Citrus Sinensis ID: 008981

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------
MAMTADSTSNHVTPRGSGFSGDGLSSPQLRRKNSPSQWSEVVRGEHDPASTTVNHSQSSPSPPLTTTSLPEPTGSVSPSKAVASAPSSPPPDNPIAAGSSDADKGNAARPKKLAWNKPSNGVVEVGPVMGAASWPALSESTKPSPKSSSADSSSSKPVADGSVSGTQVPLIPHLPQKVSNANANPNSNANRTMPARQRLKRSGGGVSNAGSGPAQTRPTQPPPPPPPPPFPVFPMPPNSFANLVTAMPDPSPREPLYRGSNWDARPVGGFVSQSHPMNDQRNSSRRGNYGQRGDGNYNNNFGGRHDQDRGNYSNARDAHVQPQRGPPRGFVRPAPPNAAAFAPPQPMRPFPNPMGFPEFIYIPPMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTVVEVQDDRVRRRNEWMKWIATPGRISTESGLSSPAGSSVDVLAPSFQNITVKEGAVNQRSLTGNANCHCEDAPGIHSSEGEATEEPNQN
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHccccccEEHHHHccccHHHHHcccHHHHHHHHHccccEEEcccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccHEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHcHHHHHHHHHHccccccEEEHEEEcHHHHHHHHHHHHHHHHHHHcccEEEEEcccEEEcccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccc
mamtadstsnhvtprgsgfsgdglsspqlrrknspsqwsevvrgehdpasttvnhsqsspsppltttslpeptgsvspskavasapsspppdnpiaagssdadkgnaarpkklawnkpsngvvevgpvmgaaswpalsestkpspksssadsssskpvadgsvsgtqvpliphlpqkvsnananpnsnanrtmparqrlkrsgggvsnagsgpaqtrptqpppppppppfpvfpmppnsfanlvtampdpspreplyrgsnwdarpvggfvsqshpmndqrnssrrgnygqrgdgnynnnfggrhdqdrgnysnardahvqpqrgpprgfvrpappnaaafappqpmrpfpnpmgfpefiyippmpveAAALrgvtgmppfippapvlmpvpepsLAAMLIHQIDyyfsdanlvkdeflksnmddqgwvpitliasfprvknlTSNIQLILDSLRtstvvevqDDRVRRRNEWMKWIatpgristesglsspagssvdvlapsfqnitvkegavnqrsltgnanchcedapgihssegeateepnqn
mamtadstsnhvtprgsgfsgdglsspqlrrknspsqWSEVVRGEHDPASttvnhsqsspspplTTTSLPEPTGSVSPSKAVASAPSSPPPDNPIAAGSSDADKGNAARpkklawnkpsngvVEVGPVMGAASWPALSESTKPSPKSSSADSSSSKPVADGSVSGTQVPLIPHLPQKVSnananpnsnanrtmpARQRLKRSGGGVSNAGSGPAQTRPTQPPPPPPPPPFPVFPMPPNSFANLVTAMPDPSPREPLYRGSNWDARPVGGFvsqshpmndqrnssrrgnygqrgDGNYNNNFGGRHDQDRGNYSNARDAHVQPQRGPPRGFVRPAPPNAAAFAPPQPMRPFPNPMGFPEFIYIPPMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLIldslrtstvvevqddrvrrrnewmkwiatpgristesglsspAGSSVDVLAPSFQNITVKEGAVNQRSLTGNANCHCEDAPgihssegeateepnqn
MAMTADSTSNHVTPRGSGFSGDGLSSPQLRRKNSPSQWSEVVRGEHDPASTTVNHSQsspsppltttslpeptGsvspskavasapsspppdnpiaaGSSDADKGNAARPKKLAWNKPSNGVVEVGPVMGAASWPALsestkpspksssadsssskpVADGSVSGTQVPLIPHLPQKVsnananpnsnanRTMPARQRLKRSGGGVSNAGSGPAQTRPTQpppppppppfpvfpmppNSFANLVTAMPDPSPREPLYRGSNWDARPVGGFVSQSHPMNDQRNSSRRGNYGQRGDGNYNNNFGGRHDQDRGNYSNARDAHVQPQRGPPRGFVRpappnaaafappqpmrpfpnpmGFPEFIYIPPMPVEAAALRGVTGMppfippapvlmpvpepSLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTvvevqddrvrrrNEWMKWIATPGRISTESGLSSPAGSSVDVLAPSFQNITVKEGAVNQRSLTGNANCHCEDAPGIHSSEGEATEEPNQN
******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************GFPEFIYIPPMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTVVEVQDDRVRRRNEWMKWIATPG**********************FQNITV**************************************
*************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************PVLMPVPEPSLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTVVEVQDDRVRRRNEWMKWIA*********************************************************************
**************************************************************************************************************KKLAWNKPSNGVVEVGPVMGAASW*******************************TQVPLIPHLPQKVSNANANPNSNANRTMP******************************PPPPPFPVFPMPPNSFANLVTAMPDPSPREPLYRGSNWDARPVGGFVSQS*************NYGQRGDGNYNNNFGGRHDQDRGNYSNARDAHVQPQRGPPRGFVRPAPPNAAAFAPPQPMRPFPNPMGFPEFIYIPPMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTVVEVQDDRVRRRNEWMKWIATPGRI************SVDVLAPSFQNITVKEGAVNQRSLTGNANCHCEDAPGIH*************
******************************************************************************************************************************************************************************************************************************PPPPPPP*************************************************************************************ARDAHVQPQRGPPRGFVRPAPPNAAAFAPPQPMRPFPNPMGFPEFIYIPPMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTVVEVQDDRVRRRNEWMKWIATPG******************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMTADSTSNHVTPRGSGFSGDGLSSPQLRRKNSPSQWSEVVRGEHDPASTTVNHSQSSPSPPLTTTSLPEPTGSVSPSKAVASAPSSPPPDNPIAAGSSDADKGNAARPKKLAWNKPSNGVVEVGPVMGAASWPALSESTKPSPKSSSADSSSSKPVADGSVSGTQVPLIPHLPQKVSNANANPNSNANRTMPARQRLKRSGGGVSNAGSGPAQTRPTQPPPPPPPPPFPVFPMPPNSFANLVTAMPDPSPREPLYRGSNWDARPVGGFVSQSHPMNDQRNSSRRGNYGQRGDGNYNNNFGGRHDQDRGNYSNARDAHVQPQRGPPRGFVRPAPPNAAAFAPPQPMRPFPNPMGFPEFIYIPPMPVEAAALRGVTGMPPFIPPAPVLMPVPEPSLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTVVEVQDDRVRRRNEWMKWIATPGRISTESGLSSPAGSSVDVLAPSFQNITVKEGAVNQRSLTGNANCHCEDAPGIHSSEGEATEEPNQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query547 2.2.26 [Sep-21-2011]
Q659C4 914 La-related protein 1B OS= yes no 0.162 0.097 0.483 4e-19
Q6PKG0 1096 La-related protein 1 OS=H no no 0.162 0.081 0.505 1e-18
Q6ZQ58 1072 La-related protein 1 OS=M no no 0.148 0.075 0.518 2e-17
Q9P6K0475 Uncharacterized HTH La-ty yes no 0.149 0.172 0.382 5e-15
Q9I7T7 1531 La-related protein CG1150 yes no 0.171 0.061 0.404 1e-12
Q26457 383 La protein homolog OS=Aed N/A no 0.138 0.198 0.392 5e-12
P05455 408 Lupus La protein OS=Homo no no 0.138 0.186 0.379 4e-11
P10881 404 Lupus La protein homolog no no 0.138 0.188 0.379 4e-11
Q9VAW5 1673 La-related protein OS=Dro no no 0.149 0.049 0.373 5e-11
Q7ZWE3 555 La-related protein 7 OS=D no no 0.124 0.122 0.416 8e-11
>sp|Q659C4|LAR1B_HUMAN La-related protein 1B OS=Homo sapiens GN=LARP1B PE=1 SV=2 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 64/89 (71%)

Query: 388 LMPVPEPSLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNI 447
           + PV E  L   +  QI+YYFS  NL +D FL+  MD+QG++PI+LIA F RV+ LT+N+
Sbjct: 207 VYPVEEALLKEYIKRQIEYYFSVENLERDFFLRGKMDEQGFLPISLIAGFQRVQALTTNL 266

Query: 448 QLILDSLRTSTVVEVQDDRVRRRNEWMKW 476
            LIL++L+ ST VE+ D+++R++ E  KW
Sbjct: 267 NLILEALKDSTEVEIVDEKMRKKIEPEKW 295

Homo sapiens (taxid: 9606)
>sp|Q6PKG0|LARP1_HUMAN La-related protein 1 OS=Homo sapiens GN=LARP1 PE=1 SV=2 Back     alignment and function description
>sp|Q6ZQ58|LARP1_MOUSE La-related protein 1 OS=Mus musculus GN=Larp1 PE=1 SV=2 Back     alignment and function description
>sp|Q9P6K0|YLA3_SCHPO Uncharacterized HTH La-type RNA-binding protein C1527.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1527.03 PE=1 SV=1 Back     alignment and function description
>sp|Q9I7T7|Y1505_DROME La-related protein CG11505 OS=Drosophila melanogaster GN=CG11505 PE=1 SV=2 Back     alignment and function description
>sp|Q26457|LA_AEDAL La protein homolog OS=Aedes albopictus PE=1 SV=1 Back     alignment and function description
>sp|P05455|LA_HUMAN Lupus La protein OS=Homo sapiens GN=SSB PE=1 SV=2 Back     alignment and function description
>sp|P10881|LA_BOVIN Lupus La protein homolog OS=Bos taurus GN=SSB PE=2 SV=2 Back     alignment and function description
>sp|Q9VAW5|LARP_DROME La-related protein OS=Drosophila melanogaster GN=larp PE=1 SV=5 Back     alignment and function description
>sp|Q7ZWE3|LARP7_DANRE La-related protein 7 OS=Danio rerio GN=larp7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
359492285565 PREDICTED: uncharacterized protein LOC10 0.936 0.906 0.511 1e-122
317106588536 JHL20J20.1 [Jatropha curcas] 0.919 0.938 0.531 1e-114
302142718559 unnamed protein product [Vitis vinifera] 0.773 0.756 0.536 1e-114
356552054527 PREDICTED: uncharacterized protein LOC10 0.904 0.939 0.503 1e-104
449437412540 PREDICTED: uncharacterized protein LOC10 0.957 0.970 0.465 1e-103
224085930502 predicted protein [Populus trichocarpa] 0.881 0.960 0.472 6e-98
356517961511 PREDICTED: uncharacterized protein LOC10 0.857 0.917 0.478 1e-89
302143562568 unnamed protein product [Vitis vinifera] 0.877 0.845 0.407 4e-78
255539032449 lupus la ribonucleoprotein, putative [Ri 0.431 0.525 0.593 8e-76
357438541 681 La-related protein [Medicago truncatula] 0.804 0.646 0.446 4e-71
>gi|359492285|ref|XP_002279250.2| PREDICTED: uncharacterized protein LOC100243746 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  445 bits (1145), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 288/563 (51%), Positives = 354/563 (62%), Gaps = 51/563 (9%)

Query: 1   MAMTADSTSNHVTPRGSGFSGDGLSSPQLRRKNSPSQWSEVVRGEHDPASTTVNHSQSSP 60
           MA T DS+     PRGSGFS DG+ SP LRR+N  S W+++VRGE +  S+ V HS +S 
Sbjct: 1   MATTTDSS-----PRGSGFSADGVHSP-LRRRNLSSPWAQIVRGETESMSS-VPHSPTSS 53

Query: 61  SPPLTTTSLPEPTG--SVSPSKAVASAPSSPPPDNPIAAG-----SSDADKGNAARPKKL 113
           S     TS PE       SP+K ++ +PS  P  +    G     +SD    NA R KK 
Sbjct: 54  S---PVTSCPEQISFSECSPTKPLSPSPSRSPAPDNSGVGEALLENSDGCGSNAGRQKKP 110

Query: 114 AWNKPSNGVVEVGPVMGAASWPALSESTKPSPKSSSADSSSSKPVADGSVSGTQVPLIPH 173
           AWNKPSN VVEVGPVMGA SWPALSEST+ SP+SSS    S KP  DGS +  Q P+IPH
Sbjct: 111 AWNKPSNDVVEVGPVMGAVSWPALSESTRASPRSSS---DSPKPAVDGSAASIQGPVIPH 167

Query: 174 LPQKVSNANANPNSNANRTMPARQRLKRSGGGVSNAGSGPAQTRPTQPPPPPPPPPFPVF 233
            PQK   AN NPNS+ N   P RQR  +SGGG S    G   ++P  PPPP P     +F
Sbjct: 168 SPQKQVPANTNPNSSQNHASPFRQRSIKSGGGSSQTVHGHLPSQPPPPPPPYP-----LF 222

Query: 234 PMPPNSFANLVTAMPDPSPREPLYRGSNWDARPVGGFVSQSHPMNDQ---RNSSRRGNYG 290
            MP N +A +   + D S REP YR + W+ RP+GGFV Q   ++D    RNS RRGN+G
Sbjct: 223 EMPQNKYAKMAPQVLDSSTREPPYRNNTWETRPIGGFVPQPRGLSDHPLPRNS-RRGNFG 281

Query: 291 Q--RGDGNYNNNFGGRHDQDRGNY------SNARDAHVQPQRGPPRGFVRPAPPNAA-AF 341
              RGDG ++NN+GGR DQDRGNY      SN RD H+QPQR PPRGF+R AP +++  F
Sbjct: 282 PHPRGDGPHHNNYGGRRDQDRGNYEWNSRSSNVRDIHMQPQRAPPRGFIRAAPQSSSPRF 341

Query: 342 APPQPMRPFPNPMGFP----EFIYIPPMPVEAAALRGVTGMPPFIPPAPVLMPVP---EP 394
             PQP+RPF NP G+P    +  Y P +P E    R V    PF+  AP         +P
Sbjct: 342 MTPQPIRPFMNPAGYPDMPSQMYYFPALPSEP--FRSV----PFVAHAPPPPMFIPVPDP 395

Query: 395 SLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSL 454
            L  +L++QI+YYFSD NL+KD++L+S MDDQGWVPITLIA FPRV++LT++I LILDSL
Sbjct: 396 PLPTLLVNQIEYYFSDVNLIKDDYLRSYMDDQGWVPITLIAGFPRVQSLTNSIPLILDSL 455

Query: 455 RTSTVVEVQDDRVRRRNEWMKWIATPGRISTESGLSSPAGSSVDVLAPSFQNITVKEGAV 514
           RTST VEVQ D+VRRRNEWMKW+ +  R   + GL SP G S   L  SFQ +TV+EG+ 
Sbjct: 456 RTSTSVEVQGDKVRRRNEWMKWLPSSARFHADLGLQSPGGLSYGTLVSSFQKVTVEEGSA 515

Query: 515 NQRSLTGNANCHCEDAPGIHSSE 537
           NQ SL G    H E   G  SSE
Sbjct: 516 NQNSLKGKTEAHTETVLGRASSE 538

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|317106588|dbj|BAJ53096.1| JHL20J20.1 [Jatropha curcas] Back     alignment and taxonomy information
>gi|302142718|emb|CBI19921.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356552054|ref|XP_003544386.1| PREDICTED: uncharacterized protein LOC100785504 [Glycine max] Back     alignment and taxonomy information
>gi|449437412|ref|XP_004136486.1| PREDICTED: uncharacterized protein LOC101220887 [Cucumis sativus] gi|449505790|ref|XP_004162569.1| PREDICTED: uncharacterized LOC101220887 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224085930|ref|XP_002307743.1| predicted protein [Populus trichocarpa] gi|222857192|gb|EEE94739.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356517961|ref|XP_003527653.1| PREDICTED: uncharacterized protein LOC100792549 [Glycine max] Back     alignment and taxonomy information
>gi|302143562|emb|CBI22123.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255539032|ref|XP_002510581.1| lupus la ribonucleoprotein, putative [Ricinus communis] gi|223551282|gb|EEF52768.1| lupus la ribonucleoprotein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357438541|ref|XP_003589546.1| La-related protein [Medicago truncatula] gi|355478594|gb|AES59797.1| La-related protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
TAIR|locus:2156912453 LARP1b "AT5G66100" [Arabidopsi 0.199 0.240 0.348 4.6e-23
TAIR|locus:2125334523 LARP1c "La related protein 1c" 0.206 0.216 0.330 1.6e-21
UNIPROTKB|E7ERC4184 SSB "Lupus La protein" [Homo s 0.115 0.342 0.421 7.4e-10
UNIPROTKB|E9PFL9134 SSB "Lupus La protein" [Homo s 0.115 0.470 0.421 7.4e-10
UNIPROTKB|G3V0E9358 LARP1B "La-related protein 1B" 0.142 0.217 0.468 8.2e-10
POMBASE|SPAC1527.03475 SPAC1527.03 "RNA-binding prote 0.204 0.235 0.311 1.5e-09
UNIPROTKB|G3XAJ5 522 LARP1B "La-related protein 1B" 0.142 0.149 0.468 1.9e-09
UNIPROTKB|Q659C4 914 LARP1B "La-related protein 1B" 0.142 0.085 0.468 4.3e-09
WB|WBGene00020097 1150 larp-1 [Caenorhabditis elegans 0.102 0.048 0.553 1.5e-08
UNIPROTKB|F1P339 927 LARP1 "Uncharacterized protein 0.142 0.084 0.455 7.1e-08
TAIR|locus:2156912 LARP1b "AT5G66100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 4.6e-23, Sum P(3) = 4.6e-23
 Identities = 39/112 (34%), Positives = 70/112 (62%)

Query:   400 LIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTX 459
             ++ Q++YYFS  NL +DE L+  M+D+GWVP+ +IA+F R+  LT+NIQ IL++LR+S  
Sbjct:   339 ILTQVEYYFSADNLSRDEHLRDQMNDEGWVPVRVIAAFRRLAELTNNIQTILEALRSSEV 398

Query:   460 XXXXXXXXXXXNEWMKWIATPGRISTESGLSSPAGSSVDVLAPSFQNITVKE 511
                         +W K++  P R  + SG ++ A ++  +++   +++T+ E
Sbjct:   399 VEIQGETLRRRGDWDKYLL-P-REPSRSGPAAGASNNASLVS-QIESMTLSE 447
GO:0003674 "molecular_function" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0010150 "leaf senescence" evidence=IMP
TAIR|locus:2125334 LARP1c "La related protein 1c" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E7ERC4 SSB "Lupus La protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PFL9 SSB "Lupus La protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V0E9 LARP1B "La-related protein 1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPAC1527.03 SPAC1527.03 "RNA-binding protein (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|G3XAJ5 LARP1B "La-related protein 1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q659C4 LARP1B "La-related protein 1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00020097 larp-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1P339 LARP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
cd0732375 cd07323, LAM, LA motif RNA-binding domain 2e-36
smart0071580 smart00715, LA, Domain in the RNA-binding Lupus La 2e-31
cd0803473 cd08034, LARP_1_2, La RNA-binding domain proteins 4e-28
pfam0538359 pfam05383, La, La domain 3e-27
cd0803873 cd08038, LARP_2, La RNA-binding domain of La-relat 3e-24
cd0803377 cd08033, LARP_6, La RNA-binding domain of La-relat 2e-23
cd0803773 cd08037, LARP_1, La RNA-binding domain of La-relat 4e-23
cd0803175 cd08031, LARP_4_5_like, La RNA-binding domain of p 3e-21
cd0802882 cd08028, LARP_3, La RNA-binding domain of La-relat 9e-19
cd0803282 cd08032, LARP_7, La RNA-binding domain of La-relat 3e-17
cd0802976 cd08029, LA_like_fungal, La-motif domain of fungal 7e-14
cd0803090 cd08030, LA_like_plant, La-motif domain of plant p 2e-13
cd0803575 cd08035, LARP_4, La RNA-binding domain of La-relat 2e-11
cd0803675 cd08036, LARP_5, La RNA-binding domain of La-relat 1e-08
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-06
COG5193438 COG5193, LHP1, La protein, small RNA-binding pol I 9e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-05
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-04
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 1e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 4e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 5e-04
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 5e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 7e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.001
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.002
COG5193 438 COG5193, LHP1, La protein, small RNA-binding pol I 0.004
>gnl|CDD|153396 cd07323, LAM, LA motif RNA-binding domain Back     alignment and domain information 
 Score =  129 bits (326), Expect = 2e-36
 Identities = 43/74 (58%), Positives = 59/74 (79%), Gaps = 2/74 (2%)

Query: 398 AMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTS 457
             +  Q++YYFSD NL KD FL+S MDD GWVP++L+ASF RVK LT++++LIL++LR S
Sbjct: 2   EKIKKQVEYYFSDENLCKDRFLRSLMDDDGWVPLSLLASFNRVKKLTTDVELILEALRDS 61

Query: 458 TVVEVQDD--RVRR 469
           +VVEV +D  +VRR
Sbjct: 62  SVVEVSEDGTKVRR 75

This domain is found at the N-terminus of La RNA-binding proteins as well as in other related proteins. Typically, the domain co-occurs with an RNA-recognition motif (RRM), and together these domains function to bind primary transcripts of RNA polymerase III in the La autoantigen (Lupus La protein, LARP3, or Sjoegren syndrome type B antigen, SS-B). A variety of La-related proteins (LARPs or La ribonucleoproteins), with differing domain architecture, appear to function as RNA-binding proteins in eukaryotic cellular processes. Length = 75
>gnl|CDD|128955 smart00715, LA, Domain in the RNA-binding Lupus La protein; unknown function Back     alignment and domain information
>gnl|CDD|153403 cd08034, LARP_1_2, La RNA-binding domain proteins similar to La-related proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|203243 pfam05383, La, La domain Back     alignment and domain information
>gnl|CDD|153407 cd08038, LARP_2, La RNA-binding domain of La-related protein 2 Back     alignment and domain information
>gnl|CDD|153402 cd08033, LARP_6, La RNA-binding domain of La-related protein 6 Back     alignment and domain information
>gnl|CDD|153406 cd08037, LARP_1, La RNA-binding domain of La-related protein 1 Back     alignment and domain information
>gnl|CDD|153400 cd08031, LARP_4_5_like, La RNA-binding domain of proteins similar to La-related proteins 4 and 5 Back     alignment and domain information
>gnl|CDD|153397 cd08028, LARP_3, La RNA-binding domain of La-related protein 3 Back     alignment and domain information
>gnl|CDD|153401 cd08032, LARP_7, La RNA-binding domain of La-related protein 7 Back     alignment and domain information
>gnl|CDD|153398 cd08029, LA_like_fungal, La-motif domain of fungal proteins similar to the La autoantigen Back     alignment and domain information
>gnl|CDD|153399 cd08030, LA_like_plant, La-motif domain of plant proteins similar to the La autoantigen Back     alignment and domain information
>gnl|CDD|153404 cd08035, LARP_4, La RNA-binding domain of La-related protein 4 Back     alignment and domain information
>gnl|CDD|153405 cd08036, LARP_5, La RNA-binding domain of La-related protein 5 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|227520 COG5193, LHP1, La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|227520 COG5193, LHP1, La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 547
cd0803773 LARP_1 La RNA-binding domain of La-related protein 99.96
cd0803873 LARP_2 La RNA-binding domain of La-related protein 99.96
cd0803473 LARP_1_2 La RNA-binding domain proteins similar to 99.96
cd0803675 LARP_5 La RNA-binding domain of La-related protein 99.96
cd0803575 LARP_4 La RNA-binding domain of La-related protein 99.96
cd0803282 LARP_7 La RNA-binding domain of La-related protein 99.95
KOG1855 484 consensus Predicted RNA-binding protein [General f 99.95
cd0803377 LARP_6 La RNA-binding domain of La-related protein 99.95
smart0071580 LA Domain in the RNA-binding Lupus La protein; unk 99.95
cd0803175 LARP_4_5_like La RNA-binding domain of proteins si 99.95
cd0802882 LARP_3 La RNA-binding domain of La-related protein 99.94
cd0802976 LA_like_fungal La-motif domain of fungal proteins 99.94
cd0732375 LAM LA motif RNA-binding domain. This domain is fo 99.93
cd0803090 LA_like_plant La-motif domain of plant proteins si 99.93
PF0538361 La: La domain; InterPro: IPR006630 Human Ro ribonu 99.88
KOG2591 684 consensus c-Mpl binding protein, contains La domai 99.83
KOG2590448 consensus RNA-binding protein LARP/SRO9 and relate 99.83
KOG4213205 consensus RNA-binding protein La [RNA processing a 99.73
COG5193438 LHP1 La protein, small RNA-binding pol III transcr 99.43
COG5193 438 LHP1 La protein, small RNA-binding pol III transcr 99.36
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 97.39
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 96.73
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 96.61
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 96.25
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 96.2
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 96.03
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 95.9
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 95.85
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 95.83
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 95.74
smart0036272 RRM_2 RNA recognition motif. 95.73
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 95.67
KOG2590 448 consensus RNA-binding protein LARP/SRO9 and relate 95.38
smart0036071 RRM RNA recognition motif. 95.3
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 95.14
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 95.04
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 94.98
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 94.89
PLN03120 260 nucleic acid binding protein; Provisional 94.64
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 94.62
KOG0121153 consensus Nuclear cap-binding protein complex, sub 94.26
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 93.72
KOG0122270 consensus Translation initiation factor 3, subunit 93.43
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 93.06
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 92.51
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 92.12
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 91.88
COG0724 306 RNA-binding proteins (RRM domain) [General functio 91.87
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 91.66
PLN03121 243 nucleic acid binding protein; Provisional 91.28
smart0036170 RRM_1 RNA recognition motif. 91.15
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 91.08
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 90.96
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 90.72
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 90.57
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 90.51
PF09421 989 FRQ: Frequency clock protein; InterPro: IPR018554 89.7
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 89.31
KOG0114124 consensus Predicted RNA-binding protein (RRM super 88.71
PRK00819179 RNA 2'-phosphotransferase; Reviewed 88.27
PF01885186 PTS_2-RNA: RNA 2'-phosphotransferase, Tpt1 / KptA 88.04
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 84.58
KOG0107 195 consensus Alternative splicing factor SRp20/9G8 (R 81.27
KOG2278207 consensus RNA:NAD 2'-phosphotransferase TPT1 [Tran 80.64
>cd08037 LARP_1 La RNA-binding domain of La-related protein 1 Back     alignment and domain information 
Probab=99.96  E-value=1.1e-30  Score=217.22  Aligned_cols=72  Identities=50%  Similarity=0.858  Sum_probs=70.8

Q ss_pred             HHHHHhhhhhcCcCcccccchhhhccCCCCcEEehhhccchhhhhcccCHHHHHHHHhcCCcEEEcCCeEee
Q 008981          398 AMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTVVEVQDDRVRR  469 (547)
Q Consensus       398 ~~I~kQVEYYFSDeNL~kD~FLr~~Md~qG~VPLs~IasFnRVK~Lt~d~~lI~eALr~S~~LEVsgdKVRR  469 (547)
                      ++|++||||||||+||++|.|||++|++||||||++|++|||||+||.|+++|++||+.|++|||+++||||
T Consensus         2 ~~I~~QvEyYFSd~NL~~D~fLr~~md~dG~Vpi~~ia~F~rmk~Lt~d~~~I~~Al~~S~~vev~~~~~r~   73 (73)
T cd08037           2 DYIKRQIEYYFSVDNLERDFFLRRKMDEDGFLPVTLIASFHRVQALTTDISLIIKALKDSKVVEIIDMKIRR   73 (73)
T ss_pred             hHHHHHHHHhccHhhhccCHHHHHHhccCCCEeHHHHhcchHHHHhcCCHHHHHHHHHcCCeEEEecchhcC
Confidence            689999999999999999999999999999999999999999999999999999999999999999999997

This domain is found in vertebrate La-related protein 1 (LARP1). A variety of La-related proteins (LARPs or La ribonucleoproteins), with differing domain architecture, appear to function as RNA-binding proteins in eukaryotic cellular processes.
>cd08038 LARP_2 La RNA-binding domain of La-related protein 2 Back     alignment and domain information
>cd08034 LARP_1_2 La RNA-binding domain proteins similar to La-related proteins 1 and 2 Back     alignment and domain information
>cd08036 LARP_5 La RNA-binding domain of La-related protein 5 Back     alignment and domain information
>cd08035 LARP_4 La RNA-binding domain of La-related protein 4 Back     alignment and domain information
>cd08032 LARP_7 La RNA-binding domain of La-related protein 7 Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>cd08033 LARP_6 La RNA-binding domain of La-related protein 6 Back     alignment and domain information
>smart00715 LA Domain in the RNA-binding Lupus La protein; unknown function Back     alignment and domain information
>cd08031 LARP_4_5_like La RNA-binding domain of proteins similar to La-related proteins 4 and 5 Back     alignment and domain information
>cd08028 LARP_3 La RNA-binding domain of La-related protein 3 Back     alignment and domain information
>cd08029 LA_like_fungal La-motif domain of fungal proteins similar to the La autoantigen Back     alignment and domain information
>cd07323 LAM LA motif RNA-binding domain Back     alignment and domain information
>cd08030 LA_like_plant La-motif domain of plant proteins similar to the La autoantigen Back     alignment and domain information
>PF05383 La: La domain; InterPro: IPR006630 Human Ro ribonucleoproteins (RNPs) are composed of one of the four small Y RNAs and at least two proteins, Ro60 and La Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2590 consensus RNA-binding protein LARP/SRO9 and related La domain proteins [Posttranslational modification, protein turnover, chaperones; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4213 consensus RNA-binding protein La [RNA processing and modification] Back     alignment and domain information
>COG5193 LHP1 La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5193 LHP1 La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG2590 consensus RNA-binding protein LARP/SRO9 and related La domain proteins [Posttranslational modification, protein turnover, chaperones; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PF09421 FRQ: Frequency clock protein; InterPro: IPR018554 The frequency clock protein, is the central component of the frq-based circadian negative feedback loop, regulates various aspects of the circadian clock in Neurospora crassa [] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PRK00819 RNA 2'-phosphotransferase; Reviewed Back     alignment and domain information
>PF01885 PTS_2-RNA: RNA 2'-phosphotransferase, Tpt1 / KptA family; InterPro: IPR002745 The final step of tRNA splicing in Saccharomyces cerevisiae (Baker's yeast) requires 2'-phosphotransferase (Tpt1) to transfer the 2'-phosphate from ligated tRNA to NAD, producing mature tRNA and ADP ribose-1' '-2' '-cyclic phosphate Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2278 consensus RNA:NAD 2'-phosphotransferase TPT1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
1s7a_A103 Nmr Structure Of The La Motif Of Human La Protein L 4e-10
2vod_A193 Crystal Structure Of N-Terminal Domains Of Human La 5e-10
1zh5_A195 Structural Basis For Recognition Of Uuuoh 3'-Termin 9e-10
1yty_A194 Structural Basis For Recognition Of Uuuoh 3'-Termin 1e-09
2cqk_A101 Solution Structure Of The La Domain Of C-Mpl Bindin 5e-06
1s29_A92 La Autoantigen N-Terminal Domain Length = 92 3e-04
>pdb|1S7A|A Chain A, Nmr Structure Of The La Motif Of Human La Protein Length = 103 Back     alignment and structure 
Iteration: 1

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 44/64 (68%), Gaps = 1/64 (1%)
Query: 395 SLAAMLIHQIDYYFSDANLVKDEFLKSNMD-DQGWVPITLIASFPRVKNLTSNIQLILDS 453
           +L A + HQI+YYF D NL +D+FLK  +  D+GWVP+ ++  F R+  LT++  +I+++
Sbjct: 12  ALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEA 71
Query: 454 LRTS 457
           L  S
Sbjct: 72  LSKS 75
>pdb|2VOD|A Chain A, Crystal Structure Of N-Terminal Domains Of Human La Protein Complexed With Rna Oligomer Auauuuu Length = 193 Back     alignment and structure
>pdb|1ZH5|A Chain A, Structural Basis For Recognition Of Uuuoh 3'-Terminii Of Nascent Rna Pol Iii Transcripts By La Autoantigen Length = 195 Back     alignment and structure
>pdb|1YTY|A Chain A, Structural Basis For Recognition Of Uuuoh 3'-Terminii Of Nascent Rna Pol Iii Transcripts By La Autoantigen Length = 194 Back     alignment and structure
>pdb|2CQK|A Chain A, Solution Structure Of The La Domain Of C-Mpl Binding Protein Length = 101 Back     alignment and structure
>pdb|1S29|A Chain A, La Autoantigen N-Terminal Domain Length = 92 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
2cqk_A101 C-MPL binding protein; LA domain, structural genom 4e-32
1s29_A92 LA protein; winged helix-turn-helix, autoantigen, 1e-29
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 3e-20
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-04
>2cqk_A C-MPL binding protein; LA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.5.46 Length = 101 Back     alignment and structure
 Score =  118 bits (296), Expect = 4e-32
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 390 PVPEPSLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQL 449
            V    L   L  Q+++ FS  NL KD +L S MD   ++PI  +A+   +K LT++  L
Sbjct: 8   AVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDL 67

Query: 450 ILDSLRTSTVVEVQDD--RVRRRNEWMKWIATPG 481
           IL+ LR+S +V+V +   +VR  ++      + G
Sbjct: 68  ILEVLRSSPMVQVDEKGEKVRPSHKRCISGPSSG 101
>1s29_A LA protein; winged helix-turn-helix, autoantigen, RNA-binding, RNA binding protein; 1.60A {Trypanosoma brucei} SCOP: a.4.5.46 Length = 92 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.97
2cqk_A101 C-MPL binding protein; LA domain, structural genom 99.96
1s29_A92 LA protein; winged helix-turn-helix, autoantigen, 99.96
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 97.6
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 97.58
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 97.56
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 97.52
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 97.51
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 97.47
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 97.47
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 97.41
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 97.37
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 97.37
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 97.31
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 97.3
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 97.26
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 97.25
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.23
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 97.2
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 97.19
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 97.15
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 97.15
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 97.15
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 97.13
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 97.12
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 97.12
2cqd_A116 RNA-binding region containing protein 1; RNA recog 97.11
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 97.11
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 97.09
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 97.08
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 97.07
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 97.07
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 97.05
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 97.04
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 97.04
2dis_A109 Unnamed protein product; structural genomics, RRM 97.03
2cph_A107 RNA binding motif protein 19; RNA recognition moti 97.02
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 97.01
3p5t_L90 Cleavage and polyadenylation specificity factor S; 97.01
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 97.0
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 97.0
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 96.99
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 96.99
2dnl_A114 Cytoplasmic polyadenylation element binding protei 96.99
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 96.98
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 96.97
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 96.95
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 96.95
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 96.94
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 96.93
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 96.93
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 96.91
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 96.91
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 96.91
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 96.91
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 96.91
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 96.9
2la6_A99 RNA-binding protein FUS; structural genomics, nort 96.89
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 96.88
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 96.88
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 96.88
2krb_A81 Eukaryotic translation initiation factor 3 subunit 96.87
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 96.86
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 96.86
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 96.85
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 96.84
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 96.84
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 96.83
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 96.83
1x4e_A85 RNA binding motif, single-stranded interacting pro 96.82
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 96.82
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 96.81
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 96.81
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 96.81
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 96.81
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 96.8
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 96.79
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 96.78
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 96.78
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 96.78
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 96.78
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 96.77
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 96.76
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 96.75
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 96.75
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 96.74
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 96.73
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 96.72
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 96.72
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 96.72
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 96.71
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 96.68
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 96.68
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 96.67
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 96.66
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 96.65
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 96.65
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 96.64
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 96.64
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 96.64
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 96.63
2kt5_A124 RNA and export factor-binding protein 2; chaperone 96.62
3q2s_C229 Cleavage and polyadenylation specificity factor S; 96.6
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 96.59
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 96.59
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 96.58
1x5o_A114 RNA binding motif, single-stranded interacting pro 96.56
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 96.54
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 96.53
2div_A99 TRNA selenocysteine associated protein; structural 96.51
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.5
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 96.5
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 96.49
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 96.48
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 96.47
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 96.46
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 96.46
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 96.45
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 96.42
3n9u_C156 Cleavage and polyadenylation specificity factor S; 96.4
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 96.39
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 96.38
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 96.36
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 96.35
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 95.35
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 96.32
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 96.31
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 96.3
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 96.3
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 96.29
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 96.27
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 96.23
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 96.19
2cjk_A 167 Nuclear polyadenylated RNA-binding protein 4; HRP1 96.19
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 96.17
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 96.16
2cpj_A99 Non-POU domain-containing octamer-binding protein; 96.15
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 96.15
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 96.14
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 96.13
2i2y_A150 Fusion protein consists of immunoglobin G- binding 96.1
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.09
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 96.08
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 96.07
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 96.07
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 96.07
3nmr_A 175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 96.05
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 96.04
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 96.04
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 96.04
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 96.03
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 96.02
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 96.02
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 96.02
2f3j_A177 RNA and export factor binding protein 2; RRM domai 96.01
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 96.0
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 95.96
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 95.95
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 95.9
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 95.89
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 95.88
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 95.88
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 95.87
3md3_A 166 Nuclear and cytoplasmic polyadenylated RNA-bindin 95.87
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 95.84
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 95.83
1b7f_A 168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 95.81
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 95.8
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 95.8
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 95.77
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 95.76
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 95.76
2g4b_A 172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 95.72
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 95.66
1fxl_A 167 Paraneoplastic encephalomyelitis antigen HUD; prot 95.63
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 95.58
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 95.51
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 95.44
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 95.41
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 95.26
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 95.19
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 95.09
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 95.05
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 95.04
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 95.04
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 94.97
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 94.97
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 94.92
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 94.79
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 94.65
1x5p_A97 Negative elongation factor E; structure genomics, 94.51
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 94.47
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 94.3
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 94.22
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 93.79
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 93.78
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 93.72
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 93.36
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 93.23
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 93.17
2dit_A112 HIV TAT specific factor 1 variant; structural geno 92.96
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 91.96
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 91.2
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 88.78
1wfx_A186 Probable RNA 2'-phosphotransferase; tRNA splicing, 88.58
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 87.28
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 86.0
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 84.87
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
Probab=99.97  E-value=1.5e-31  Score=251.34  Aligned_cols=148  Identities=24%  Similarity=0.391  Sum_probs=121.9

Q ss_pred             HHHHHHHHHhhhhhcCcCcccccchhhhccC-CCCcEEehhhccchhhhhcccCHHHHHHHHhcC--CcEEEcCC--eEe
Q 008981          394 PSLAAMLIHQIDYYFSDANLVKDEFLKSNMD-DQGWVPITLIASFPRVKNLTSNIQLILDSLRTS--TVVEVQDD--RVR  468 (547)
Q Consensus       394 ~~L~~~I~kQVEYYFSDeNL~kD~FLr~~Md-~qG~VPLs~IasFnRVK~Lt~d~~lI~eALr~S--~~LEVsgd--KVR  468 (547)
                      ++|+.+|++||||||||+||++|.||+++|+ ++|||+|.+|++|+|||+|+.|+++|++||+.|  ..|+|+++  +||
T Consensus        10 ~~~~~~i~~q~e~yfs~~nl~~D~fl~~~~~~~~g~V~l~~i~sF~r~k~l~~d~~~I~~Al~~S~~~~lev~ed~~~vr   89 (193)
T 2voo_A           10 AALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIR   89 (193)
T ss_dssp             HHHHHHHHHHHHHHTSTTTGGGCHHHHHHHHHTTTCEEHHHHTTSHHHHHHCCCHHHHHHHHHTCSSCCEEECTTSSEEE
T ss_pred             HHHHHHHHHHhheecchhhcccCHHHHHHhcccCCcEEeHHHhhhhHHHHhcCCHHHHHHHHhhcccceEEEecccceEE
Confidence            6899999999999999999999999999997 799999999999999999999999999999999  99999865  788


Q ss_pred             eCCcccccCCCC-------CCceeeeecCCCCCCChhhhhhhcccccccccccccccccCCCcccCCcccEEcCChhhhh
Q 008981          469 RRNEWMKWIATP-------GRISTESGLSSPAGSSVDVLAPSFQNITVKEGAVNQRSLTGNANCHCEDAPGIHSSEGEAT  541 (547)
Q Consensus       469 Rr~~w~kwvp~~-------~r~~tV~g~~~p~~~T~d~L~~~F~~~gle~~~~~~~s~R~~~k~f~GsvfVEFsSeEeAk  541 (547)
                      |+....  .++.       ...+++...+++...|.++|.++|..+|-.....   -.+...+.++|.+||||.++|+|+
T Consensus        90 R~~~~p--~p~~~~~~~~~~~~~~l~V~nLp~~~t~~~L~~~F~~~G~v~~v~---i~~~~~~~~kG~aFVeF~~~e~A~  164 (193)
T 2voo_A           90 RSPSKP--LPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQ---MRRTLHKAFKGSIFVVFDSIESAK  164 (193)
T ss_dssp             ECTTSC--CCCCCHHHHHHHHHTEEEEECCCTTCCHHHHHHHHTTSCCEEEEE---EEECTTCCEEEEEEEEESSHHHHH
T ss_pred             ecccCC--CcccchhhhhccccCEEEecCCCCcCCHHHHHHHHhcCCCEEEEE---EEECCCCCcccEEEEEECCHHHHH
Confidence            873211  1221       1234566667889999999999999998422211   122334778999999999999999


Q ss_pred             cCCCC
Q 008981          542 EEPNQ  546 (547)
Q Consensus       542 k~~~~  546 (547)
                      ++++.
T Consensus       165 ~A~~~  169 (193)
T 2voo_A          165 KFVET  169 (193)
T ss_dssp             HHHHC
T ss_pred             HHHHh
Confidence            98753
>2cqk_A C-MPL binding protein; LA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.5.46 Back     alignment and structure
>1s29_A LA protein; winged helix-turn-helix, autoantigen, RNA-binding, RNA binding protein; 1.60A {Trypanosoma brucei} SCOP: a.4.5.46 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1wfx_A Probable RNA 2'-phosphotransferase; tRNA splicing, NAD, structural GE riken structural genomics/proteomics initiative, RSGI; 2.80A {Aeropyrum pernix} SCOP: d.166.1.5 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 547
d2cqka188 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Hu 4e-36
d1zh5a199 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal 7e-32
d1s29a_92 a.4.5.46 (A:) Lupus La autoantigen N-terminal doma 1e-27
>d2cqka1 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: La domain
domain: La-related protein 4 LARP4
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  127 bits (321), Expect = 4e-36
 Identities = 31/89 (34%), Positives = 51/89 (57%), Gaps = 4/89 (4%)

Query: 391 VPEPSLAAMLIHQIDYYFSDANLVKDEFLKSNMDDQGWVPITLIASFPRVKNLTSNIQLI 450
           V    L   L  Q+++ FS  NL KD +L S MD   ++PI  +A+   +K LT++  LI
Sbjct: 2   VSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLI 61

Query: 451 LDSLRTSTVVEVQDD--RVRRRNEWMKWI 477
           L+ LR+S +V+V +   +VR  ++  + I
Sbjct: 62  LEVLRSSPMVQVDEKGEKVRPSHK--RCI 88
>d1zh5a1 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Length = 92 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
d1s29a_92 Lupus La autoantigen N-terminal domain {Trypanosom 99.95
d2cqka188 La-related protein 4 LARP4 {Human (Homo sapiens) [ 99.95
d1zh5a199 Lupus La autoantigen N-terminal domain {Human (Hom 99.95
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 97.73
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 97.72
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.7
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.56
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 97.52
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.49
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 97.36
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 97.3
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.3
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 97.28
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 97.28
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 97.25
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.24
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 97.21
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 97.21
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.2
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 97.2
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 97.2
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.13
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.09
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.08
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 97.06
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.02
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 97.01
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 96.98
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 96.97
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 96.96
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 96.95
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 96.94
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 96.92
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 96.88
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 96.88
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 96.87
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 96.85
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 96.85
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 96.81
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 96.81
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 96.81
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 96.8
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 96.8
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 96.77
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 96.76
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 96.76
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.74
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 96.72
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 96.71
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 96.67
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 96.67
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 96.67
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 96.66
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 96.66
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 96.62
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 96.61
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 96.58
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 96.57
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 96.53
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 96.52
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 96.51
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 96.49
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.48
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 96.46
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 96.44
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 96.4
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.29
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 96.23
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 96.21
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 96.14
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 96.08
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 96.07
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 96.07
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 95.78
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 95.74
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 95.7
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 95.67
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 95.1
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 95.03
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 94.98
d2cpja186 Non-POU domain-containing octamer-binding protein, 94.88
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 94.83
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 94.62
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 94.5
d1u1qa_ 183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 94.28
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 94.04
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 92.71
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 92.41
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 90.39
d1wfxa_180 Probable RNA 2'-phosphotransferase KptA {Aeropyrum 89.91
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 87.62
>d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: La domain
domain: Lupus La autoantigen N-terminal domain
species: Trypanosoma brucei [TaxId: 5691]

Probab=99.95  E-value=1.2e-29  Score=215.84  Aligned_cols=83  Identities=31%  Similarity=0.655  Sum_probs=76.5

Q ss_pred             CCCcHHHHHHHHHhhhhhcCcCcccccchhhhcc--CCCCcEEehhhccchhhhhcccCHHHHHHHHhcCCcEEEcCC--
Q 008981          390 PVPEPSLAAMLIHQIDYYFSDANLVKDEFLKSNM--DDQGWVPITLIASFPRVKNLTSNIQLILDSLRTSTVVEVQDD--  465 (547)
Q Consensus       390 P~~d~~L~~~I~kQVEYYFSDeNL~kD~FLr~~M--d~qG~VPLs~IasFnRVK~Lt~d~~lI~eALr~S~~LEVsgd--  465 (547)
                      |.. ++.+++|++||||||||+||++|+||+++|  +.||||+|++|++|+|||+|+.|+++|++||+.|..|||++|  
T Consensus         5 p~~-~e~~~~I~~QvEfYFSd~NL~~D~fL~~~m~~~~~G~V~i~~i~~F~rmk~lt~d~~~i~~Al~~S~~lev~ed~~   83 (92)
T d1s29a_           5 PLS-SENKQKLQKQVEFYFSDVNVQRDIFLKGKMAENAEGFVSLETLLTFKRVNSVTTDVKEVVEAIRPSEKLVLSEDGL   83 (92)
T ss_dssp             CCC-HHHHHHHHHHHHHHTSHHHHTTCHHHHHHHTTSTTCCEEHHHHTTSHHHHTTCSCHHHHHHHHTTCSSEEECTTSS
T ss_pred             CCC-HHHHHHHHHHHHHHccHhhhccCHHHHHHHhccCCCcEEhHHHhcCcCHHHhcCCHHHHHHHHhhCCeEEEeCCCC
Confidence            443 467889999999999999999999999999  689999999999999999999999999999999999999965  


Q ss_pred             eEeeCCcc
Q 008981          466 RVRRRNEW  473 (547)
Q Consensus       466 KVRRr~~w  473 (547)
                      +||||.++
T Consensus        84 ~VRRk~pl   91 (92)
T d1s29a_          84 MVRRRDPL   91 (92)
T ss_dssp             EEEESSCC
T ss_pred             EEeeCCCC
Confidence            89999753
>d2cqka1 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a1 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfxa_ d.166.1.5 (A:) Probable RNA 2'-phosphotransferase KptA {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure