPROTKB|Q641Z6 534 Ehd1 "EH domain-containing pro 0.714 0.732 0.536 5.4e-118
UNIPROTKB|F1PSK6471 EHD1 "Uncharacterized protein" 0.722 0.838 0.533 6.9e-118
UNIPROTKB|Q9H4M9 534 EHD1 "EH domain-containing pro 0.714 0.732 0.536 8.8e-118
TAIR|locus:2135462 EHD2 "EPS15 homology domain 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2244 (795.0 bits), Expect = 1.2e-232, P = 1.2e-232
 Identities = 425/537 (79%), Positives = 475/537 (88%)

Query:    11 CSKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALADSKRQGFLDL 70
             C KEHQKIY+EWF+IADSDGDGR++GNDATKF  +SKLSRQELKQ+WA+ADSKRQGFL L
Sbjct:    12 CLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLGL 71

Query:    71 AEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKGLKMDSKPAVN 130
             +EF+TAMKLVSLAQ G EITSD+LK    M++ E P +EGLE  V+K K  K +    V 
Sbjct:    72 SEFITAMKLVSLAQEGHEITSDLLKGSIDMKSVELPVLEGLENVVSKQKVSKTNVD--VE 129

Query:   131 GSASVQSQILSSAQWFTSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPF 190
              +   + Q+ +   WF SKS+ K P   V +I+DGLKRLY+EKLKPLE TYRFNDF SP 
Sbjct:   130 DNVVTKPQVTAKTPWFKSKSIIK-PQVNVVTIVDGLKRLYTEKLKPLEVTYRFNDFASPV 188

Query:   191 LTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTI 250
             LT+SDFDAKPMVMLLGQYSTGKTTFIKHLL C+YPGAHIGPEPTTDRFVV MSGPDERTI
Sbjct:   189 LTSSDFDAKPMVMLLGQYSTGKTTFIKHLLGCDYPGAHIGPEPTTDRFVVAMSGPDERTI 248

Query:   251 PGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTY 310
             PGNT+AV AD+PF+GLT+FGGAFLSKFECSQM HP+LDQ+T VDTPGVLSGEKQR QR+Y
Sbjct:   249 PGNTMAVQADMPFNGLTSFGGAFLSKFECSQMPHPVLDQITLVDTPGVLSGEKQRMQRSY 308

Query:   311 DFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQL 370
             DFTGVISWFA+KCD+ILLLFDPHKLDISDEFKRVI SLRGN+DKIRVVLNKADQVDTQQL
Sbjct:   309 DFTGVISWFASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQL 368

Query:   371 MRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDI 430
             MRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPIN   VGPIG+ELFEKEQ+DLL DL+D+
Sbjct:   369 MRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINEVAVGPIGKELFEKEQNDLLADLMDV 428

Query:   431 PKKACDRQINEFVKRARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQRE 490
             PKKACDR+INEFVKRAR+AKI+AYI+SHLKKEMP MMGK+KAQQRL+DNLE+EF KVQRE
Sbjct:   429 PKKACDRKINEFVKRARSAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVQRE 488

Query:   491 FHLPGGDFPNVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPYE 547
             FHLP GDFP+VEHFREVL  YNIDKFEKLKPKMIQ VDDML Y+IP+LLK FRNPY+
Sbjct:   489 FHLPAGDFPSVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD 545
GO:0003924 "GTPase activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0005525 "GTP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0006897 "endocytosis" evidence=RCA;IMP
GO:0016020 "membrane" evidence=IDA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2092419 EHD1 "EPS15 homology domain 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQR4 EHD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00004373 rme-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9R3 EHD1 "EH domain-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1341878 Ehd1 "EH-domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309017 Ehd1 "EH-domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q641Z6 Ehd1 "EH domain-containing protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PSK6 EHD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H4M9 EHD1 "EH domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5RBP4EHD1_PONABNo assigned EC number0.53380.72210.7397yesno
Q9H4M9EHD1_HUMANNo assigned EC number0.53380.72210.7397yesno
Q641Z6EHD1_RATNo assigned EC number0.53380.72210.7397yesno
Q5E9R3EHD1_BOVINNo assigned EC number0.53630.72210.7397yesno
Q9WVK4EHD1_MOUSENo assigned EC number0.53380.72210.7397yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
cd09913241 cd09913, EHD, Eps15 homology domain (EHD), C-termi 1e-138
pfam00350168 pfam00350, Dynamin_N, Dynamin family 1e-27
cd0005267 cd00052, EH, Eps15 homology domain; found in prote 6e-24
smart0002796 smart00027, EH, Eps15 homology domain 2e-17
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 4e-11
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 9e-09
pfam12763104 pfam12763, efhand_3, Cytoskeletal-regulatory compl 2e-06
cd00880161 cd00880, Era_like, E 7e-06
cd11383140 cd11383, YfjP, YfjP GTPase 5e-05
TIGR03918391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 7e-05
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 7e-05
cd04163168 cd04163, Era, E 8e-05
PRK00089292 PRK00089, era, GTPase Era; Reviewed 3e-04
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 3e-04
cd00881183 cd00881, GTP_translation_factor, GTP translation f 0.002
>gnl|CDD|206740 cd09913, EHD, Eps15 homology domain (EHD), C-terminal domain Back     alignment and domain information 
 Score =  400 bits (1029), Expect = e-138
 Identities = 155/245 (63%), Positives = 184/245 (75%), Gaps = 4/245 (1%)

Query: 201 MVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHAD 260
           MV+ LGQYSTGK+TFI +LL  +YPG   GPEPTTDRF VVM G D+ TIPGN + V  D
Sbjct: 1   MVLFLGQYSTGKSTFINYLLGQDYPGLRTGPEPTTDRFTVVMHGEDDGTIPGNALVVDPD 60

Query: 261 LPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFA 320
            PF GL+ FG  FL+KFE S + HPLL+ VT VDTPG+LSGEKQR  R YDF  V  WFA
Sbjct: 61  KPFRGLSKFGNGFLNKFEGSTLPHPLLESVTIVDTPGILSGEKQRQSRGYDFNAVCRWFA 120

Query: 321 AKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWS 380
            + DLI LLFDPHKLDISDEF+RVI  L+G++ KIR+VLNKAD VDTQQLMRVYGALMWS
Sbjct: 121 ERADLIFLLFDPHKLDISDEFRRVIEQLKGHESKIRIVLNKADMVDTQQLMRVYGALMWS 180

Query: 381 LGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQIN 440
           L KV+NTPEV RVYIGSF D+P          ++LF +E+ DLL DL  +P+ A  R++N
Sbjct: 181 LSKVINTPEVPRVYIGSFWDQPYE----PDTNRKLFLEEEIDLLRDLNSLPRNAALRKLN 236

Query: 441 EFVKR 445
           + +KR
Sbjct: 237 DLIKR 241

Dynamin-like C-terminal Eps15 homology domain (EHD) proteins regulate endocytic events; they have been linked to a number of Rab proteins through their association with mutual effectors, suggesting a coordinate role in endocytic regulation. Eukaryotic EHDs comprise four members (EHD1-4) in mammals and single members in Caenorhabditis elegans (Rme-1), Drosophila melanogaster (Past1) as well as several eukaryotic parasites. EHD1 regulates trafficking of multiple receptors from the endocytic recycling compartment (ERC) to the plasma membrane; EHD2 regulates trafficking from the plasma membrane by controlling Rac1 activity; EHD3 regulates endosome-to-Golgi transport, and preserves Golgi morphology; EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward the recycling compartment as well as late endocytic pathway. Rme-1, an ortholog of human EHD1, controls the recycling of internalized receptors from the endocytic recycling compartment to the plasma membrane. In D. melanogaster, deletion of the Past1 gene leads to infertility as well as premature death of adult flies. Arabidopsis thaliana also has homologs of EHD proteins (AtEHD1 and AtEHD2), possibly involved in regulating endocytosis and signaling. Length = 241
>gnl|CDD|215874 pfam00350, Dynamin_N, Dynamin family Back     alignment and domain information
>gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>gnl|CDD|197477 smart00027, EH, Eps15 homology domain Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information
>gnl|CDD|193239 pfam12763, efhand_3, Cytoskeletal-regulatory complex EF hand Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206743 cd11383, YfjP, YfjP GTPase Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 547
KOG1954 532 consensus Endocytosis/signaling protein EHD1 [Sign 100.0
COG1159298 Era GTPase [General function prediction only] 100.0
COG0486454 ThdF Predicted GTPase [General function prediction 99.97
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.95
PRK00089292 era GTPase Era; Reviewed 99.95
PRK15494339 era GTPase Era; Provisional 99.94
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.92
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.92
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.91
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.86
COG1160444 Predicted GTPases [General function prediction onl 99.84
COG1160 444 Predicted GTPases [General function prediction onl 99.82
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.79
PRK09866 741 hypothetical protein; Provisional 99.74
PRK12298390 obgE GTPase CgtA; Reviewed 99.72
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.71
PRK00093435 GTP-binding protein Der; Reviewed 99.7
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.69
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.69
PRK03003472 GTP-binding protein Der; Reviewed 99.69
COG0218200 Predicted GTPase [General function prediction only 99.68
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 99.67
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.67
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.65
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.65
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.64
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.64
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.63
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.62
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.62
COG1084346 Predicted GTPase [General function prediction only 99.62
cd00881189 GTP_translation_factor GTP translation factor fami 99.62
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.61
PRK12299335 obgE GTPase CgtA; Reviewed 99.61
PRK03003 472 GTP-binding protein Der; Reviewed 99.61
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.6
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.6
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.6
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 99.6
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.59
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.59
PRK12296500 obgE GTPase CgtA; Reviewed 99.59
PRK11058426 GTPase HflX; Provisional 99.58
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.58
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.57
PRK04213201 GTP-binding protein; Provisional 99.57
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.57
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.57
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.57
PRK00093 435 GTP-binding protein Der; Reviewed 99.56
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.56
PRK12297424 obgE GTPase CgtA; Reviewed 99.56
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.56
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.56
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.54
COG2262411 HflX GTPases [General function prediction only] 99.54
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.54
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.54
CHL00071409 tufA elongation factor Tu 99.54
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.54
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.54
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.53
PRK12317425 elongation factor 1-alpha; Reviewed 99.52
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.52
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.51
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.51
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.49
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.49
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.49
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.49
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.49
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.49
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.48
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.48
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.47
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.47
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.47
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.47
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.46
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.46
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.46
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.46
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.46
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.45
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.45
PLN03127447 Elongation factor Tu; Provisional 99.45
PRK12736394 elongation factor Tu; Reviewed 99.45
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.44
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.44
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.44
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.44
PLN03126478 Elongation factor Tu; Provisional 99.44
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.44
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.44
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.43
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.43
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.43
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.43
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.43
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.43
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.43
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.43
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.43
PRK12735396 elongation factor Tu; Reviewed 99.43
COG0536369 Obg Predicted GTPase [General function prediction 99.43
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.43
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.42
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.42
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.42
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.42
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.42
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.42
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.41
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.41
PRK00049396 elongation factor Tu; Reviewed 99.41
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 99.41
COG1163365 DRG Predicted GTPase [General function prediction 99.41
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.41
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.41
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.41
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.41
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.4
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.4
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.4
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.4
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.4
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 99.4
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.39
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.39
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.39
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.39
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.39
PRK05306 787 infB translation initiation factor IF-2; Validated 99.39
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.39
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.38
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.38
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.38
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.38
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.38
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.38
cd01896233 DRG The developmentally regulated GTP-binding prot 99.38
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.38
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.37
PTZ00133182 ADP-ribosylation factor; Provisional 99.37
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.37
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.37
PTZ00369189 Ras-like protein; Provisional 99.37
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.37
PTZ00141 446 elongation factor 1- alpha; Provisional 99.37
PLN00223181 ADP-ribosylation factor; Provisional 99.37
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.37
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.37
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.37
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.36
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.36
PRK10218 607 GTP-binding protein; Provisional 99.35
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 99.35
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.35
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.35
PRK00007 693 elongation factor G; Reviewed 99.35
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.35
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.34
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.34
CHL00189 742 infB translation initiation factor 2; Provisional 99.34
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.34
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.34
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.34
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.34
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.33
COG3596296 Predicted GTPase [General function prediction only 99.33
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.33
PLN03118211 Rab family protein; Provisional 99.33
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.33
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.32
PRK04004 586 translation initiation factor IF-2; Validated 99.32
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.32
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.32
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.32
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.32
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.31
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.31
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.31
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.31
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.31
PLN03110216 Rab GTPase; Provisional 99.31
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.31
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.3
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.3
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.3
PRK12739 691 elongation factor G; Reviewed 99.3
PLN03108210 Rab family protein; Provisional 99.29
COG0411250 LivG ABC-type branched-chain amino acid transport 99.29
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.29
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.29
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.28
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.28
KOG1490 620 consensus GTP-binding protein CRFG/NOG1 (ODN super 99.28
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.27
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.26
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.26
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.26
COG1217 603 TypA Predicted membrane GTPase involved in stress 99.26
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.25
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.25
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.24
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.24
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.24
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.24
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.23
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.23
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.22
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.22
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.22
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.22
KOG1145 683 consensus Mitochondrial translation initiation fac 99.22
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 99.21
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.21
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.21
PRK09602396 translation-associated GTPase; Reviewed 99.21
cd04105203 SR_beta Signal recognition particle receptor, beta 99.2
PLN00043 447 elongation factor 1-alpha; Provisional 99.2
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.2
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.19
PRK05433 600 GTP-binding protein LepA; Provisional 99.19
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.19
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.19
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.18
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.18
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.18
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.17
PTZ00416 836 elongation factor 2; Provisional 99.17
KOG1955737 consensus Ral-GTPase effector RALBP1 [Intracellula 99.17
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.16
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.16
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.16
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.15
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.15
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 99.14
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.13
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.13
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.12
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.12
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.11
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.11
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.11
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.11
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 99.1
COG0410237 LivF ABC-type branched-chain amino acid transport 99.1
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.09
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.09
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.09
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.09
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.09
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.08
PRK13351 687 elongation factor G; Reviewed 99.06
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.05
KOG0448 749 consensus Mitofusin 1 GTPase, involved in mitochon 99.05
COG1127263 Ttg2A ABC-type transport system involved in resist 99.04
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 99.04
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.04
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.03
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 99.03
KOG0410410 consensus Predicted GTP binding protein [General f 99.03
KOG0462 650 consensus Elongation factor-type GTP-binding prote 99.03
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.02
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.01
PRK09435332 membrane ATPase/protein kinase; Provisional 99.01
KOG0458603 consensus Elongation factor 1 alpha [Translation, 99.01
COG4152300 ABC-type uncharacterized transport system, ATPase 99.01
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.01
PTZ00258390 GTP-binding protein; Provisional 99.0
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 98.99
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.99
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 98.99
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 98.98
KOG0098216 consensus GTPase Rab2, small G protein superfamily 98.98
PRK07560 731 elongation factor EF-2; Reviewed 98.97
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.97
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.97
PRK13536340 nodulation factor exporter subunit NodI; Provision 98.97
PRK13537306 nodulation ABC transporter NodI; Provisional 98.96
COG2229187 Predicted GTPase [General function prediction only 98.96
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 98.96
PRK09601364 GTP-binding protein YchF; Reviewed 98.96
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.95
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 98.95
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 98.94
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.94
PRK12740 668 elongation factor G; Reviewed 98.94
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.93
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 98.93
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.92
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 98.92
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 98.92
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 98.91
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 98.91
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 98.91
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.91
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 98.91
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 98.91
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 98.91
COG4161242 ArtP ABC-type arginine transport system, ATPase co 98.9
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 98.9
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 98.9
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 98.89
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.89
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 98.89
cd0005267 EH Eps15 homology domain; found in proteins implic 98.89
COG5019373 CDC3 Septin family protein [Cell division and chro 98.89
PRK11153343 metN DL-methionine transporter ATP-binding subunit 98.89
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.88
PLN00023334 GTP-binding protein; Provisional 98.88
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 98.88
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.87
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 98.87
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 98.87
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 98.87
cd03246173 ABCC_Protease_Secretion This family represents the 98.87
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 98.87
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 98.86
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 98.86
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 98.86
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 98.86
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 98.86
KOG0078207 consensus GTP-binding protein SEC4, small G protei 98.86
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 98.86
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 98.85
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 98.85
cd03269210 ABC_putative_ATPase This subfamily is involved in 98.85
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.85
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 98.85
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 98.85
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 98.85
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 98.85
PRK13768253 GTPase; Provisional 98.85
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 98.85
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 98.85
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 98.85
cd03215182 ABC_Carb_Monos_II This family represents domain II 98.85
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 98.85
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 98.84
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 98.84
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 98.84
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 98.84
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 98.84
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 98.84
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 98.83
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 98.83
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 98.83
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 98.83
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 98.83
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 98.83
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 98.83
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 98.82
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 98.82
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 98.82
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 98.82
PRK10908222 cell division protein FtsE; Provisional 98.82
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 98.81
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 98.81
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 98.81
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 98.81
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 98.81
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 98.8
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 98.8
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.8
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 98.8
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 98.8
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 98.8
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 98.79
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.79
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 98.79
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 98.79
COG1100219 GTPase SAR1 and related small G proteins [General 98.79
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 98.79
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.79
COG4175386 ProV ABC-type proline/glycine betaine transport sy 98.79
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.78
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 98.78
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 98.78
COG4525259 TauB ABC-type taurine transport system, ATPase com 98.78
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 98.78
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 98.78
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 98.78
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 98.77
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 98.77
PRK11607377 potG putrescine transporter ATP-binding subunit; P 98.77
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 98.77
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 98.77
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 98.77
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 98.77
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 98.77
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 98.76
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.76
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 98.76
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 98.76
COG4181228 Predicted ABC-type transport system involved in ly 98.75
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.75
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 98.75
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 98.75
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 98.75
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 98.74
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 98.74
COG4148352 ModC ABC-type molybdate transport system, ATPase c 98.74
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 98.74
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 98.74
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 98.74
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 98.74
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 98.74
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 98.73
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 98.73
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 98.73
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 98.73
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 98.73
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 98.73
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 98.73
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 98.73
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 98.72
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 98.72
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 98.72
PRK10619257 histidine/lysine/arginine/ornithine transporter su 98.72
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 98.72
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 98.72
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.72
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 98.72
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 98.72
PLN03211 659 ABC transporter G-25; Provisional 98.72
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 98.71
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.71
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 98.71
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 98.71
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 98.7
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 98.7
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 98.7
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.7
PRK14242253 phosphate transporter ATP-binding protein; Provisi 98.7
COG5257415 GCD11 Translation initiation factor 2, gamma subun 98.7
PRK10253265 iron-enterobactin transporter ATP-binding protein; 98.7
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 98.69
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 98.69
cd03234226 ABCG_White The White subfamily represents ABC tran 98.69
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 98.69
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 98.68
PRK09984262 phosphonate/organophosphate ester transporter subu 98.68
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 98.68
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 98.68
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 98.68
PRK09473330 oppD oligopeptide transporter ATP-binding componen 98.68
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 98.68
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 98.68
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 98.68
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.68
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.67
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 98.67
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 98.67
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 98.67
PRK09700510 D-allose transporter ATP-binding protein; Provisio 98.67
KOG0093193 consensus GTPase Rab3, small G protein superfamily 98.66
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 98.66
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.66
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 98.66
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 98.66
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 98.66
COG0050394 TufB GTPases - translation elongation factors [Tra 98.65
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 98.65
PRK14235267 phosphate transporter ATP-binding protein; Provisi 98.65
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 98.65
PRK10261 623 glutathione transporter ATP-binding protein; Provi 98.65
PRK14241258 phosphate transporter ATP-binding protein; Provisi 98.65
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 98.65
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 98.65
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 98.65
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 98.65
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 98.64
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 98.64
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 98.64
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 98.64
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 98.64
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 98.64
PRK11288501 araG L-arabinose transporter ATP-binding protein; 98.64
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 98.64
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 98.63
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 98.63
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 98.63
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.63
KOG0461 522 consensus Selenocysteine-specific elongation facto 98.63
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 98.63
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 98.63
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 98.62
cd03299235 ABC_ModC_like Archeal protein closely related to M 98.62
COG3276 447 SelB Selenocysteine-specific translation elongatio 98.62
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 98.62
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 98.62
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 98.62
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.61
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 98.61
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 98.61
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 98.61
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.61
PRK09580248 sufC cysteine desulfurase ATPase component; Review 98.61
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=5.6e-85  Score=630.12  Aligned_cols=388  Identities=62%  Similarity=1.055  Sum_probs=379.8

Q ss_pred             CchhhHHHHHHHHHHHHhhchhhhhhhccCCccccccCCCCCCCCcEEEEeeCCCCChhHHHHHHHhCCCCCCCCCCCcc
Q 008954          155 PPSAVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPT  234 (547)
Q Consensus       155 ~~~~~~~~id~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~g~~V~lvG~~~aGKSTLiN~Llg~~~~~~~v~~~~~  234 (547)
                      .......+.++|+++|.++++|||..|+|++|+++++.+.+|+.+|+|+++|+++.|||||||+|++.++||+.+|++||
T Consensus        14 ~~~~~~tv~~glkrlY~~kl~PLE~~Yrf~df~sp~l~d~dfd~KPmill~GqyStGKTtfi~yLle~dypg~riGpEPT   93 (532)
T KOG1954|consen   14 NPEVLQTVSEGLKRLYKQKLLPLEELYRFHDFHSPALEDPDFDAKPMILLVGQYSTGKTTFIRYLLEQDYPGLRIGPEPT   93 (532)
T ss_pred             CcchHHHHHHHHHHHHHHhcccHHHHHhhhhcccccccCcccccCceEEEEeccccchhHHHHHHHhCCCCccccCCCCC
Confidence            44566778889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cceeEEEEeCCCccccCCceeeecCCCCCCCccccccchhhhhhhhcccccccccceEEcCCCCCChhhhhhhcccChHH
Q 008954          235 TDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTG  314 (547)
Q Consensus       235 T~~~~~i~~~~~~~~~~g~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~ll~~l~lvDTPG~~~~~~~~~~~~~~~~~  314 (547)
                      |++|.++|+|+.+..+||++++++...+|++++.||+.|++++.|.++|+++|+++++|||||++++++|+++|+|+|.+
T Consensus        94 td~Fi~vM~G~~e~~ipGnal~vd~~~pF~gL~~FG~aflnRf~csqmp~~vLe~vtiVdtPGILsgeKQrisR~ydF~~  173 (532)
T KOG1954|consen   94 TDRFIAVMHGDEEGSIPGNALVVDAKKPFRGLNKFGNAFLNRFMCSQLPNQVLESVTIVDTPGILSGEKQRISRGYDFTG  173 (532)
T ss_pred             cceeEEEEecCcccccCCceeeecCCCchhhhhhhHHHHHHHHHHhcCChhhhhheeeeccCcccccchhcccccCChHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhcCCeEEEEecCCCCCCCHHHHHHHHHHhCCCCeEEEEeccCCCcChHHHHHHHHHHHHhhhhccCCCCcEEEE
Q 008954          315 VISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVY  394 (547)
Q Consensus       315 ~~~~~~~~aD~illv~d~~~~~~~~~~~~ll~~l~~~~~~iivVlNK~D~~~~~~l~~~~~~l~~~l~~~~~~~~v~~v~  394 (547)
                      +++|+++++|.||+++|++++++++++.++|..++.+..++.||+||+|.++.++++++++++||+++++++++++.++|
T Consensus       174 v~~WFaeR~D~IiLlfD~hKLDIsdEf~~vi~aLkG~EdkiRVVLNKADqVdtqqLmRVyGALmWslgkv~nTpev~rvY  253 (532)
T KOG1954|consen  174 VLEWFAERVDRIILLFDAHKLDISDEFKRVIDALKGHEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVMNTPEVSRVY  253 (532)
T ss_pred             HHHHHHHhccEEEEEechhhccccHHHHHHHHHhhCCcceeEEEeccccccCHHHHHHHHHHHHHhhhhhcCCCcceeEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecccCCCCCCCCCCCCcchHhhHHHHHHHHHHHhhchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccHHHHH
Q 008954          395 IGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKKEMPTMMGKAKAQQ  474 (547)
Q Consensus       395 isa~~~~~l~~~~~~~~~~~~~~~~~e~l~~~l~~~~~~~~~~~i~~~~~~~~~~~i~a~i~~~~~~~~~~~~gk~~~~~  474 (547)
                      ++|+|..++.+    +..+.+|+.++.+++++++.+|..++.++++++++|++++++||+|+.+++++||.++||.+++.
T Consensus       254 igSfw~hPl~~----~a~rrLfeaee~dl~rDlq~lp~ka~~rKind~ikrAr~akvHAyiis~lkkemp~~~gk~~~kk  329 (532)
T KOG1954|consen  254 IGSFWDHPLQD----PANRRLFEAEEQDLFRDLQTLPRKAALRKLNDLIKRARLAKVHAYIISCLKKEMPSVFGKEKKKK  329 (532)
T ss_pred             eeccccCcccC----ccHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcchhhHH
Confidence            99999999986    56789999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhCCCCCCCCCHHHHHHHHhcCCCCccccCChHHHHHHHHHHHhhHHHHhhhhcCCC
Q 008954          475 RLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPY  546 (547)
Q Consensus       475 ~~i~~l~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  546 (547)
                      +++.+|.+||.++++++++++||||++++||++|+.++|++|+.|++++|+.+|+||++|||+||..+++++
T Consensus       330 ~lidnl~~iy~~l~re~~Is~gDfPd~~~mre~l~~~df~kF~~lkpklle~vD~mla~di~~Lm~~~kkee  401 (532)
T KOG1954|consen  330 RLIDNLIDIYEKLQREHNISPGDFPDVEKMREFLQTQDFSKFKPLKPKLLEVVDDMLAYDIAELMGKIKKEE  401 (532)
T ss_pred             HHHHhHHHHHHHHhHhhcCCCcCCCCHHHHHHHHhcCChhhccccCccHHHHHHHHHHhhHHHHHHHhcchh
Confidence            999999999999999999999999999999999999999999999999999999999999999999999875

>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
2qpt_A 550 Crystal Structure Of An Ehd Atpase Involved In Memb 1e-123
1qjt_A99 Solution Structure Of The Apo Eh1 Domain Of Mouse E 2e-06
2kgr_A111 Solution Structure Of Protein Itsn1 From Homo Sapie 2e-06
2khn_A121 Nmr Solution Structure Of The Eh 1 Domain From Huma 5e-06
2kff_A105 Structure Of The C-Terminal Domain Of Ehd1 With Fny 5e-06
2jq6_A139 Structure Of Eh-Domain Of Ehd1 Length = 139 7e-06
1fi6_A92 Solution Structure Of The Reps1 Eh Domain Length = 4e-05
3fia_A121 Crystal Structure Of The Eh 1 Domain From Human Int 5e-05
1iq3_A110 Solution Structure Of The Eps15 Homology Domain Of 1e-04
>pdb|2QPT|A Chain A, Crystal Structure Of An Ehd Atpase Involved In Membrane Remodelling Length = 550 Back     alignment and structure 
Iteration: 1

 Score =  439 bits (1130), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/400 (52%), Positives = 280/400 (70%), Gaps = 4/400 (1%)
Query: 145 WFTSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVML 204
           W      +   P A+ ++   LK LY  KL PLE  YRF  F SP L ++DFD KPMV++
Sbjct: 11  WLKKGGARGQRPEAIRTVTSSLKELYRTKLLPLEEHYRFGSFHSPALEDADFDGKPMVLV 70
Query: 205 LGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFS 264
            GQYSTGKT+FI++LL    PG+ +GPEPTTD FV VM G  E T+PGN + V  + PF 
Sbjct: 71  AGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGETEGTVPGNALVVDPEKPFR 130
Query: 265 GLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFAAKCD 324
            L  FG  FL++F C+Q+ + +L+ ++ +DTPG+LSG KQR  R YDF  V+ WFA + D
Sbjct: 131 KLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAERVD 190
Query: 325 LILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKV 384
           LI+LLFD HKL+ISDEF   I +LRG++DKIRVVLNKAD V+TQQLMRVYGALMW+LGKV
Sbjct: 191 LIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWALGKV 250
Query: 385 LNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVK 444
           + TPEV+RVYIGSF  +P+    + P  + LFE E+ DL  D+  +P+ A  R++N+ VK
Sbjct: 251 VGTPEVLRVYIGSFWSQPL----LVPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVK 306
Query: 445 RARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPNVEHF 504
           RAR  ++HAYIIS+LKKEMPT+ GK   +++LI  L   FAK+Q E H+  GDFP+ +  
Sbjct: 307 RARLVRVHAYIISYLKKEMPTVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPDCQKM 366
Query: 505 REVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRN 544
           +E+L +++  KF  LKPK+++ +DDMLA +I +L+   R 
Sbjct: 367 QELLMAHDFTKFHSLKPKLLEALDDMLAQDIAKLMPLLRQ 406
>pdb|1QJT|A Chain A, Solution Structure Of The Apo Eh1 Domain Of Mouse Epidermal Growth Factor Receptor Substrate 15, Eps15 Length = 99 Back     alignment and structure
>pdb|2KGR|A Chain A, Solution Structure Of Protein Itsn1 From Homo Sapiens. Northeast Structural Genomics Consortium Target Hr5524a Length = 111 Back     alignment and structure
>pdb|2KHN|A Chain A, Nmr Solution Structure Of The Eh 1 Domain From Human Intersectin-1 Protein. Northeast Structural Genomics Consortium Target Hr3646e Length = 121 Back     alignment and structure
>pdb|2KFF|A Chain A, Structure Of The C-Terminal Domain Of Ehd1 With Fnyestnpftak Length = 105 Back     alignment and structure
>pdb|2JQ6|A Chain A, Structure Of Eh-Domain Of Ehd1 Length = 139 Back     alignment and structure
>pdb|1FI6|A Chain A, Solution Structure Of The Reps1 Eh Domain Length = 92 Back     alignment and structure
>pdb|3FIA|A Chain A, Crystal Structure Of The Eh 1 Domain From Human Intersectin- 1 Protein. Northeast Structural Genomics Consortium Target Hr3646e Length = 121 Back     alignment and structure
>pdb|1IQ3|A Chain A, Solution Structure Of The Eps15 Homology Domain Of A Human Pob1 Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 1e-163
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 2e-20
1qjt_A99 EH1, epidermal growth factor receptor substrate su 7e-28
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 4e-26
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 1e-25
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 1e-25
1c07_A95 Protein (epidermal growth factor receptor pathway 9e-24
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 1e-23
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 2e-22
2jq6_A139 EH domain-containing protein 1; metal binding prot 3e-22
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 2e-13
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 6e-08
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 2e-07
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-04
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 3e-07
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-07
3li6_A66 Calcium-binding protein; calcium signaling protein 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 5e-07
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 5e-07
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-04
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 5e-07
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 5e-07
2hps_A186 Coelenterazine-binding protein with bound coelent; 5e-07
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-06
1y1x_A191 Leishmania major homolog of programmed cell death 1e-06
1y1x_A191 Leishmania major homolog of programmed cell death 3e-04
1avs_A90 Troponin C; muscle contraction, calcium-activated, 1e-06
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-06
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-05
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 1e-06
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-06
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 6e-04
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 2e-06
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-06
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 2e-06
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 2e-06
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 2e-06
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-06
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 4e-06
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 3e-06
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 6e-04
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 5e-06
3fwb_A161 Cell division control protein 31; gene gating, com 5e-06
1exr_A148 Calmodulin; high resolution, disorder, metal trans 6e-06
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 7e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 7e-06
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 7e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 8e-06
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 8e-06
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 3e-04
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 8e-06
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 8e-06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 1e-05
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 1e-05
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-05
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-05
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 1e-05
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 2e-05
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 2e-05
2jnf_A158 Troponin C; stretch activated muscle contraction, 3e-05
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 3e-05
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 3e-05
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 3e-05
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 4e-05
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 5e-05
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 9e-05
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 1e-04
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 1e-04
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 1e-04
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 1e-04
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 2e-04
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 2e-04
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 2e-04
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 3e-04
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 2e-04
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-04
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 3e-04
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 2e-04
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-04
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 3e-04
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 4e-04
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 4e-04
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 5e-04
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 6e-04
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 7e-04
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 7e-04
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 7e-04
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 8e-04
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 8e-04
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 9e-04
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure
 Score =  474 bits (1221), Expect = e-163
 Identities = 209/405 (51%), Positives = 281/405 (69%), Gaps = 4/405 (0%)

Query: 141 SSAQWFTSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKP 200
           S   W      +   P A+ ++   LK LY  KL PLE  YRF  F SP L ++DFD KP
Sbjct: 7   SMFSWLKKGGARGQRPEAIRTVTSSLKELYRTKLLPLEEHYRFGSFHSPALEDADFDGKP 66

Query: 201 MVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHAD 260
           MV++ GQYSTGKT+FI++LL    PG+ +GPEPTTD FV VM G  E T+PGN + V  +
Sbjct: 67  MVLVAGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGETEGTVPGNALVVDPE 126

Query: 261 LPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFA 320
            PF  L  FG  FL++F C+Q+ + +L+ ++ +DTPG+LSG KQR  R YDF  V+ WFA
Sbjct: 127 KPFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFA 186

Query: 321 AKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWS 380
            + DLI+LLFD HKL+ISDEF   I +LRG++DKIRVVLNKAD V+TQQLMRVYGALMW+
Sbjct: 187 ERVDLIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWA 246

Query: 381 LGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQIN 440
           LGKV+ TPEV+RVYIGSF  +P+    + P  + LFE E+ DL  D+  +P+ A  R++N
Sbjct: 247 LGKVVGTPEVLRVYIGSFWSQPL----LVPDNRRLFELEEQDLFRDIQGLPRHAALRKLN 302

Query: 441 EFVKRARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPN 500
           + VKRAR  ++HAYIIS+LKKEMPT+ GK   +++LI  L   FAK+Q E H+  GDFP+
Sbjct: 303 DLVKRARLVRVHAYIISYLKKEMPTVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPD 362

Query: 501 VEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNP 545
            +  +E+L +++  KF  LKPK+++ +DDMLA +I +L+   R  
Sbjct: 363 CQKMQELLMAHDFTKFHSLKPKLLEALDDMLAQDIAKLMPLLRQE 407
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Length = 695 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 100.0
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.92
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.89
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.89
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.88
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.87
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.83
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 99.74
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.71
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.7
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.67
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.67
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.67
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.66
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.64
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.63
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.63
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.62
1c07_A95 Protein (epidermal growth factor receptor pathway 99.62
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.61
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.61
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.61
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.6
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.59
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.59
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.59
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.58
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.58
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.58
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.58
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.57
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.57
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.57
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.57
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.56
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.56
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.55
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.55
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.55
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.55
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.54
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.53
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.53
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.53
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.53
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.53
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.53
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.52
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.52
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.52
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.52
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.52
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.52
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.52
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.52
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.51
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.51
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.51
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.5
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.5
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.5
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.5
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.5
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.5
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.5
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.5
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.49
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.49
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.49
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.49
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.49
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.49
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.49
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.49
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.49
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.49
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.49
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.48
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.48
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.48
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.48
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.48
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.48
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.48
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.47
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.47
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.47
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.47
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.47
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.47
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.47
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.47
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.47
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.46
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.46
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.46
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.46
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.46
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.46
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.46
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.46
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.46
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.46
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.46
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.45
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.45
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.45
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.45
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.45
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.45
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.45
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.44
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.44
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.44
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.44
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.44
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.44
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.44
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.44
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.44
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.43
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.43
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.43
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.43
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.43
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.43
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.43
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.42
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.42
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.42
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.42
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.42
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.42
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.42
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.42
2ged_A193 SR-beta, signal recognition particle receptor beta 99.41
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.41
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.41
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.41
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.41
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.4
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.4
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.4
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.4
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.39
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.39
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.38
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.38
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.38
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.37
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.37
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.37
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.37
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.36
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.36
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.36
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.36
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.05
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.36
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.36
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.35
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.35
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.35
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.35
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.34
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.34
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.34
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.34
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.33
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.33
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.32
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.31
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.31
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.31
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.3
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.3
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.3
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.29
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.29
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.29
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.28
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.26
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.25
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.25
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.25
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.24
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.23
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.23
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.23
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.22
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.2
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.2
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.2
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.19
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.19
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.19
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.19
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 99.19
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.16
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.15
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.15
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 99.13
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.12
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.12
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.12
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.09
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.08
1g6h_A257 High-affinity branched-chain amino acid transport 99.07
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.07
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.07
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.07
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.07
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.07
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.06
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.03
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.02
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 99.02
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.02
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.01
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 99.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.0
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 98.99
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 98.98
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 98.98
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 98.98
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 98.97
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.97
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 98.96
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 98.96
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 98.95
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.95
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 98.93
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 98.93
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.91
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 98.9
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 98.89
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.89
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 98.89
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.88
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 98.87
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.86
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.86
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.86
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.85
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.85
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 98.85
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 98.85
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.83
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 98.82
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.82
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.82
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 98.82
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.79
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.79
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 98.77
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 98.77
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 98.76
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 98.75
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.75
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.75
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.74
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 98.74
2ghi_A260 Transport protein; multidrug resistance protein, M 98.73
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.72
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.72
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 98.72
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.71
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 98.7
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.69
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.68
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.68
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.68
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.67
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.67
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.64
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.64
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 98.64
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.64
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.63
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.63
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.63
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 98.61
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.61
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.61
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 98.61
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 98.59
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 98.59
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.59
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 98.59
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.58
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.58
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.58
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.58
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.56
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.56
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 98.54
3li6_A66 Calcium-binding protein; calcium signaling protein 98.54
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 98.52
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.51
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.51
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.51
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.5
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.5
3fwb_A161 Cell division control protein 31; gene gating, com 98.5
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.49
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.49
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.49
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.48
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.48
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.47
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.47
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.46
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.45
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.45
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.45
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 98.45
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.45
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.45
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.44
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.44
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.43
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.43
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.43
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.43
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.43
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.42
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.41
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.41
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.4
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.39
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.39
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.39
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.39
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.39
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 98.38
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.37
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.36
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.35
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.35
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 98.35
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.35
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.34
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.34
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.34
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.32
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.32
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 98.32
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 98.32
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.32
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.3
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 98.29
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.28
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.28
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 98.26
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.26
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.26
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.25
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.25
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.24
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.23
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.23
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 98.23
2og2_A359 Putative signal recognition particle receptor; nuc 98.22
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.22
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.21
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.21
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.21
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.21
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.2
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.2
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 98.2
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.19
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 98.19
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.19
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.19
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.18
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.17
3fwb_A161 Cell division control protein 31; gene gating, com 98.17
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.16
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.16
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.15
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.15
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.15
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.15
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.14
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.14
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.14
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.14
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.13
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.13
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.13
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.12
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.12
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.11
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.1
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.1
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.1
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.09
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.09
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.09
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.09
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.09
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.09
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.09
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.09
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.08
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 98.08
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.08
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.08
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.07
1y1x_A191 Leishmania major homolog of programmed cell death 98.07
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.07
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 98.06
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.06
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.06
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.06
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.06
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.05
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.04
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.04
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.03
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.03
1y1x_A191 Leishmania major homolog of programmed cell death 98.03
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.03
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.03
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.02
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 98.02
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.02
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.02
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.02
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.01
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 98.01
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.0
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 97.99
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 97.98
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 97.97
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.96
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 97.96
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 97.96
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 97.95
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 97.95
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 97.95
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 97.95
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 97.94
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 97.94
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 97.92
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 97.9
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 97.9
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 97.9
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 97.89
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 97.88
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 97.88
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 97.87
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 97.87
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 97.85
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 97.85
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 97.84
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 97.83
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 97.83
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 97.82
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 97.82
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 97.8
3akb_A166 Putative calcium binding protein; EF-hand, metal b 97.8
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.78
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 97.78
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 97.78
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 97.77
2hps_A186 Coelenterazine-binding protein with bound coelent; 97.77
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.76
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 97.76
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 97.76
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 97.76
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 97.76
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 97.76
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 97.75
3lij_A494 Calcium/calmodulin dependent protein kinase with A 97.75
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 97.75
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 97.73
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 97.73
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 97.73
3lij_A494 Calcium/calmodulin dependent protein kinase with A 97.72
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 97.71
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 97.7
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 97.7
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 97.7
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 97.69
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 97.68
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 97.68
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.67
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 97.66
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 97.66
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.65
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 97.65
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 97.65
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 97.64
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.64
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 97.63
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 97.63
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.62
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=1.3e-50  Score=438.94  Aligned_cols=398  Identities=52%  Similarity=0.921  Sum_probs=319.7

Q ss_pred             hhhhccccccCCCCchhhHHHHHHHHHHHHhhchhhhhhhccCCccccccCCCCCCCCcEEEEeeCCCCChhHHHHHHHh
Q 008954          142 SAQWFTSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  221 (547)
Q Consensus       142 ~~~~~~~~~~~~~~~~~~~~~id~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~g~~V~lvG~~~aGKSTLiN~Llg  221 (547)
                      |.+|..+...+++....+..+++.|+++|++++.+++..+.+..++.+.+.+..+...++|+|+|.+|+|||||||+|+|
T Consensus         8 ~~~~~~~~~~~~~~~~~~~~~~~~L~~~y~~~i~~le~~~~~~~~~~~~l~~~~~~~~~~V~vvG~~n~GKSTLIN~Llg   87 (550)
T 2qpt_A            8 MFSWLKKGGARGQRPEAIRTVTSSLKELYRTKLLPLEEHYRFGSFHSPALEDADFDGKPMVLVAGQYSTGKTSFIQYLLE   87 (550)
T ss_dssp             ------------------CCHHHHHHHHHHHHTHHHHHHTTGGGTTCCCCCSTTTSSCCEEEEEEBTTSCHHHHHHHHHT
T ss_pred             hhhhhcccccccccHHHHHHHHHHHHHHHHHhhhhHHHHhccccccchhcccccccCCcEEEEECCCCCCHHHHHHHHhC
Confidence            67777633322234577888999999999999999999999999998888888888889999999999999999999999


Q ss_pred             CCCCCCCCCCCcccceeEEEEeCCCccccCCceeeecCCCCCCCccccccchhhhhhhhcccccccccceEEcCCCCCCh
Q 008954          222 CNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECSQMSHPLLDQVTFVDTPGVLSG  301 (547)
Q Consensus       222 ~~~~~~~v~~~~~T~~~~~i~~~~~~~~~~g~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~ll~~l~lvDTPG~~~~  301 (547)
                      ..+.+.++++.|+|+++..+.+++.....+|.++..+...++..+..+|+.+..++.|...+++++.++.||||||+.++
T Consensus        88 ~~~~~~~vs~~p~T~~~~~i~~~~~~~i~~g~~l~~~~~~~~~~L~~~g~~~~~~~~~~~~~~~ll~~l~lIDTPG~~~~  167 (550)
T 2qpt_A           88 QEVPGSRVGPEPTTDCFVAVMHGETEGTVPGNALVVDPEKPFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSG  167 (550)
T ss_dssp             SCCSSCCCCSSCCCCSEEEEECCSSSEEECCC------------------CCCTTEEEEECCCHHHHHCEEEECCCBCC-
T ss_pred             CccccCccCCCCccceEEEEEECCcccccCCceeeecCcccHHHHhhhcccccccceEEeccccccCCEEEEECcCCCCc
Confidence            99733479999999999888888776667788877777788888888888888888889999999889999999999986


Q ss_pred             hhhhhhcccChHHHHHHHhhcCCeEEEEecCCCCCCCHHHHHHHHHHhCCCCeEEEEeccCCCcChHHHHHHHHHHHHhh
Q 008954          302 EKQRTQRTYDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSL  381 (547)
Q Consensus       302 ~~~~~~~~~~~~~~~~~~~~~aD~illv~d~~~~~~~~~~~~ll~~l~~~~~~iivVlNK~D~~~~~~l~~~~~~l~~~l  381 (547)
                      ..+.+.+.++|...+.+++.++|++|+|+|+.+.+..+++..+++.+...+.|+++|+||+|+++.+++.++++.++|++
T Consensus       168 ~~~~~~~~~~f~~~~~~~l~~aD~il~VvDa~~~~~~~~~~~~l~~l~~~~~pvilVlNK~Dl~~~~el~~~~~~l~~s~  247 (550)
T 2qpt_A          168 AKQRVSRGYDFPAVLRWFAERVDLIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWAL  247 (550)
T ss_dssp             ------CCSCHHHHHHHHHHHCSEEEEEEETTSCCCCHHHHHHHHHTTTCGGGEEEEEECGGGSCHHHHHHHHHHHHHHH
T ss_pred             chhHHHHHhhHHHHHHHHHHhCCEEEEEEeCCcCCCCHHHHHHHHHHHhcCCCEEEEEECCCccCHHHHHHHHHHhhcch
Confidence            66677777777788899999999999999998866788888899998888889999999999999889999999999999


Q ss_pred             hhccCCCCcEEEEecccCCCCCCCCCCCCcchHhhHHHHHHHHHHHhhchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 008954          382 GKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYIISHLKK  461 (547)
Q Consensus       382 ~~~~~~~~v~~v~isa~~~~~l~~~~~~~~~~~~~~~~~e~l~~~l~~~~~~~~~~~i~~~~~~~~~~~i~a~i~~~~~~  461 (547)
                      .+.++..++..++.+..+..+..    .+.....|..|.|+++..+.++|+....+.|+++.++++.++|||.|++++++
T Consensus       248 ~~i~~vs~l~~~~~~~~~~~~~~----~~~~~~~~~~E~e~l~~~l~elP~~~~v~~i~~~~~~~~~~~I~a~I~v~~~s  323 (550)
T 2qpt_A          248 GKVVGTPEVLRVYIGSFWSQPLL----VPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVKRARLVRVHAYIISYLKK  323 (550)
T ss_dssp             HHHHCCSSCCCEEESCCSSSCCS----SCTTHHHHHHHHHHHHHHHHTTGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hheeechHhhhhccccCCCCccc----CCCCHHHHHHHHHHHHHHhhhccHHHHHHHHHHHhccCCeEEEEEEEEEeecc
Confidence            88888877777787777665433    24556678888899999987777655555589999888899999999999999


Q ss_pred             hcccccccHHHHHHHHHHHHHHHHHHHHHhCCCCCCCCCHHHHHHHHhcCCCCccccCChHHHHHHHHHHHhhHHHHhhh
Q 008954          462 EMPTMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFPNVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKN  541 (547)
Q Consensus       462 ~~~~~~gk~~~~~~~i~~l~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~  541 (547)
                      |++++|||++++.+++.+|..+|.++++.|++++||||+++.|++.++.+++++|++|++++++.|+.+|++|||.||..
T Consensus       324 qk~i~iGk~g~~~~li~~l~~~~~~i~~~~~~~~~d~p~~~~~~~~~~~~~~~~f~~l~~~~~~~l~~~~~~d~~~l~~~  403 (550)
T 2qpt_A          324 EMPTVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPDCQKMQELLMAHDFTKFHSLKPKLLEALDDMLAQDIAKLMPL  403 (550)
T ss_dssp             HSCSSSCHHHHHHHHHHTHHHHHHHHHHTTCCCTTTCCCHHHHHHHHHHSCGGGSCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cceeEECCchHHHHHHHhHHHHHHHHHHHhCCCccccCCHHHHHhhhhhCChhhccccCHHHHHHHHhhhHhhHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             hc
Q 008954          542 FR  543 (547)
Q Consensus       542 ~~  543 (547)
                      ++
T Consensus       404 ~~  405 (550)
T 2qpt_A          404 LR  405 (550)
T ss_dssp             HH
T ss_pred             cc
Confidence            86
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 547
d2akab1299 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus n 1e-18
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 9e-18
d1jwyb_306 c.37.1.8 (B:) Dynamin G domain {Dictyostelium disc 3e-17
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 5e-17
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 1e-16
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 1e-15
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 2e-14
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 4e-08
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 1e-07
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 2e-07
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 2e-07
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 2e-06
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-06
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 7e-06
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 9e-06
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 2e-05
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 0.004
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 2e-05
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 3e-05
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-05
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-05
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 4e-05
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 5e-05
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 5e-05
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 1e-04
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 2e-04
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 2e-04
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-04
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 6e-04
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 6e-04
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 8e-04
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 8e-04
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 0.001
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.001
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 0.003
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 84.2 bits (207), Expect = 1e-18
 Identities = 49/320 (15%), Positives = 102/320 (31%), Gaps = 37/320 (11%)

Query: 172 EKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCNYPGAHIGP 231
           E L PL    R  D  S    N+D D  P + ++G  S GK++ +++ +  ++     G 
Sbjct: 2   EDLIPLVN--RLQDAFSAIGQNADLD-LPQIAVVGGQSAGKSSVLENFVGRDFL--PRGS 56

Query: 232 EPTTDRFVVVM------------SGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFEC 279
              T R +V+                 ++      + +  +     +T            
Sbjct: 57  GIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPIN 116

Query: 280 SQMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDF--TGVISWFAAKCDLILLLFDPHKLDI 337
            ++  P +  +T VD PG+            +F    ++  F  K + ++L   P   D+
Sbjct: 117 LRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDL 176

Query: 338 S-DEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIG 396
           +  +  ++   +     +   V+ K D +D     R          +      V R    
Sbjct: 177 ANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKD 236

Query: 397 SFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQINEFVKRARAAKIHAYII 456
               K I               E+    +        A         K      ++  + 
Sbjct: 237 IDGKKDI---------TAALAAER-KFFLSHPSYRHLADRMGTPYLQKV-----LNQQLT 281

Query: 457 SHLKKEMPTMMGKAKAQQRL 476
           +H++  +P +  + K Q +L
Sbjct: 282 NHIRDTLPGL--RNKLQSQL 299
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Length = 306 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.81
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.77
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.75
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.72
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.72
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.7
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.7
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.68
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.68
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.66
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.66
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.65
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.62
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.6
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.6
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.6
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 99.59
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.59
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.58
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 99.58
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.53
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.51
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.49
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.46
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.44
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.44
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.44
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.44
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.4
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.4
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.39
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.39
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.39
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.38
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.38
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.37
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.37
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.36
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.35
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.35
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.35
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.33
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.33
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.32
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.31
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.31
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.3
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.3
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.3
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.3
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.29
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.28
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.28
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.26
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.26
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.26
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.25
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.25
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.25
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.24
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.23
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.23
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.21
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.21
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.21
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.2
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.19
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.19
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.18
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.18
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.17
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.17
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.14
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.14
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.14
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.13
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.13
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.09
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.08
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.07
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.04
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.03
d2hyda1255 Putative multidrug export ATP-binding/permease pro 98.99
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.98
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.97
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.93
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 98.93
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.92
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.91
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 98.91
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.9
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.88
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.88
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.87
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.87
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.84
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.84
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 98.81
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.81
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.78
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 98.78
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.77
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.71
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 98.69
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.68
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.68
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.66
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.66
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.63
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.61
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.6
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.6
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.6
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.58
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.53
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.5
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.5
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.48
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.44
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.43
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.38
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.37
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.36
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.36
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.36
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.34
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.33
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.32
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.3
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.3
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.25
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.25
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.24
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.23
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.23
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.23
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.22
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.19
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.19
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.18
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.16
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.15
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.15
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.13
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.11
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.11
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.11
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.08
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.06
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.04
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.04
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.01
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 97.96
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.96
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 97.95
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 97.95
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 97.89
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.87
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 97.86
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.85
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 97.83
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 97.83
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.83
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.82
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 97.81
d1okkd2207 GTPase domain of the signal recognition particle r 97.79
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 97.79
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.77
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.75
d1xzpa1173 TrmE connector domain {Thermotoga maritima [TaxId: 97.74
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 97.72
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 97.72
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 97.71
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.7
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 97.68
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 97.68
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.68
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.67
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.66
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 97.65
d2qy9a2211 GTPase domain of the signal recognition particle r 97.65
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.61
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 97.61
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.58
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.56
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.56
d1vmaa2213 GTPase domain of the signal recognition particle r 97.51
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 97.46
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.46
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 97.43
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 97.4
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 97.36
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.35
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.26
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 97.23
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 97.19
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 97.19
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.16
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 97.16
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 97.14
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.1
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 97.01
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.98
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 96.9
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 96.88
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 96.87
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 96.83
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.77
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 96.77
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 96.72
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.72
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.72
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 96.62
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.58
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.51
d1egaa2113 GTPase Era C-terminal domain {Escherichia coli [Ta 96.43
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 96.37
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.36
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.28
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 96.27
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.07
d1wf3a2118 GTPase Era C-terminal domain {Thermus thermophilus 96.06
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.02
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.02
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 96.02
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.99
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 95.87
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 95.87
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.79
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 95.71
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.65
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.64
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 95.57
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.56
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.53
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.43
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 95.43
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.38
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.29
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.24
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.23
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.22
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 95.22
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 95.22
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 95.18
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.18
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.11
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 95.11
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.05
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.0
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.93
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.92
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.9
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.85
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.85
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.76
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.72
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.71
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.53
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.52
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 94.39
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.35
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.28
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.26
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.25
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.15
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.09
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 93.99
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.92
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.92
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.9
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.86
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 93.82
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.68
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 93.67
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.6
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.45
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 93.42
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.38
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 93.33
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.26
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 93.22
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 93.06
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 92.99
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.87
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 92.73
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.72
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 92.69
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.65
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.62
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.51
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.49
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.4
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.29
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.28
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.1
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 92.05
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 91.97
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 91.91
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.66
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.63
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.56
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 91.39
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 91.39
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.23
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 91.2
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 90.8
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.76
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.65
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.64
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 90.54
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.51
d1svma_362 Papillomavirus large T antigen helicase domain {Si 90.4
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 90.39
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 90.16
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.11
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 90.03
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.97
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.96
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 89.93
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 89.77
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 89.68
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 89.63
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 89.61
d1tuea_205 Replication protein E1 helicase domain {Human papi 89.27
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 89.21
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 88.95
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 88.66
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 88.51
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 88.49
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 87.49
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 87.31
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 87.24
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 86.99
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 86.97
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 86.65
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 86.49
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 86.49
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 86.45
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 86.01
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 85.96
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 85.78
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 85.71
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 85.64
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.61
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 85.19
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 85.12
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 84.51
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 84.27
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 84.06
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 83.52
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 83.22
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 83.21
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 83.08
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 82.92
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 82.88
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 81.52
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 81.29
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 81.15
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 80.98
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 80.91
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 80.8
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 80.77
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 80.51
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 80.1
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Era, N-terminal domain
species: Thermus thermophilus [TaxId: 274]

Probab=99.81  E-value=1.9e-20  Score=171.27  Aligned_cols=163  Identities=23%  Similarity=0.332  Sum_probs=111.3

Q ss_pred             EEEEeeCCCCChhHHHHHHHhCCCCCCCCCCCcccceeEEEEeCCCccccCCceeeecCCCCCCCccccccchhhhhhhh
Q 008954          201 MVMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSKFECS  280 (547)
Q Consensus       201 ~V~lvG~~~aGKSTLiN~Llg~~~~~~~v~~~~~T~~~~~i~~~~~~~~~~g~~~~~~~~~~~~~l~~~~~~~~~~~~~~  280 (547)
                      .|+|+|.+|||||||+|+|+|...  ..++..++|+......                       .....+         
T Consensus         7 ~I~lvG~~~~GKSSLin~l~~~~~--~~~~~~~~tt~~~~~~-----------------------~~~~~~---------   52 (178)
T d1wf3a1           7 FVAIVGKPNVGKSTLLNNLLGVKV--APISPRPQTTRKRLRG-----------------------ILTEGR---------   52 (178)
T ss_dssp             EEEEECSTTSSHHHHHHHHHTSCC--SCCCSSSCCCCSCEEE-----------------------EEEETT---------
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCc--eeecccCCcccccccc-----------------------eeeeee---------
Confidence            699999999999999999999987  7888888776543310                       000001         


Q ss_pred             cccccccccceEEcCCCCCChhhhhhhcccChHHHHHHHhhcCCeEEEEecCCCCCCCHHHHHHHHHHhC--CCCeEEEE
Q 008954          281 QMSHPLLDQVTFVDTPGVLSGEKQRTQRTYDFTGVISWFAAKCDLILLLFDPHKLDISDEFKRVIASLRG--NDDKIRVV  358 (547)
Q Consensus       281 ~~~~~ll~~l~lvDTPG~~~~~~~~~~~~~~~~~~~~~~~~~aD~illv~d~~~~~~~~~~~~ll~~l~~--~~~~iivV  358 (547)
                             ..+.++||||+......... .  +...+...+.+||++|+++|+.+ +....+..+++.++.  .+.|+++|
T Consensus        53 -------~~~~~~DtpG~~~~~~~~~~-~--~~~~~~~~~~~ad~il~v~D~~~-~~~~~~~~i~~~l~~~~~~~piilv  121 (178)
T d1wf3a1          53 -------RQIVFVDTPGLHKPMDALGE-F--MDQEVYEALADVNAVVWVVDLRH-PPTPEDELVARALKPLVGKVPILLV  121 (178)
T ss_dssp             -------EEEEEEECCCCCCCCSHHHH-H--HHHHHHHHTSSCSEEEEEEETTS-CCCHHHHHHHHHHGGGTTTSCEEEE
T ss_pred             -------eeeeecccccccccccccch-h--cccccccccccccceeeeechhh-hhcccccchhhheeccccchhhhhh
Confidence                   37899999999764211111 0  12334555789999999999987 566666666666654  36799999


Q ss_pred             eccCCCcChHH-HHHHHHHHHHhhhhccCCCCcEEEEecccCCCCCCC-----CCCCCcchHhhH
Q 008954          359 LNKADQVDTQQ-LMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPING-----EVVGPIGQELFE  417 (547)
Q Consensus       359 lNK~D~~~~~~-l~~~~~~l~~~l~~~~~~~~v~~v~isa~~~~~l~~-----~~~~~~~~~~~~  417 (547)
                      +||+|+....+ ..+.+       .+.++..+  .+++||++|.|+++     ...+|+++++|+
T Consensus       122 ~NK~Dl~~~~~~~~~~~-------~~~~~~~~--~~~iSA~~~~gi~~L~~~i~~~lpe~p~~~p  177 (178)
T d1wf3a1         122 GNKLDAAKYPEEAMKAY-------HELLPEAE--PRMLSALDERQVAELKADLLALMPEGPFFYP  177 (178)
T ss_dssp             EECGGGCSSHHHHHHHH-------HHTSTTSE--EEECCTTCHHHHHHHHHHHHTTCCBCCCSSC
T ss_pred             hcccccccCHHHHHHHH-------HhhcccCc--eEEEecCCCCCHHHHHHHHHHhCCCCCCCCC
Confidence            99999987533 22222       22233333  37899999998876     245677777765
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xzpa1 a.24.25.1 (A:118-211,A:372-450) TrmE connector domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a2 d.52.3.1 (A:181-298) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure