Citrus Sinensis ID: 008991

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------

MFYRNELNGPGTSEAHNPSSFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYLAFESELTIIPVINKIDQPTADPDRVKAQLKSMFDLDPSEALLTSAKTGQGLEHVLPAVIERIPPPRGIINSSLRMLLLDSYYDEYKGVICHVAVVDGTLRKGDKISSAATGQAYEIVDVGIMHPELTPTGVLLTGQVGYVVTGMRSTKEARIGDTLYHNKSIVEPLPGFKPAKHMVFSGLYPADGSDFEVLNHAIERLTCNDASVSVTKETSTALGLGFRCGFLGLLHMDVFHQRLEQEYGAHVISTVPTVPYIFEYSDGSKAEVQNPASLPSNPKKRVTACWEPTVVATIIIPSEYVGSVITLCSERRGQQLEYSFIDSQRAFMKYCLPLREIVVDFYNELKSLTSGYASFDYEDSEYQQADMVKLDILLNGQPVDAMATIVHNLKAQRVGRELVEKLKKFIDRQMFEITIQAAIGSKVIARETISAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHQLLRVS

cccccccccccccccccccEEEEEccccccccccccccHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccccccccccEEEEEcccccccEEEEEEEEEccEEccccEEEEEEcccEEEEEEEEEEccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEcccEEEEEEEccccEEEEEccccccccccccccEEEccEEEEEEccccccHHHHHHHHHHHcccccccEEccccEEEEEEEcccccEEEEcccccccccccccccccccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHccEEEEcccccccccccccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHccc

ccccccEEEEEEEEcccccEEEEEEEcccccccEEEEEHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHHHHcccHccHHHHHHHccccHHHHHHHHHHcccccccccccccEEEEEEcccccccEEEEEEEEEccEEccccEEEEEccccEEEEEEEEEEccccccHHHcccccEEEEEEEEEEccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHcccHccccccccHHHHHccccHcHHHHHHHHHHHHHHHHHHccccEEEEcccEEEEEEEccccEEEEcccccccccccccHHHEcccEEEEEEEccHHHHHHHHHHHHHHcccEEEcEEccccEEEEEEEccHHHHHHHHHHHHHcccccccEEEEEEccccccccEEEEEEEccccccHHHHHHcHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccEccHHHHHHHHccc

mfyrnelngpgtseahnpssfllnlidtpghvdFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYLAFEseltiipvinkidqptadpdRVKAQLKSmfdldpseaLLTSAKTGQGLEHVLPavierippprgiiNSSLRMLLLDSYYDEYKGVICHVAVVdgtlrkgdkissaatgqayeivdvgimhpeltptgvlltgqvgyvvtgmrstkearigdtlyhnksiveplpgfkpakhmvfsglypadgsdfEVLNHAIERltcndasvsvtketstalglgfrcgflGLLHMDVFHQRLEQeygahvistvptvpyifeysdgskaevqnpaslpsnpkkrvtacwepTVVATIIIPSEYVGSVITLCserrgqqleYSFIDSQRAFMKYCLPLREIVVDFYNELKSLtsgyasfdyedseyqqaDMVKLDillngqpvdAMATIVHNLKAQRVGRELVEKLKKFIDRQMFEITIQAAIGSKVIARETISAMRKNVLAKcyggdvtrkRKLLEKQKEGKKRmkrvgsvdipqEAFHQLLRVS

mfyrnelngpgtseahnPSSFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYLAFESELTIIPVINKIDQPTADPDRVKAQLKSMFDLDPSEALLTSAKTGQGLEHVLPavierippprgIINSSLRMLLLDSYYDEYKGVICHVAVVDGTLRKGDKISSAATGQAYEIVDVGIMHPELTPTGVLLTGQVGYVVTGMRSTKEARIGDTLYHNKSIVEPLPGFKPAKHMVFSGLYPADGSDFEVLNHAIERLtcndasvsvTKETSTALGLGFRCGFLGLLHMDVFHQRLEQEYGAHVISTVPTVPYIFEYSDGSKAevqnpaslpsnpkkrvtACWEPTVVATIIIPSEYVGSVITLCSERRGQQLEYSFIDSQRAFMKYCLPLREIVVDFYNELKSLTSGYASFDYEDSEYQQADMVKLDILLNGQPVDAMATIVHNLKAQRVGRELVEKLKKFIDRQMFEITIQAAIGSKVIARETISAMRKNVLakcyggdvtrkrkllekqkegkkrmkrvgsvdipqeafhqllrvs

MFYRNELNGPGTSEAHNPSSFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYLAFESELTIIPVINKIDQPTADPDRVKAQLKSMFDLDPSEALLTSAKTGQGLEHVLPAVIERIPPPRGIINSSLRMLLLDSYYDEYKGVICHVAVVDGTLRKGDKISSAATGQAYEIVDVGIMHPELTPTGVLLTGQVGYVVTGMRSTKEARIGDTLYHNKSIVEPLPGFKPAKHMVFSGLYPADGSDFEVLNHAIERLTCNDASVSVTKETSTAlglgfrcgflgllHMDVFHQRLEQEYGAHVISTVPTVPYIFEYSDGSKAEVQNPASLPSNPKKRVTACWEPTVVATIIIPSEYVGSVITLCSERRGQQLEYSFIDSQRAFMKYCLPLREIVVDFYNELKSLTSGYASFDYEDSEYQQADMVKLDILLNGQPVDAMATIVHNLKAQRVGRELVEKLKKFIDRQMFEITIQAAIGSKVIARETISAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHQLLRVS

********************FLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYLAFESELTIIPVINKID*******************************GQGLEHVLPAVIERIPPPRGIINSSLRMLLLDSYYDEYKGVICHVAVVDGTLRKGDKISSAATGQAYEIVDVGIMHPELTPTGVLLTGQVGYVVTGMRSTKEARIGDTLYHNKSIVEPLPGFKPAKHMVFSGLYPADGSDFEVLNHAIERLTCNDASVSVTKETSTALGLGFRCGFLGLLHMDVFHQRLEQEYGAHVISTVPTVPYIFEYS********************VTACWEPTVVATIIIPSEYVGSVITLCSERRGQQLEYSFIDSQRAFMKYCLPLREIVVDFYNELKSLTSGYASFDYEDSEYQQADMVKLDILLNGQPVDAMATIVHNLKAQRVGRELVEKLKKFIDRQMFEITIQAAIGSKVIARETISAMRKNVLAKCYGGDVT************************************

***********TSEAHNPSSFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYLAFESELTIIPVINKIDQPTADPDRVKAQLKSMFDLDPSEALLTSAKTGQGLEHVLPAVIERIPPPRGIINSSLRMLLLDSYYDEYKGVICHVAVVDGTLRKGDKISSAATGQAYEIVDVGIMHPELTPTGVLLTGQVGYVVTGMRSTKEARIGDTLYHNKSIVEPLPGFKPAKHMVFSGLYPADGSDFEVLNHAIERLTCNDASVSVTKETSTALGLGFRCGFLGLLHMDVFHQRLEQEYGAHVISTVPTVPYIFEYSDGSKAEVQNPASLPSNPKKRVTACWEPTVVATIIIPSEYVGSVITLCSERRGQQLEYSFIDSQRAFMKYCLPLREIVVDFYNELKSLTSGYASFDYEDSEYQQADMVKLDILLNGQPVDAMATIVHNLKAQRVGRELVEKLKKFIDRQMFEITIQAAIGSKVIARETISAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHQLLRVS

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		547	2.2.26 [Sep-21-2011]
B9RUN8		673	Translation factor GUF1 h	N/A	no	1.0	0.812	0.901	0.0
Q5VQ69		663	Translation factor GUF1 h	yes	no	1.0	0.825	0.842	0.0
C5Z3W1		665	Translation factor GUF1 h	N/A	no	0.992	0.816	0.839	0.0
Q9FLE4		663	Translation factor GUF1 h	yes	no	0.989	0.815	0.806	0.0
A9S3D3		684	Translation factor GUF1 h	N/A	no	0.989	0.790	0.777	0.0
B8B2R1		648	Translation factor GUF1 h	N/A	no	0.972	0.820	0.811	0.0
B0G189		685	Translation factor GUF1 h	yes	no	0.976	0.779	0.565	0.0
Q8C3X4		651	Translation factor Guf1,	yes	no	0.954	0.801	0.569	1e-180
Q8N442		669	Translation factor GUF1,	yes	no	0.954	0.780	0.571	1e-180
B3RXR7		660	Translation factor GUF1 h	N/A	no	0.968	0.803	0.558	1e-179

>sp\|B9RUN8\|GUF1_RICCO Translation factor GUF1 homolog, mitochondrial OS=Ricinus communis GN=RCOM_0855130 PE=3 SV=1	Back alignment and function desciption

 Score = 1032 bits (2668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/547 (90%), Positives = 522/547 (95%)

Query: 1   MFYRNELNGPGTSEAHNPSSFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQA 60
           MF++   +GP   +AH P +FLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQA
Sbjct: 127 MFHKYNFHGPNIGDAHEPPTFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQA 186

Query: 61  QTVANFYLAFESELTIIPVINKIDQPTADPDRVKAQLKSMFDLDPSEALLTSAKTGQGLE 120
           QTVANFYLAFES LT+IPVINKIDQPTADPDRVKAQLKSMFDL+PS+ LLTSAKTGQGLE
Sbjct: 187 QTVANFYLAFESNLTVIPVINKIDQPTADPDRVKAQLKSMFDLEPSDCLLTSAKTGQGLE 246

Query: 121 HVLPAVIERIPPPRGIINSSLRMLLLDSYYDEYKGVICHVAVVDGTLRKGDKISSAATGQ 180
            VLPAVIERIP P G  NS LRMLLLDSYYDEYKGVICHVAVVDG LRKGDKISSAATG 
Sbjct: 247 QVLPAVIERIPSPPGYSNSPLRMLLLDSYYDEYKGVICHVAVVDGMLRKGDKISSAATGH 306

Query: 181 AYEIVDVGIMHPELTPTGVLLTGQVGYVVTGMRSTKEARIGDTLYHNKSIVEPLPGFKPA 240
           +YEI+DVG MHPELTPTG+LLTGQVGYVV+GMRSTKEAR+GDTLYH+++ VEPLPGFKPA
Sbjct: 307 SYEILDVGFMHPELTPTGILLTGQVGYVVSGMRSTKEARVGDTLYHSRTSVEPLPGFKPA 366

Query: 241 KHMVFSGLYPADGSDFEVLNHAIERLTCNDASVSVTKETSTALGLGFRCGFLGLLHMDVF 300
           KHMVFSGLYPADGSDF+ LNHAIERLTCNDASVSVTKE+S+ALGLGFRCGFLGLLHMDVF
Sbjct: 367 KHMVFSGLYPADGSDFDALNHAIERLTCNDASVSVTKESSSALGLGFRCGFLGLLHMDVF 426

Query: 301 HQRLEQEYGAHVISTVPTVPYIFEYSDGSKAEVQNPASLPSNPKKRVTACWEPTVVATII 360
           HQRLEQEYGAHVISTVPTVPYIFEYSDGSK +VQNPA+LPSNPKKRVTA WEPTVVATII
Sbjct: 427 HQRLEQEYGAHVISTVPTVPYIFEYSDGSKVQVQNPAALPSNPKKRVTASWEPTVVATII 486

Query: 361 IPSEYVGSVITLCSERRGQQLEYSFIDSQRAFMKYCLPLREIVVDFYNELKSLTSGYASF 420
           IPSEYVG VITLCSERRGQQLEYSFIDSQRAFMKY LPLREIVVDFYNELKS+TSGYASF
Sbjct: 487 IPSEYVGPVITLCSERRGQQLEYSFIDSQRAFMKYRLPLREIVVDFYNELKSITSGYASF 546

Query: 421 DYEDSEYQQADMVKLDILLNGQPVDAMATIVHNLKAQRVGRELVEKLKKFIDRQMFEITI 480
           DYEDSEYQ+A++VKLDILLNGQPVDAMATIVHNLKAQRVGRELV+KLKKFIDRQMFEITI
Sbjct: 547 DYEDSEYQEAELVKLDILLNGQPVDAMATIVHNLKAQRVGRELVDKLKKFIDRQMFEITI 606

Query: 481 QAAIGSKVIARETISAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAF 540
           QAAIGSKV+ARETISAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAF
Sbjct: 607 QAAIGSKVVARETISAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAF 666

Query: 541 HQLLRVS 547
           H+LL+VS
Sbjct: 667 HELLKVS 673

Promotes mitochondrial protein synthesis. May act as a fidelity factor of the translation reaction, by catalyzing a one-codon backward translocation of tRNAs on improperly translocated ribosomes. Binds to mitochondrial ribosomes in a GTP-dependent manner.
Ricinus communis (taxid: 3988)
EC: 3EC: .EC: 6EC: .EC: 5EC: .EC: -

>sp\|Q5VQ69\|GUF1_ORYSJ Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0144800 PE=3 SV=1	Back alignment and function description

>sp\|C5Z3W1\|GUF1_SORBI Translation factor GUF1 homolog, mitochondrial OS=Sorghum bicolor GN=Sb10g003070 PE=3 SV=1	Back alignment and function description

>sp\|Q9FLE4\|GUF1_ARATH Translation factor GUF1 homolog, mitochondrial OS=Arabidopsis thaliana GN=At5g39900 PE=2 SV=1	Back alignment and function description

>sp\|A9S3D3\|GUF1_PHYPA Translation factor GUF1 homolog, mitochondrial OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_180825 PE=3 SV=1	Back alignment and function description

>sp\|B8B2R1\|GUF1_ORYSI Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_21607 PE=3 SV=1	Back alignment and function description

>sp\|B0G189\|GUF1_DICDI Translation factor GUF1 homolog, mitochondrial OS=Dictyostelium discoideum GN=guf1 PE=3 SV=1	Back alignment and function description

>sp\|Q8C3X4\|GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus GN=Guf1 PE=2 SV=1	Back alignment and function description

>sp\|Q8N442\|GUF1_HUMAN Translation factor GUF1, mitochondrial OS=Homo sapiens GN=GUF1 PE=1 SV=1	Back alignment and function description

>sp\|B3RXR7\|GUF1_TRIAD Translation factor GUF1 homolog, mitochondrial OS=Trichoplax adhaerens GN=TRIADDRAFT_56304 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		547
255552880		673	GTP-binding protein lepA, putative [Rici	1.0	0.812	0.901	0.0
225452725		681	PREDICTED: translation factor GUF1 homol	1.0	0.803	0.897	0.0
449461953		766	PREDICTED: translation factor GUF1 homol	0.994	0.710	0.893	0.0
449505867		766	PREDICTED: LOW QUALITY PROTEIN: translat	0.994	0.710	0.892	0.0
356530066		675	PREDICTED: translation factor GUF1 homol	1.0	0.810	0.873	0.0
357501711		672	GTP-binding protein lepA [Medicago trunc	1.0	0.813	0.854	0.0
115466368		663	Os06g0144800 [Oryza sativa Japonica Grou	1.0	0.825	0.842	0.0
242094648		665	hypothetical protein SORBIDRAFT_10g00307	0.992	0.816	0.839	0.0
119638453		667	GTP binding protein [Brachypodium sylvat	0.994	0.815	0.837	0.0
224140951		611	predicted protein [Populus trichocarpa]	0.996	0.891	0.858	0.0

>gi|255552880|ref|XP_002517483.1| GTP-binding protein lepA, putative [Ricinus communis] gi|317411652|sp|B9RUN8.1|GUF1_RICCO RecName: Full=Translation factor GUF1 homolog, mitochondrial; AltName: Full=Elongation factor 4 homolog; Short=EF-4; AltName: Full=GTPase GUF1 homolog; AltName: Full=Ribosomal back-translocase; Flags: Precursor gi|223543494|gb|EEF45025.1| GTP-binding protein lepA, putative [Ricinus communis]

Back alignment and taxonomy information

 Score = 1032 bits (2668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/547 (90%), Positives = 522/547 (95%)

Query: 1   MFYRNELNGPGTSEAHNPSSFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQA 60
           MF++   +GP   +AH P +FLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQA
Sbjct: 127 MFHKYNFHGPNIGDAHEPPTFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQA 186

Query: 61  QTVANFYLAFESELTIIPVINKIDQPTADPDRVKAQLKSMFDLDPSEALLTSAKTGQGLE 120
           QTVANFYLAFES LT+IPVINKIDQPTADPDRVKAQLKSMFDL+PS+ LLTSAKTGQGLE
Sbjct: 187 QTVANFYLAFESNLTVIPVINKIDQPTADPDRVKAQLKSMFDLEPSDCLLTSAKTGQGLE 246

Query: 121 HVLPAVIERIPPPRGIINSSLRMLLLDSYYDEYKGVICHVAVVDGTLRKGDKISSAATGQ 180
            VLPAVIERIP P G  NS LRMLLLDSYYDEYKGVICHVAVVDG LRKGDKISSAATG 
Sbjct: 247 QVLPAVIERIPSPPGYSNSPLRMLLLDSYYDEYKGVICHVAVVDGMLRKGDKISSAATGH 306

Query: 181 AYEIVDVGIMHPELTPTGVLLTGQVGYVVTGMRSTKEARIGDTLYHNKSIVEPLPGFKPA 240
           +YEI+DVG MHPELTPTG+LLTGQVGYVV+GMRSTKEAR+GDTLYH+++ VEPLPGFKPA
Sbjct: 307 SYEILDVGFMHPELTPTGILLTGQVGYVVSGMRSTKEARVGDTLYHSRTSVEPLPGFKPA 366

Query: 241 KHMVFSGLYPADGSDFEVLNHAIERLTCNDASVSVTKETSTALGLGFRCGFLGLLHMDVF 300
           KHMVFSGLYPADGSDF+ LNHAIERLTCNDASVSVTKE+S+ALGLGFRCGFLGLLHMDVF
Sbjct: 367 KHMVFSGLYPADGSDFDALNHAIERLTCNDASVSVTKESSSALGLGFRCGFLGLLHMDVF 426

Query: 301 HQRLEQEYGAHVISTVPTVPYIFEYSDGSKAEVQNPASLPSNPKKRVTACWEPTVVATII 360
           HQRLEQEYGAHVISTVPTVPYIFEYSDGSK +VQNPA+LPSNPKKRVTA WEPTVVATII
Sbjct: 427 HQRLEQEYGAHVISTVPTVPYIFEYSDGSKVQVQNPAALPSNPKKRVTASWEPTVVATII 486

Query: 361 IPSEYVGSVITLCSERRGQQLEYSFIDSQRAFMKYCLPLREIVVDFYNELKSLTSGYASF 420
           IPSEYVG VITLCSERRGQQLEYSFIDSQRAFMKY LPLREIVVDFYNELKS+TSGYASF
Sbjct: 487 IPSEYVGPVITLCSERRGQQLEYSFIDSQRAFMKYRLPLREIVVDFYNELKSITSGYASF 546

Query: 421 DYEDSEYQQADMVKLDILLNGQPVDAMATIVHNLKAQRVGRELVEKLKKFIDRQMFEITI 480
           DYEDSEYQ+A++VKLDILLNGQPVDAMATIVHNLKAQRVGRELV+KLKKFIDRQMFEITI
Sbjct: 547 DYEDSEYQEAELVKLDILLNGQPVDAMATIVHNLKAQRVGRELVDKLKKFIDRQMFEITI 606

Query: 481 QAAIGSKVIARETISAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAF 540
           QAAIGSKV+ARETISAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAF
Sbjct: 607 QAAIGSKVVARETISAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAF 666

Query: 541 HQLLRVS 547
           H+LL+VS
Sbjct: 667 HELLKVS 673

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225452725\|ref\|XP_002277245.1\| PREDICTED: translation factor GUF1 homolog, mitochondrial [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449461953\|ref\|XP_004148706.1\| PREDICTED: translation factor GUF1 homolog, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449505867\|ref\|XP_004162590.1\| PREDICTED: LOW QUALITY PROTEIN: translation factor GUF1 homolog, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356530066\|ref\|XP_003533605.1\| PREDICTED: translation factor GUF1 homolog, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|357501711\|ref\|XP_003621144.1\| GTP-binding protein lepA [Medicago truncatula] gi\|355496159\|gb\|AES77362.1\| GTP-binding protein lepA [Medicago truncatula]	Back alignment and taxonomy information

>gi|115466368|ref|NP_001056783.1| Os06g0144800 [Oryza sativa Japonica Group] gi|75109937|sp|Q5VQ69.1|GUF1_ORYSJ RecName: Full=Translation factor GUF1 homolog, mitochondrial; AltName: Full=Elongation factor 4 homolog; Short=EF-4; AltName: Full=GTPase GUF1 homolog; AltName: Full=Ribosomal back-translocase; Flags: Precursor gi|55296361|dbj|BAD68406.1| putative GTP-binding membrane protein LepA [Oryza sativa Japonica Group] gi|113594823|dbj|BAF18697.1| Os06g0144800 [Oryza sativa Japonica Group] gi|222634942|gb|EEE65074.1| hypothetical protein OsJ_20104 [Oryza sativa Japonica Group]

Back alignment and taxonomy information

>gi|242094648|ref|XP_002437814.1| hypothetical protein SORBIDRAFT_10g003070 [Sorghum bicolor] gi|317411653|sp|C5Z3W1.1|GUF1_SORBI RecName: Full=Translation factor GUF1 homolog, mitochondrial; AltName: Full=Elongation factor 4 homolog; Short=EF-4; AltName: Full=GTPase GUF1 homolog; AltName: Full=Ribosomal back-translocase; Flags: Precursor gi|241916037|gb|EER89181.1| hypothetical protein SORBIDRAFT_10g003070 [Sorghum bicolor]

Back alignment and taxonomy information

>gi\|119638453\|gb\|ABL85044.1\| GTP binding protein [Brachypodium sylvaticum]	Back alignment and taxonomy information

>gi\|224140951\|ref\|XP_002323840.1\| predicted protein [Populus trichocarpa] gi\|222866842\|gb\|EEF03973.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		547
TAIR\|locus:2178042		663	AT5G39900 "AT5G39900" [Arabido	0.989	0.815	0.784	2.8e-231
UNIPROTKB\|F1PF69		610	GUF1 "Translation factor GUF1,	0.954	0.855	0.559	1e-155
ZFIN\|ZDB-GENE-030131-4289		672	guf1 "GUF1 GTPase homolog (S.	0.963	0.784	0.545	1.3e-155
UNIPROTKB\|F1S3T1		614	GUF1 "Uncharacterized protein"	0.954	0.850	0.558	3.5e-155
DICTYBASE\|DDB_G0291708		685	guf1 "LepA family protein" [Di	0.956	0.763	0.554	5.1e-154
MGI\|MGI:2140726		651	Guf1 "GUF1 GTPase homolog (S.	0.954	0.801	0.550	5.1e-154
UNIPROTKB\|Q8N442		669	GUF1 "Translation factor GUF1,	0.956	0.781	0.553	1.3e-153
UNIPROTKB\|A6QLJ3		669	GUF1 "Translation factor GUF1,	0.954	0.780	0.556	1.7e-153
UNIPROTKB\|D4A6V2		651	Guf1 "Translation factor GUF1,	0.954	0.801	0.550	4.5e-153
UNIPROTKB\|F1NX95		661	GUF1 "Uncharacterized protein"	0.957	0.792	0.546	1.5e-152

TAIR\|locus:2178042 AT5G39900 "AT5G39900" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2231 (790.4 bits), Expect = 2.8e-231, P = 2.8e-231
 Identities = 429/547 (78%), Positives = 482/547 (88%)

Query:     1 MFYRNELNGPGTSEAHNPSSFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQA 60
             MFY N++      E    S +LLNLIDTPGHVDFSYEVSRSL+ACQGALLVVDAAQGVQA
Sbjct:   123 MFYENKV------EDQEASGYLLNLIDTPGHVDFSYEVSRSLSACQGALLVVDAAQGVQA 176

Query:    61 QTVANFYLAFESELTIIPVINKIDQPTADPDRVKAQLKSMFDLDPSEALLTSAKTGQGLE 120
             QTVANFYLAFE+ LTI+PVINKIDQPTADP+RVKAQLKSMFDLD  + LL SAKTG GLE
Sbjct:   177 QTVANFYLAFEANLTIVPVINKIDQPTADPERVKAQLKSMFDLDTEDVLLVSAKTGLGLE 236

Query:   121 HVLPAVIERIPPPRGIINSSLRMLLLDSYYDEYKGVICHVAVVDGTLRKGDKISSAATGQ 180
             HVLPAVIERIPPP GI  S LRMLL DS+++EYKGVIC+V+VVDG L KGDK+S AA+GQ
Sbjct:   237 HVLPAVIERIPPPPGISESPLRMLLFDSFFNEYKGVICYVSVVDGMLSKGDKVSFAASGQ 296

Query:   181 AYEIVDVGIMHPELTPTGVLLTGQVGYVVTGMRSTKEARIGDTLYHNKSIVEPLPGFKPA 240
             +YE++DVGIMHPELT TG+LLTGQVGY+VTGMR+TKEARIGDT+Y  K+ VEPLPGFKP 
Sbjct:   297 SYEVLDVGIMHPELTSTGMLLTGQVGYIVTGMRTTKEARIGDTIYRTKTTVEPLPGFKPV 356

Query:   241 KHMVFSGLYPADGSDFEVLNHAIERLTCNDASVSVTKETSTAXXXXXXXXXXXXXHMDVF 300
             +HMVFSG+YPADGSDFE L HA+E+LTCNDASVSV KETSTA             HMDVF
Sbjct:   357 RHMVFSGVYPADGSDFEALGHAMEKLTCNDASVSVAKETSTALGMGFRCGFLGLLHMDVF 416

Query:   301 HQRLEQEYGAHVISTVPTVPYIFEYSDGSKAEVQNPASLPSNPKKRVTACWEPTVVATII 360
             HQRLEQEYG  VIST+PTVPY FEYSDGSK +VQNPA+LPSNPK RVTA WEPTV+ATII
Sbjct:   417 HQRLEQEYGTQVISTIPTVPYTFEYSDGSKLQVQNPAALPSNPKYRVTASWEPTVIATII 476

Query:   361 IPSEYVGSVITLCSERRGQQLEYSFIDSQRAFMKYCLPLREIVVDFYNELKSLTSGYASF 420
             +PSEYVG+VI LCS+RRGQQLEY+FID+QR F+KY LPLREIVVDFY+ELKS+TSGYASF
Sbjct:   477 LPSEYVGAVINLCSDRRGQQLEYTFIDAQRVFLKYQLPLREIVVDFYDELKSITSGYASF 536

Query:   421 DYEDSEYQQADMVKLDILLNGQPVDAMATIVHNLKAQRVGRELVEKLKKFIDRQMFEITI 480
             DYED+EYQ +D+VKLDILLNGQ VDA+ATIVH  KA RVG+ELVEKLK +I+RQMFE+ I
Sbjct:   537 DYEDAEYQASDLVKLDILLNGQAVDALATIVHKQKAYRVGKELVEKLKNYIERQMFEVMI 596

Query:   481 QAAIGSKVIARETISAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAF 540
             QAAIGSK+IAR+TISAMRKNVLAKCYGGD+TRK+KLLEKQKEGKKRMKRVGSVDIP EAF
Sbjct:   597 QAAIGSKIIARDTISAMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPHEAF 656

Query:   541 HQLLRVS 547
              Q+L+VS
Sbjct:   657 QQILKVS 663

GO:0003746 "translation elongation factor activity" evidence=ISS

GO:0003924 "GTPase activity" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA;ISS

GO:0005886 "plasma membrane" evidence=ISM

UNIPROTKB\|F1PF69 GUF1 "Translation factor GUF1, mitochondrial" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-4289 guf1 "GUF1 GTPase homolog (S. cerevisiae)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S3T1 GUF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0291708 guf1 "LepA family protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

MGI\|MGI:2140726 Guf1 "GUF1 GTPase homolog (S. cerevisiae)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8N442 GUF1 "Translation factor GUF1, mitochondrial" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|A6QLJ3 GUF1 "Translation factor GUF1, mitochondrial" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|D4A6V2 Guf1 "Translation factor GUF1, mitochondrial" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NX95 GUF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
A5I644	LEPA_CLOBH	3, ., 6, ., 5, ., n, 1	0.5304	0.9561	0.8687	yes	no
Q89BJ8	LEPA_BRAJA	3, ., 6, ., 5, ., n, 1	0.5093	0.9689	0.8789	yes	no
B1KZP1	LEPA_CLOBM	3, ., 6, ., 5, ., n, 1	0.5342	0.9561	0.8687	yes	no
B1ILM7	LEPA_CLOBK	3, ., 6, ., 5, ., n, 1	0.5323	0.9561	0.8687	yes	no
B8FUP2	LEPA_DESHD	3, ., 6, ., 5, ., n, 1	0.5253	0.9689	0.8818	yes	no
A6Q241	LEPA_NITSB	3, ., 6, ., 5, ., n, 1	0.5320	0.9579	0.8791	yes	no
A4S3R2	GUF1_OSTLU	3, ., 6, ., 5, ., -	0.5430	0.9689	0.8141	yes	no
B9M4U5	LEPA_GEOSF	3, ., 6, ., 5, ., n, 1	0.5177	0.9689	0.8848	yes	no
B0G189	GUF1_DICDI	3, ., 6, ., 5, ., -	0.5656	0.9762	0.7795	yes	no
B3E9R0	LEPA_GEOLS	3, ., 6, ., 5, ., n, 1	0.5187	0.9670	0.8816	yes	no
Q5VQ69	GUF1_ORYSJ	3, ., 6, ., 5, ., -	0.8427	1.0	0.8250	yes	no
P60789	LEPA_GEOSL	3, ., 6, ., 5, ., n, 1	0.5232	0.9762	0.89	yes	no
Q5KWZ3	LEPA_GEOKA	3, ., 6, ., 5, ., n, 1	0.5102	0.9762	0.8768	yes	no
Q24SR6	LEPA_DESHY	3, ., 6, ., 5, ., n, 1	0.5253	0.9689	0.8818	yes	no
A5D3X6	LEPA_PELTS	3, ., 6, ., 5, ., n, 1	0.5449	0.9707	0.8820	yes	no
Q9KD76	LEPA_BACHD	3, ., 6, ., 5, ., n, 1	0.5018	0.9707	0.8719	yes	no
A4J7F8	LEPA_DESRM	3, ., 6, ., 5, ., n, 1	0.5253	0.9689	0.8818	yes	no
B0KA85	LEPA_THEP3	3, ., 6, ., 5, ., n, 1	0.5327	0.9725	0.8822	yes	no
Q8N442	GUF1_HUMAN	3, ., 6, ., 5, ., -	0.5711	0.9542	0.7802	yes	no
Q00ZZ1	GUF1_OSTTA	3, ., 6, ., 5, ., -	0.5310	0.9762	0.8005	yes	no
Q72E76	LEPA_DESVH	3, ., 6, ., 5, ., n, 1	0.5351	0.9579	0.8718	yes	no
B0CS18	GUF1_LACBS	3, ., 6, ., 5, ., -	0.5396	0.9561	0.8328	N/A	no
B0K3Y4	LEPA_THEPX	3, ., 6, ., 5, ., n, 1	0.5345	0.9725	0.8822	yes	no
B8DIZ5	LEPA_DESVM	3, ., 6, ., 5, ., n, 1	0.5403	0.9689	0.8818	yes	no
B3RXR7	GUF1_TRIAD	3, ., 6, ., 5, ., -	0.5588	0.9689	0.8030	N/A	no
C5Z3W1	GUF1_SORBI	3, ., 6, ., 5, ., -	0.8391	0.9926	0.8165	N/A	no
A0Q1R8	LEPA_CLONN	3, ., 6, ., 5, ., n, 1	0.5189	0.9597	0.8735	yes	no
Q8RB72	LEPA_THETN	3, ., 6, ., 5, ., n, 1	0.5420	0.9725	0.8822	yes	no
Q8C3X4	GUF1_MOUSE	3, ., 6, ., 5, ., -	0.5692	0.9542	0.8018	yes	no
Q39US7	LEPA_GEOMG	3, ., 6, ., 5, ., n, 1	0.5196	0.9689	0.8848	yes	no
A0L631	LEPA_MAGSM	3, ., 6, ., 5, ., n, 1	0.5224	0.9707	0.8879	yes	no
C3L3H1	LEPA_CLOB6	3, ., 6, ., 5, ., n, 1	0.5323	0.9561	0.8687	yes	no
B5EB36	LEPA_GEOBB	3, ., 6, ., 5, ., n, 1	0.5262	0.9670	0.8831	yes	no
Q2JWR1	LEPA_SYNJA	3, ., 6, ., 5, ., n, 1	0.5430	0.9670	0.8772	yes	no
Q3AF13	LEPA_CARHZ	3, ., 6, ., 5, ., n, 1	0.5400	0.9762	0.8855	yes	no
A6QLJ3	GUF1_BOVIN	3, ., 6, ., 5, ., -	0.5749	0.9542	0.7802	yes	no
C6DZ67	LEPA_GEOSM	3, ., 6, ., 5, ., n, 1	0.5224	0.9670	0.8831	yes	no
Q67S76	LEPA_SYMTH	3, ., 6, ., 5, ., n, 1	0.5423	0.9652	0.8756	yes	no
B8B2R1	GUF1_ORYSI	3, ., 6, ., 5, ., -	0.8117	0.9725	0.8209	N/A	no
B4U6M2	LEPA_HYDS0	3, ., 6, ., 5, ., n, 1	0.5294	0.9579	0.8747	yes	no
Q9FLE4	GUF1_ARATH	3, ., 6, ., 5, ., -	0.8062	0.9890	0.8159	yes	no
B9RUN8	GUF1_RICCO	3, ., 6, ., 5, ., -	0.9012	1.0	0.8127	N/A	no
A9S3D3	GUF1_PHYPA	3, ., 6, ., 5, ., -	0.7779	0.9890	0.7909	N/A	no
Q2RKX8	LEPA_MOOTA	3, ., 6, ., 5, ., n, 1	0.5290	0.9689	0.8803	yes	no
A7GHI0	LEPA_CLOBL	3, ., 6, ., 5, ., n, 1	0.5323	0.9561	0.8687	yes	no
C1FVU4	LEPA_CLOBJ	3, ., 6, ., 5, ., n, 1	0.5304	0.9561	0.8687	yes	no
B0TAD2	LEPA_HELMI	3, ., 6, ., 5, ., n, 1	0.5289	0.9725	0.8851	yes	no
Q2JQ51	LEPA_SYNJB	3, ., 6, ., 5, ., n, 1	0.5459	0.9689	0.8789	yes	no
A5G4G3	LEPA_GEOUR	3, ., 6, ., 5, ., n, 1	0.5262	0.9670	0.8831	yes	no
A7FXL9	LEPA_CLOB1	3, ., 6, ., 5, ., n, 1	0.5304	0.9561	0.8687	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.5	0.921
3rd Layer	3.6.5.n1	0.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		547
PRK05433		600	PRK05433, PRK05433, GTP-binding protein LepA; Prov	0.0
COG0481		603	COG0481, LepA, Membrane GTPase LepA [Cell envelope	0.0
TIGR01393		595	TIGR01393, lepA, GTP-binding protein LepA	0.0
cd01890		179	cd01890, LepA, LepA also known as Elongation Facto	2e-74
pfam06421		108	pfam06421, LepA_C, GTP-binding protein LepA C-term	6e-65
cd03699		86	cd03699, lepA_II, lepA_II: This subfamily represen	9e-43
cd03709		80	cd03709, lepA_C, lepA_C: This family represents th	2e-38
pfam00009		184	pfam00009, GTP_EFTU, Elongation factor Tu GTP bind	1e-34
TIGR01394		594	TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip	7e-32
COG1217		603	COG1217, TypA, Predicted membrane GTPase involved	1e-28
cd00881		183	cd00881, GTP_translation_factor, GTP translation f	7e-28
cd01514		79	cd01514, Elongation_Factor_C, Elongation factor G	9e-25
pfam00679		89	pfam00679, EFG_C, Elongation factor G C-terminus	3e-24
cd01891		194	cd01891, TypA_BipA, Tyrosine phosphorylated protei	4e-22
cd01885		218	cd01885, EF2, Elongation Factor 2 (EF2) in archaea	4e-22
TIGR00487		587	TIGR00487, IF-2, translation initiation factor IF-	6e-22
PRK10218		607	PRK10218, PRK10218, GTP-binding protein; Provision	9e-22
PRK12740		668	PRK12740, PRK12740, elongation factor G; Reviewed	2e-19
COG0480		697	COG0480, FusA, Translation elongation factors (GTP	5e-19
cd04168		237	cd04168, TetM_like, Tet(M)-like family includes Te	1e-17
cd01886		270	cd01886, EF-G, Elongation factor G (EF-G) family i	1e-17
cd04167		213	cd04167, Snu114p, Snu114p, a spliceosome protein,	3e-17
COG0532		509	COG0532, InfB, Translation initiation factor 2 (IF	5e-17
PRK13351		687	PRK13351, PRK13351, elongation factor G; Reviewed	2e-16
TIGR00484		689	TIGR00484, EF-G, translation elongation factor EF-	2e-15
cd01887		169	cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk	6e-15
TIGR00490		720	TIGR00490, aEF-2, translation elongation factor aE	1e-14
PTZ00416		836	PTZ00416, PTZ00416, elongation factor 2; Provision	2e-14
cd04169		268	cd04169, RF3, Release Factor 3 (RF3) protein invol	8e-14
PRK05306		746	PRK05306, infB, translation initiation factor IF-2	1e-13
TIGR00503		527	TIGR00503, prfC, peptide chain release factor 3	2e-13
CHL00189		742	CHL00189, infB, translation initiation factor 2; P	3e-13
COG0480		697	COG0480, FusA, Translation elongation factors (GTP	5e-13
COG4108		528	COG4108, PrfC, Peptide chain release factor RF-3 [	5e-13
cd04170		268	cd04170, EF-G_bact, Elongation factor G (EF-G) fam	5e-13
PRK12739		691	PRK12739, PRK12739, elongation factor G; Reviewed	6e-13
PRK07560		731	PRK07560, PRK07560, elongation factor EF-2; Review	1e-12
PRK00007		693	PRK00007, PRK00007, elongation factor G; Reviewed	1e-12
TIGR00475		581	TIGR00475, selB, selenocysteine-specific elongatio	1e-11
PLN00116		843	PLN00116, PLN00116, translation elongation factor	3e-11
PRK00741		526	PRK00741, prfC, peptide chain release factor 3; Pr	5e-11
cd00882		161	cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s	7e-11
cd03713		78	cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar	9e-11
cd01895		174	cd01895, EngA2, EngA2 GTPase contains the second d	1e-10
cd04171		170	cd04171, SelB, SelB, the dedicated elongation fact	3e-10
PRK13351		687	PRK13351, PRK13351, elongation factor G; Reviewed	1e-09
PRK00093		435	PRK00093, PRK00093, GTP-binding protein Der; Revie	1e-09
TIGR03594		429	TIGR03594, GTPase_EngA, ribosome-associated GTPase	2e-09
TIGR00231		162	TIGR00231, small_GTP, small GTP-binding protein do	1e-08
COG3276		447	COG3276, SelB, Selenocysteine-specific translation	2e-08
COG1160		444	COG1160, COG1160, Predicted GTPases [General funct	2e-08
cd00880		161	cd00880, Era_like, E	4e-08
PRK12740		668	PRK12740, PRK12740, elongation factor G; Reviewed	1e-07
cd01342		83	cd01342, Translation_Factor_II_like, Translation_F	2e-07
TIGR00483		426	TIGR00483, EF-1_alpha, translation elongation fact	2e-07
COG5256		428	COG5256, TEF1, Translation elongation factor EF-1a	2e-07
PRK12740		668	PRK12740, PRK12740, elongation factor G; Reviewed	3e-07
PRK13351		687	PRK13351, PRK13351, elongation factor G; Reviewed	2e-06
cd03710		79	cd03710, BipA_TypA_C, BipA_TypA_C: a C-terminal po	2e-06
TIGR03918		391	TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster	3e-06
COG0050		394	COG0050, TufB, GTPases - translation elongation fa	5e-06
PRK12317		425	PRK12317, PRK12317, elongation factor 1-alpha; Rev	2e-05
cd04166		209	cd04166, CysN_ATPS, CysN, together with protein Cy	3e-05
PRK00089		292	PRK00089, era, GTPase Era; Reviewed	3e-05
PRK05291		449	PRK05291, trmE, tRNA modification GTPase TrmE; Rev	5e-05
COG0480		697	COG0480, FusA, Translation elongation factors (GTP	6e-05
cd04164		159	cd04164, trmE, trmE is a tRNA modification GTPase	6e-05
smart00838		85	smart00838, EFG_C, Elongation factor G C-terminus	9e-05
cd01878		204	cd01878, HflX, HflX GTPase family	1e-04
pfam03144		70	pfam03144, GTP_EFTU_D2, Elongation factor Tu domai	1e-04
COG0486		454	COG0486, ThdF, Predicted GTPase [General function	2e-04
TIGR03680		406	TIGR03680, eif2g_arch, translation initiation fact	3e-04
COG2895		431	COG2895, CysN, GTPases - Sulfate adenylate transfe	3e-04
TIGR02034		406	TIGR02034, CysN, sulfate adenylyltransferase, larg	3e-04
COG1160		444	COG1160, COG1160, Predicted GTPases [General funct	4e-04
PRK07560		731	PRK07560, PRK07560, elongation factor EF-2; Review	5e-04
cd01889		192	cd01889, SelB_euk, SelB, the dedicated elongation	8e-04
TIGR00484		689	TIGR00484, EF-G, translation elongation factor EF-	0.002
cd04163		168	cd04163, Era, E	0.002
TIGR00485		394	TIGR00485, EF-Tu, translation elongation factor TU	0.002
COG2229		187	COG2229, COG2229, Predicted GTPase [General functi	0.004
PRK04004		586	PRK04004, PRK04004, translation initiation factor	0.004

>gnl\|CDD\|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional	Back alignment and domain information

 Score =  860 bits (2226), Expect = 0.0
 Identities = 307/526 (58%), Positives = 400/526 (76%), Gaps = 6/526 (1%)

Query: 23  LNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYLAFESELTIIPVINK 82
           LNLIDTPGHVDFSYEVSRSLAAC+GALLVVDA+QGV+AQT+AN YLA E++L IIPV+NK
Sbjct: 76  LNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVLNK 135

Query: 83  IDQPTADPDRVKAQLKSMFDLDPSEALLTSAKTGQGLEHVLPAVIERIPPPRGIINSSLR 142
           ID P ADP+RVK +++ +  +D S+A+L SAKTG G+E VL A++ERIPPP+G  ++ L+
Sbjct: 136 IDLPAADPERVKQEIEDVIGIDASDAVLVSAKTGIGIEEVLEAIVERIPPPKGDPDAPLK 195

Query: 143 MLLLDSYYDEYKGVICHVAVVDGTLRKGDKISSAATGQAYEIVDVGIMHPELTPTGVLLT 202
            L+ DS+YD Y+GV+  V VVDGTL+KGDKI   +TG+ YE+ +VG+  P++ P   L  
Sbjct: 196 ALIFDSWYDNYRGVVVLVRVVDGTLKKGDKIKMMSTGKEYEVDEVGVFTPKMVPVDELSA 255

Query: 203 GQVGYVVTGMRSTKEARIGDTLYH-NKSIVEPLPGFKPAKHMVFSGLYPADGSDFEVLNH 261
           G+VGY++ G++  ++AR+GDT+        EPLPGFK  K MVF+GLYP D  D+E L  
Sbjct: 256 GEVGYIIAGIKDVRDARVGDTITLAKNPAEEPLPGFKEVKPMVFAGLYPVDSDDYEDLRD 315

Query: 262 AIERLTCNDASVSVTKETSTALGLGFRCGFLGLLHMDVFHQRLEQEYGAHVISTVPTVPY 321
           A+E+L  NDAS++   ETS ALG GFRCGFLGLLHM++  +RLE+E+   +I+T P+V Y
Sbjct: 316 ALEKLQLNDASLTYEPETSQALGFGFRCGFLGLLHMEIIQERLEREFDLDLITTAPSVVY 375

Query: 322 IFEYSDGSKAEVQNPASLPSNPK-KRVTACWEPTVVATIIIPSEYVGSVITLCSERRGQQ 380
               +DG   EV NP+ LP   K + +    EP V ATII+P EYVG+V+ LC E+RG Q
Sbjct: 376 EVTLTDGEVIEVDNPSKLPDPGKIEEIE---EPIVKATIIVPQEYVGAVMELCQEKRGVQ 432

Query: 381 LEYSFIDSQRAFMKYCLPLREIVVDFYNELKSLTSGYASFDYEDSEYQQADMVKLDILLN 440
            +  ++   R  + Y LPL EIV DF++ LKS++ GYAS DYE   Y+++D+VKLDIL+N
Sbjct: 433 KDMEYLG-NRVELTYELPLAEIVFDFFDRLKSVSRGYASLDYEFIGYRESDLVKLDILIN 491

Query: 441 GQPVDAMATIVHNLKAQRVGRELVEKLKKFIDRQMFEITIQAAIGSKVIARETISAMRKN 500
           G+PVDA++ IVH  KA   GR LVEKLK+ I RQ FEI IQAAIGSK+IARETI A+RK+
Sbjct: 492 GEPVDALSFIVHRDKAYERGRALVEKLKELIPRQQFEIPIQAAIGSKIIARETIKALRKD 551

Query: 501 VLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHQLLRV 546
           VLAKCYGGD++RKRKLLEKQKEGKKRMK++G+V+IPQEAF  +L+V
Sbjct: 552 VLAKCYGGDISRKRKLLEKQKEGKKRMKQIGNVEIPQEAFLAVLKV 597

Length = 600

>gnl\|CDD\|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|130460 TIGR01393, lepA, GTP-binding protein LepA	Back alignment and domain information

>gnl\|CDD\|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4)	Back alignment and domain information

>gnl\|CDD\|203441 pfam06421, LepA_C, GTP-binding protein LepA C-terminus	Back alignment and domain information

>gnl\|CDD\|239670 cd03699, lepA_II, lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane	Back alignment and domain information

>gnl\|CDD\|239680 cd03709, lepA_C, lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane	Back alignment and domain information

>gnl\|CDD\|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain	Back alignment and domain information

>gnl\|CDD\|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA	Back alignment and domain information

>gnl\|CDD\|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors	Back alignment and domain information

>gnl\|CDD\|238772 cd01514, Elongation_Factor_C, Elongation factor G C-terminus	Back alignment and domain information

>gnl\|CDD\|201388 pfam00679, EFG_C, Elongation factor G C-terminus	Back alignment and domain information

>gnl\|CDD\|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases	Back alignment and domain information

>gnl\|CDD\|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya	Back alignment and domain information

>gnl\|CDD\|232995 TIGR00487, IF-2, translation initiation factor IF-2	Back alignment and domain information

>gnl\|CDD\|104396 PRK10218, PRK10218, GTP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|237186 PRK12740, PRK12740, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins	Back alignment and domain information

>gnl\|CDD\|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis	Back alignment and domain information

>gnl\|CDD\|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase	Back alignment and domain information

>gnl\|CDD\|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|237358 PRK13351, PRK13351, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|129575 TIGR00484, EF-G, translation elongation factor EF-G	Back alignment and domain information

>gnl\|CDD\|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family	Back alignment and domain information

>gnl\|CDD\|129581 TIGR00490, aEF-2, translation elongation factor aEF-2	Back alignment and domain information

>gnl\|CDD\|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional	Back alignment and domain information

>gnl\|CDD\|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria	Back alignment and domain information

>gnl\|CDD\|235401 PRK05306, infB, translation initiation factor IF-2; Validated	Back alignment and domain information

>gnl\|CDD\|129594 TIGR00503, prfC, peptide chain release factor 3	Back alignment and domain information

>gnl\|CDD\|177089 CHL00189, infB, translation initiation factor 2; Provisional	Back alignment and domain information

>gnl\|CDD\|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|206733 cd04170, EF-G_bact, Elongation factor G (EF-G) family	Back alignment and domain information

>gnl\|CDD\|237185 PRK12739, PRK12739, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed	Back alignment and domain information

>gnl\|CDD\|234569 PRK00007, PRK00007, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB	Back alignment and domain information

>gnl\|CDD\|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|179105 PRK00741, prfC, peptide chain release factor 3; Provisional	Back alignment and domain information

>gnl\|CDD\|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|239683 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G	Back alignment and domain information

>gnl\|CDD\|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA	Back alignment and domain information

>gnl\|CDD\|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome	Back alignment and domain information

>gnl\|CDD\|237358 PRK13351, PRK13351, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed	Back alignment and domain information

>gnl\|CDD\|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA	Back alignment and domain information

>gnl\|CDD\|232886 TIGR00231, small_GTP, small GTP-binding protein domain	Back alignment and domain information

>gnl\|CDD\|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|224082 COG1160, COG1160, Predicted GTPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|206646 cd00880, Era_like, E	Back alignment and domain information

>gnl\|CDD\|237186 PRK12740, PRK12740, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins	Back alignment and domain information

>gnl\|CDD\|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha	Back alignment and domain information

>gnl\|CDD\|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|237186 PRK12740, PRK12740, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|237358 PRK13351, PRK13351, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|239681 cd03710, BipA_TypA_C, BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2	Back alignment and domain information

>gnl\|CDD\|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF	Back alignment and domain information

>gnl\|CDD\|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed	Back alignment and domain information

>gnl\|CDD\|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex	Back alignment and domain information

>gnl\|CDD\|234624 PRK00089, era, GTPase Era; Reviewed	Back alignment and domain information

>gnl\|CDD\|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>gnl\|CDD\|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|206727 cd04164, trmE, trmE is a tRNA modification GTPase	Back alignment and domain information

>gnl\|CDD\|197906 smart00838, EFG_C, Elongation factor G C-terminus	Back alignment and domain information

>gnl\|CDD\|206666 cd01878, HflX, HflX GTPase family	Back alignment and domain information

>gnl\|CDD\|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2	Back alignment and domain information

>gnl\|CDD\|223561 COG0486, ThdF, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma	Back alignment and domain information

>gnl\|CDD\|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit	Back alignment and domain information

>gnl\|CDD\|224082 COG1160, COG1160, Predicted GTPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed	Back alignment and domain information

>gnl\|CDD\|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome	Back alignment and domain information

>gnl\|CDD\|129575 TIGR00484, EF-G, translation elongation factor EF-G	Back alignment and domain information

>gnl\|CDD\|206726 cd04163, Era, E	Back alignment and domain information

>gnl\|CDD\|129576 TIGR00485, EF-Tu, translation elongation factor TU	Back alignment and domain information

>gnl\|CDD\|225138 COG2229, COG2229, Predicted GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|235195 PRK04004, PRK04004, translation initiation factor IF-2; Validated	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		547
COG0481		603	LepA Membrane GTPase LepA [Cell envelope biogenesi	100.0
KOG0462		650	consensus Elongation factor-type GTP-binding prote	100.0
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	100.0
PRK05433		600	GTP-binding protein LepA; Provisional	100.0
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	100.0
PRK10218		607	GTP-binding protein; Provisional	100.0
COG0480		697	FusA Translation elongation factors (GTPases) [Tra	100.0
KOG0465		721	consensus Mitochondrial elongation factor [Transla	100.0
PRK00007		693	elongation factor G; Reviewed	100.0
PRK12739		691	elongation factor G; Reviewed	100.0
PRK13351		687	elongation factor G; Reviewed	100.0
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	100.0
COG1217		603	TypA Predicted membrane GTPase involved in stress	100.0
PRK12740		668	elongation factor G; Reviewed	100.0
PRK07560		731	elongation factor EF-2; Reviewed	100.0
TIGR00490		720	aEF-2 translation elongation factor aEF-2. This mo	100.0
PLN00116		843	translation elongation factor EF-2 subunit; Provis	100.0
PTZ00416		836	elongation factor 2; Provisional	100.0
PF06421		108	LepA_C: GTP-binding protein LepA C-terminus; Inter	100.0
KOG0464		753	consensus Elongation factor G [Translation, riboso	100.0
PRK00741		526	prfC peptide chain release factor 3; Provisional	100.0
TIGR00503		527	prfC peptide chain release factor 3. This translat	100.0
KOG0469		842	consensus Elongation factor 2 [Translation, riboso	100.0
COG4108		528	PrfC Peptide chain release factor RF-3 [Translatio	100.0
KOG0468		971	consensus U5 snRNP-specific protein [Translation,	100.0
KOG0467		887	consensus Translation elongation factor 2/ribosome	100.0
PRK05306		787	infB translation initiation factor IF-2; Validated	99.96
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	99.96
COG5256		428	TEF1 Translation elongation factor EF-1alpha (GTPa	99.96
PRK12736		394	elongation factor Tu; Reviewed	99.96
PTZ00141		446	elongation factor 1- alpha; Provisional	99.96
PLN00043		447	elongation factor 1-alpha; Provisional	99.95
CHL00071		409	tufA elongation factor Tu	99.95
TIGR00485		394	EF-Tu translation elongation factor TU. This align	99.95
PRK12317		425	elongation factor 1-alpha; Reviewed	99.95
PRK12735		396	elongation factor Tu; Reviewed	99.95
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	99.95
PRK00049		396	elongation factor Tu; Reviewed	99.94
PTZ00327		460	eukaryotic translation initiation factor 2 gamma s	99.94
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	99.94
PLN03126		478	Elongation factor Tu; Provisional	99.94
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	99.94
PLN03127		447	Elongation factor Tu; Provisional	99.94
PRK04000		411	translation initiation factor IF-2 subunit gamma;	99.93
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	99.93
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	99.93
CHL00189		742	infB translation initiation factor 2; Provisional	99.93
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	99.93
COG3276		447	SelB Selenocysteine-specific translation elongatio	99.93
KOG0460		449	consensus Mitochondrial translation elongation fac	99.92
COG0050		394	TufB GTPases - translation elongation factors [Tra	99.92
COG2895		431	CysN GTPases - Sulfate adenylate transferase subun	99.91
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	99.91
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	99.9
KOG1145		683	consensus Mitochondrial translation initiation fac	99.89
KOG0458		603	consensus Elongation factor 1 alpha [Translation,	99.87
cd03709		80	lepA_C lepA_C: This family represents the C-termin	99.85
PRK04004		586	translation initiation factor IF-2; Validated	99.85
cd03710		79	BipA_TypA_C BipA_TypA_C: a C-terminal portion of B	99.84
PRK14845		1049	translation initiation factor IF-2; Provisional	99.83
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	99.83
COG5258		527	GTPBP1 GTPase [General function prediction only]	99.82
smart00838		85	EFG_C Elongation factor G C-terminus. This domain	99.81
PF00679		89	EFG_C: Elongation factor G C-terminus; InterPro: I	99.81
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	99.8
cd04097		78	mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elo	99.8
COG5257		415	GCD11 Translation initiation factor 2, gamma subun	99.8
cd03711		78	Tet_C Tet_C: C-terminus of ribosomal protection pr	99.8
cd04096		80	eEF2_snRNP_like_C eEF2_snRNP_like_C: this family r	99.8
KOG0461		522	consensus Selenocysteine-specific elongation facto	99.79
cd03713		78	EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-	99.78
KOG0459		501	consensus Polypeptide release factor 3 [Translatio	99.78
cd04098		80	eEF2_C_snRNP eEF2_C_snRNP: This family includes a	99.78
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	99.78
cd01514		79	Elongation_Factor_C Elongation factor G C-terminus	99.77
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	99.73
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	99.71
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	99.68
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	99.68
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	99.65
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	99.65
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	99.64
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	99.63
PF14492		75	EFG_II: Elongation Factor G, domain II; PDB: 1WDT_	99.62
KOG0463		641	consensus GTP-binding protein GP-1 [General functi	99.62
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	99.6
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	99.6
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	99.6
cd03699		86	lepA_II lepA_II: This subfamily represents the dom	99.59
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	99.59
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	99.58
KOG1144		1064	consensus Translation initiation factor 5B (eIF-5B	99.58
cd00881		189	GTP_translation_factor GTP translation factor fami	99.57
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	99.56
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	99.53
cd04092		83	mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri	99.53
cd04088		83	EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen	99.51
KOG1143		591	consensus Predicted translation elongation factor	99.5
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	99.5
COG1160		444	Predicted GTPases [General function prediction onl	99.49
KOG0466		466	consensus Translation initiation factor 2, gamma s	99.49
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	99.48
cd04091		81	mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri	99.48
PTZ00099		176	rab6; Provisional	99.47
KOG0084		205	consensus GTPase Rab1/YPT1, small G protein superf	99.47
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	99.47
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	99.47
cd03690		85	Tet_II Tet_II: This subfamily represents domain II	99.46
COG1159		298	Era GTPase [General function prediction only]	99.46
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	99.46
PRK15494		339	era GTPase Era; Provisional	99.46
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	99.45
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	99.44
cd03691		86	BipA_TypA_II BipA_TypA_II: domain II of BipA (also	99.43
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.43
PLN00223		181	ADP-ribosylation factor; Provisional	99.43
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	99.42
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.42
KOG0092		200	consensus GTPase Rab5/YPT51 and related small G pr	99.42
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	99.41
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	99.41
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	99.41
PTZ00369		189	Ras-like protein; Provisional	99.41
PRK03003		472	GTP-binding protein Der; Reviewed	99.41
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	99.4
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	99.4
KOG0078		207	consensus GTP-binding protein SEC4, small G protei	99.4
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	99.4
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	99.4
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	99.4
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	99.39
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	99.39
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	99.39
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	99.39
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	99.39
cd03689		85	RF3_II RF3_II: this subfamily represents the domai	99.39
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	99.39
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	99.39
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	99.39
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	99.39
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	99.39
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	99.38
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	99.38
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	99.38
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	99.38
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	99.37
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	99.36
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	99.36
KOG0098		216	consensus GTPase Rab2, small G protein superfamily	99.36
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	99.36
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	99.36
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	99.36
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	99.36
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	99.36
PRK00093		435	GTP-binding protein Der; Reviewed	99.36
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	99.36
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	99.35
PRK04213		201	GTP-binding protein; Provisional	99.35
PRK03003		472	GTP-binding protein Der; Reviewed	99.35
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	99.34
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	99.34
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	99.34
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	99.34
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	99.34
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	99.34
PRK00093		435	GTP-binding protein Der; Reviewed	99.34
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	99.34
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	99.34
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	99.34
COG1160		444	Predicted GTPases [General function prediction onl	99.34
PRK00089		292	era GTPase Era; Reviewed	99.34
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	99.33
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	99.33
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	99.33
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	99.33
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	99.33
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	99.33
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	99.33
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	99.33
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	99.32
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	99.32
PTZ00133		182	ADP-ribosylation factor; Provisional	99.32
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	99.32
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	99.32
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	99.32
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	99.32
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	99.32
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	99.31
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	99.31
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	99.31
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	99.31
KOG0094		221	consensus GTPase Rab6/YPT6/Ryh1, small G protein s	99.31
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	99.3
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	99.3
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	99.3
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	99.3
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	99.3
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	99.3
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	99.3
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	99.29
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	99.29
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	99.29
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	99.28
PLN03118		211	Rab family protein; Provisional	99.28
PLN03110		216	Rab GTPase; Provisional	99.28
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	99.28
KOG0093		193	consensus GTPase Rab3, small G protein superfamily	99.28
PRK15467		158	ethanolamine utilization protein EutP; Provisional	99.28
KOG0083		192	consensus GTPase Rab26/Rab37, small G protein supe	99.27
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	99.27
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	99.27
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	99.27
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	99.27
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	99.27
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	99.27
smart00178		184	SAR Sar1p-like members of the Ras-family of small	99.27
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	99.27
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	99.26
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	99.25
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	99.25
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	99.24
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	99.24
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	99.24
COG2229		187	Predicted GTPase [General function prediction only	99.24
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	99.23
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	99.22
KOG0080		209	consensus GTPase Rab18, small G protein superfamil	99.22
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	99.21
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	99.21
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	99.21
KOG0079		198	consensus GTP-binding protein H-ray, small G prote	99.21
cd01881		176	Obg_like The Obg-like subfamily consists of five w	99.21
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	99.2
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	99.2
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	99.2
PRK12299		335	obgE GTPase CgtA; Reviewed	99.2
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	99.2
KOG0087		222	consensus GTPase Rab11/YPT3, small G protein super	99.19
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	99.19
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	99.19
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	99.18
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	99.18
PLN03108		210	Rab family protein; Provisional	99.18
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	99.17
KOG0081		219	consensus GTPase Rab27, small G protein superfamil	99.17
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	99.17
KOG0086		214	consensus GTPase Rab4, small G protein superfamily	99.17
KOG0095		213	consensus GTPase Rab30, small G protein superfamil	99.16
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	99.16
KOG0088		218	consensus GTPase Rab21, small G protein superfamil	99.15
COG0486		454	ThdF Predicted GTPase [General function prediction	99.15
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	99.15
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	99.14
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	99.14
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	99.13
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	99.12
PRK12298		390	obgE GTPase CgtA; Reviewed	99.12
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	99.1
PRK12297		424	obgE GTPase CgtA; Reviewed	99.08
KOG0394		210	consensus Ras-related GTPase [General function pre	99.08
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	99.08
PRK12296		500	obgE GTPase CgtA; Reviewed	99.07
COG0218		200	Predicted GTPase [General function prediction only	99.06
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	99.05
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	99.05
cd03700		93	eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami	99.04
KOG0091		213	consensus GTPase Rab39, small G protein superfamil	99.04
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	99.03
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	99.02
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	99.01
KOG0075		186	consensus GTP-binding ADP-ribosylation factor-like	99.0
PRK11058		426	GTPase HflX; Provisional	98.97
PRK09866		741	hypothetical protein; Provisional	98.97
cd03698		83	eRF3_II_like eRF3_II_like: domain similar to domai	98.93
cd03693		91	EF1_alpha_II EF1_alpha_II: this family represents	98.93
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	98.91
KOG0395		196	consensus Ras-related GTPase [General function pre	98.91
KOG0097		215	consensus GTPase Rab14, small G protein superfamil	98.9
cd04090		94	eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina	98.89
KOG0073		185	consensus GTP-binding ADP-ribosylation factor-like	98.87
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	98.87
KOG0070		181	consensus GTP-binding ADP-ribosylation factor Arf1	98.86
cd04105		203	SR_beta Signal recognition particle receptor, beta	98.85
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	98.8
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	98.77
KOG0071		180	consensus GTP-binding ADP-ribosylation factor Arf6	98.76
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	98.75
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	98.74
cd04089		82	eRF3_II eRF3_II: domain II of the eukaryotic class	98.74
KOG1423		379	consensus Ras-like GTPase ERA [Cell cycle control,	98.71
cd03695		81	CysN_NodQ_II CysN_NodQ_II: This subfamily represen	98.71
KOG0076		197	consensus GTP-binding ADP-ribosylation factor-like	98.7
cd01342		83	Translation_Factor_II_like Translation_Factor_II_l	98.68
KOG0072		182	consensus GTP-binding ADP-ribosylation factor-like	98.66
cd01896		233	DRG The developmentally regulated GTP-binding prot	98.66
PRK13768		253	GTPase; Provisional	98.65
cd03696		83	selB_II selB_II: this subfamily represents the dom	98.63
KOG0393		198	consensus Ras-related small GTPase, Rho type [Gene	98.58
COG1100		219	GTPase SAR1 and related small G proteins [General	98.57
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	98.57
cd03697		87	EFTU_II EFTU_II: Elongation factor Tu domain II. E	98.54
cd03694		87	GTPBP_II Domain II of the GP-1 family of GTPase. T	98.53
PF03144		74	GTP_EFTU_D2: Elongation factor Tu domain 2; InterP	98.49
PLN00023		334	GTP-binding protein; Provisional	98.48
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	98.43
KOG1489		366	consensus Predicted GTP-binding protein (ODN super	98.43
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	98.41
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	98.36
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	98.35
KOG4252		246	consensus GTP-binding protein [Signal transduction	98.34
KOG1191		531	consensus Mitochondrial GTPase [Translation, ribos	98.31
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	98.29
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	98.27
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	98.24
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	98.24
PRK09435		332	membrane ATPase/protein kinase; Provisional	98.2
PRK09563		287	rbgA GTPase YlqF; Reviewed	98.18
COG2262		411	HflX GTPases [General function prediction only]	98.17
COG1084		346	Predicted GTPase [General function prediction only	98.17
PF09439		181	SRPRB: Signal recognition particle receptor beta s	98.14
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	98.12
KOG0074		185	consensus GTP-binding ADP-ribosylation factor-like	98.11
cd03692		84	mtIF2_IVc mtIF2_IVc: this family represents the C2	98.09
KOG0096		216	consensus GTPase Ran/TC4/GSP1 (nuclear protein tra	98.06
PRK12289		352	GTPase RsgA; Reviewed	98.02
KOG0090		238	consensus Signal recognition particle receptor, be	97.98
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	97.98
PRK00098		298	GTPase RsgA; Reviewed	97.94
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	97.93
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	97.93
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	97.91
PRK12288		347	GTPase RsgA; Reviewed	97.88
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	97.86
KOG0052		391	consensus Translation elongation factor EF-1 alpha	97.83
COG0536		369	Obg Predicted GTPase [General function prediction	97.83
cd01850		276	CDC_Septin CDC/Septin. Septins are a conserved fam	97.82
PRK09602		396	translation-associated GTPase; Reviewed	97.81
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	97.79
COG1163		365	DRG Predicted GTPase [General function prediction	97.77
TIGR02836		492	spore_IV_A stage IV sporulation protein A. A compa	97.76
PF04670		232	Gtr1_RagA: Gtr1/RagA G protein conserved region; I	97.75
TIGR00101		199	ureG urease accessory protein UreG. This model rep	97.73
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	97.72
KOG0077		193	consensus Vesicle coat complex COPII, GTPase subun	97.71
COG3596		296	Predicted GTPase [General function prediction only	97.71
PRK01889		356	GTPase RsgA; Reviewed	97.69
COG4917		148	EutP Ethanolamine utilization protein [Amino acid	97.65
KOG3883		198	consensus Ras family small GTPase [Signal transduc	97.63
KOG1673		205	consensus Ras GTPases [General function prediction	97.6
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	97.56
PRK13796		365	GTPase YqeH; Provisional	97.55
KOG2486		320	consensus Predicted GTPase [General function predi	97.46
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	97.43
KOG1490		620	consensus GTP-binding protein CRFG/NOG1 (ODN super	97.42
cd03688		113	eIF2_gamma_II eIF2_gamma_II: this subfamily repres	97.33
cd03702		95	IF2_mtIF2_II This family represents the domain II	97.26
cd03110		179	Fer4_NifH_child This protein family's function is	97.14
cd00066		317	G-alpha G protein alpha subunit. The alpha subunit	97.01
smart00275		342	G_alpha G protein alpha subunit. Subunit of G prot	96.98
cd03701		95	IF2_IF5B_II IF2_IF5B_II: This family represents th	96.96
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	96.95
COG1162		301	Predicted GTPases [General function prediction onl	96.92
KOG4423		229	consensus GTP-binding protein-like, RAS superfamil	96.9
PTZ00258		390	GTP-binding protein; Provisional	96.84
PF00350		168	Dynamin_N: Dynamin family; InterPro: IPR001401 Mem	96.83
cd04178		172	Nucleostemin_like Nucleostemin-like. Nucleostemin	96.8
PF14578		81	GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1	96.74
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	96.49
cd03703		110	aeIF5B_II aeIF5B_II: This family represents the do	96.14
KOG1954		532	consensus Endocytosis/signaling protein EHD1 [Sign	96.14
cd02036		179	MinD Bacterial cell division requires the formatio	96.14
PRK05306		787	infB translation initiation factor IF-2; Validated	96.06
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	96.06
PRK09601		364	GTP-binding protein YchF; Reviewed	96.01
CHL00189		742	infB translation initiation factor 2; Provisional	95.99
KOG1707		625	consensus Predicted Ras related/Rac-GTP binding pr	95.95
COG1161		322	Predicted GTPases [General function prediction onl	95.91
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	95.89
PF05049		376	IIGP: Interferon-inducible GTPase (IIGP); InterPro	95.3
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	95.22
TIGR00064		272	ftsY signal recognition particle-docking protein F	95.2
PRK10416		318	signal recognition particle-docking protein FtsY;	95.09
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	95.02
KOG3886		295	consensus GTP-binding protein [Signal transduction	94.87
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	94.59
PF06858		58	NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte	94.43
KOG1424		562	consensus Predicted GTP-binding protein MMR1 [Gene	94.4
KOG2484		435	consensus GTPase [General function prediction only	94.33
cd02038		139	FleN-like FleN is a member of the Fer4_NifH superf	94.25
cd03115		173	SRP The signal recognition particle (SRP) mediates	94.06
PF09186		56	DUF1949: Domain of unknown function (DUF1949); Int	93.89
PF00735		281	Septin: Septin; InterPro: IPR000038 Septins consti	93.86
PRK13760		231	putative RNA-associated protein; Provisional	93.75
COG5192		1077	BMS1 GTP-binding protein required for 40S ribosome	93.68
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	93.64
KOG0410		410	consensus Predicted GTP binding protein [General f	93.46
TIGR01007		204	eps_fam capsular exopolysaccharide family. This mo	93.32
KOG0448		749	consensus Mitofusin 1 GTPase, involved in mitochon	93.22
KOG2485		335	consensus Conserved ATP/GTP binding protein [Gener	93.05
KOG0082		354	consensus G-protein alpha subunit (small G protein	92.96
TIGR00991		313	3a0901s02IAP34 GTP-binding protein (Chloroplast En	92.95
cd02037		169	MRP-like MRP (Multiple Resistance and pH adaptatio	92.72
TIGR01969		251	minD_arch cell division ATPase MinD, archaeal. Thi	92.66
PRK14974		336	cell division protein FtsY; Provisional	92.64
cd01900		274	YchF YchF subfamily. YchF is a member of the Obg f	92.56
PHA02518		211	ParA-like protein; Provisional	92.49
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	92.17
PRK13849		231	putative crown gall tumor protein VirC1; Provision	91.79
COG1149		284	MinD superfamily P-loop ATPase containing an inser	91.34
cd03114		148	ArgK-like The function of this protein family is u	91.12
cd03111		106	CpaE_like This protein family consists of proteins	90.98
TIGR01968		261	minD_bact septum site-determining protein MinD. Th	90.75
TIGR00257		204	IMPACT_YIGZ uncharacterized protein, YigZ family.	90.74
PF04548		212	AIG1: AIG1 family; InterPro: IPR006703 This entry	90.6
COG5019		373	CDC3 Septin family protein [Cell division and chro	90.5
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	90.48
TIGR03371		246	cellulose_yhjQ cellulose synthase operon protein Y	90.44
PF00503		389	G-alpha: G-protein alpha subunit; InterPro: IPR001	90.21
KOG2655		366	consensus Septin family protein (P-loop GTPase) [C	90.15
CHL00175		281	minD septum-site determining protein; Validated	90.11
TIGR00959		428	ffh signal recognition particle protein. This mode	89.35
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	88.98
cd03112		158	CobW_like The function of this protein family is u	88.78
KOG1547		336	consensus Septin CDC10 and related P-loop GTPases	88.48
PRK10867		433	signal recognition particle protein; Provisional	88.35
PRK11568		204	hypothetical protein; Provisional	88.18
TIGR03815		322	CpaE_hom_Actino helicase/secretion neighborhood Cp	88.04
KOG1486		364	consensus GTP-binding protein DRG2 (ODN superfamil	87.73
TIGR00291		231	RNA_SBDS rRNA metabolism protein, SBDS family. Thi	87.15
PRK10818		270	cell division inhibitor MinD; Provisional	86.28
cd02032		267	Bchl_like This family of proteins contains bchL an	86.11
KOG3887		347	consensus Predicted small GTPase involved in nucle	86.02
PRK00771		437	signal recognition particle protein Srp54; Provisi	85.91
TIGR03029		274	EpsG chain length determinant protein tyrosine kin	85.61
PF01656		195	CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai	85.52
PRK13185		270	chlL protochlorophyllide reductase iron-sulfur ATP	85.07
cd02117		212	NifH_like This family contains the NifH (iron prot	84.47
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	84.24
cd02042		104	ParA ParA and ParB of Caulobacter crescentus belon	83.96
PRK13869		405	plasmid-partitioning protein RepA; Provisional	83.9
PRK11670		369	antiporter inner membrane protein; Provisional	82.99
TIGR00993		763	3a0901s04IAP86 chloroplast protein import componen	82.33
PRK04004		586	translation initiation factor IF-2; Validated	82.03
TIGR03453		387	partition_RepA plasmid partitioning protein RepA.	81.93
cd02035		217	ArsA ArsA ATPase functionas as an efflux pump loca	81.89
KOG2423		572	consensus Nucleolar GTPase [General function predi	81.79
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	80.4
PRK10037		250	cell division protein; Provisional	80.16

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

Probab=100.00  E-value=7.5e-177  Score=1340.95  Aligned_cols=528  Identities=57%  Similarity=0.981  Sum_probs=520.7

Q ss_pred             CCCceEEEEEeCCCccchHHHHHHHHhhcCEEEEEEECCCCCchhhHHHHHHHHhcCCcEEeeeecCCCCCCCHHHHHHH
Q 008991           17 NPSSFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYLAFESELTIIPVINKIDQPTADPDRVKAQ   96 (547)
Q Consensus        17 ~~~~~~l~liDTPGh~df~~~~~~~l~~aD~ailVvDa~~g~~~qt~~~~~~~~~~~lpiIvviNKiDl~~~~~~~~~~~   96 (547)
                      +|+.|.+||||||||+||++|++|+|++|+||+|||||++|+++||..+.++|.++++.+|+|+||+||+.++++++.++
T Consensus        72 ~g~~Y~lnlIDTPGHVDFsYEVSRSLAACEGalLvVDAsQGveAQTlAN~YlAle~~LeIiPViNKIDLP~Adpervk~e  151 (603)
T COG0481          72 DGETYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPAADPERVKQE  151 (603)
T ss_pred             CCCEEEEEEcCCCCccceEEEehhhHhhCCCcEEEEECccchHHHHHHHHHHHHHcCcEEEEeeecccCCCCCHHHHHHH
Confidence            77999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCCccceeccccccccccccHHHHHhhCCCCCccccCceeEEEEeeeccccccEEEEEEEecCccccCCEEEEe
Q 008991           97 LKSMFDLDPSEALLTSAKTGQGLEHVLPAVIERIPPPRGIINSSLRMLLLDSYYDEYKGVICHVAVVDGTLRKGDKISSA  176 (547)
Q Consensus        97 i~~~l~~~~~~vi~~SAk~g~Gv~~Ll~~l~~~ip~p~~~~~~p~~~~v~~~~~d~~~G~v~~~rV~~G~lk~gd~v~~~  176 (547)
                      +++.+|+++.+.+.+|||+|.||+++|++|++.+|+|.++.++|++|++||+|||+|+|+++++||++|++++||+|.++
T Consensus       152 Ie~~iGid~~dav~~SAKtG~gI~~iLe~Iv~~iP~P~g~~~~pLkALifDS~yD~Y~GVv~~vRi~dG~ik~gdki~~m  231 (603)
T COG0481         152 IEDIIGIDASDAVLVSAKTGIGIEDVLEAIVEKIPPPKGDPDAPLKALIFDSWYDNYLGVVVLVRIFDGTLKKGDKIRMM  231 (603)
T ss_pred             HHHHhCCCcchheeEecccCCCHHHHHHHHHhhCCCCCCCCCCcceEEEEeccccccceEEEEEEEeeceecCCCEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCeeEEEEEEeecCCcccccccccCcEEEEEecccccccccccCcccCCC-CCCCCCCCCCCCcceEEeeeccCCCCc
Q 008991          177 ATGQAYEIVDVGIMHPELTPTGVLLTGQVGYVVTGMRSTKEARIGDTLYHNK-SIVEPLPGFKPAKHMVFSGLYPADGSD  255 (547)
Q Consensus       177 ~~~~~~~v~~i~~~~~~~~~v~~~~aGdig~i~~glk~~~~~~~Gdtl~~~~-~~~~~l~~~~~~~p~v~~~i~p~~~~d  255 (547)
                      .+|+.+.|.++|++.|++.+++++.||||||+++|+|++.++++|||+|+.+ +..+|+|||++++||||+++||.+.+|
T Consensus       232 ~tg~~y~V~evGvftP~~~~~~~L~aGeVG~~~a~iK~v~d~~VGDTiT~~~~p~~e~LpGfk~~~P~Vf~GlyPid~~d  311 (603)
T COG0481         232 STGKEYEVDEVGIFTPKMVKVDELKAGEVGYIIAGIKDVRDARVGDTITLASNPATEPLPGFKEVKPMVFAGLYPVDSDD  311 (603)
T ss_pred             ecCCEEEEEEEeeccCCccccccccCCceeEEEEeeeecccCcccceEeccCCCccccCCCCCcCCceEEEeecccChhH
Confidence            9999999999999999999999999999999999999999999999999665 667999999999999999999999999


Q ss_pred             hhHHHHHHHhhhcCCceeEEEecCcccccceEEEeecccchHHHHHHHHHHHhCCeeEEecCceeeEEEeeCCCEEEEeC
Q 008991          256 FEVLNHAIERLTCNDASVSVTKETSTALGLGFRCGFLGLLHMDVFHQRLEQEYGAHVISTVPTVPYIFEYSDGSKAEVQN  335 (547)
Q Consensus       256 ~~~L~~aL~kL~~~Dpsl~v~~e~s~~lg~~~~~GflG~LHlev~~erL~~e~g~~v~~t~P~V~Yre~~~~g~~~~~~~  335 (547)
                      |+.|++||+||.+||+||+|++|+|.|||+||||||||+|||||++|||+||||+++++|+|+|.|+...++|++..++|
T Consensus       312 ye~LrdAleKL~LNDasl~~E~EtS~ALGfGfRcGFLGlLHmeiiqERLeREf~ldlI~TaPsV~Y~v~~~~g~~~~i~N  391 (603)
T COG0481         312 YEDLRDALEKLQLNDASLTYEPETSQALGFGFRCGFLGLLHMEIIQERLEREFDLDLITTAPSVVYKVELTDGEEIEVDN  391 (603)
T ss_pred             HHHHHHHHHhcccccceeeeccccchhccCceeehhhhHHHHHHHHHHHHHhhCcceEecCCceEEEEEEcCCcEEEecC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCcccccceeecceEEEEEEcCCCcHHHHHHHHhhcCeeEeeeeEcCCcEEEEEEEechHhHHHHHHHHhcccCc
Q 008991          336 PASLPSNPKKRVTACWEPTVVATIIIPSEYVGSVITLCSERRGQQLEYSFIDSQRAFMKYCLPLREIVVDFYNELKSLTS  415 (547)
Q Consensus       336 p~~fp~~~~~~i~~llEP~~~~~I~vP~e~~G~v~~~l~~rRG~~~~~~~~~~~~~~i~~~iPl~ei~~~f~~~Lks~T~  415 (547)
                      |++||+.  .+|..+.|||++++|++|+||+|+||++|+++||.+.+|+|++.+|++|.|++||+|++.||||+|||.|+
T Consensus       392 Ps~~P~~--~~I~~i~EP~v~~~ii~P~eylG~vm~Lcq~kRG~~~~m~yl~~~rv~l~Y~lPl~Eiv~DFfDkLKS~sk  469 (603)
T COG0481         392 PSDLPDP--NKIEEIEEPYVKATIITPQEYLGNVMELCQEKRGIQIDMEYLDQNRVMLTYELPLAEIVFDFFDKLKSISK  469 (603)
T ss_pred             hHhCCCh--hhhheeeCceeEEEEeCcHHHHHHHHHHHHHhcCceecceEecCceEEEEEecchHHHHHHHhHhhhcccc
Confidence            9999984  57999999999999999999999999999999999999999998999999999999999999999999999


Q ss_pred             CeEEEEeEeccceeccceeeeEeecCcccCcceeeeehHHHHHHHHHHHHHhhccCCCCceeeeeeeeeCCEEEEEeccc
Q 008991          416 GYASFDYEDSEYQQADMVKLDILLNGQPVDAMATIVHNLKAQRVGRELVEKLKKFIDRQMFEITIQAAIGSKVIARETIS  495 (547)
Q Consensus       416 G~as~~~~~~~y~~~~l~k~~i~~ng~~vd~ls~i~~~~~a~~~~~~~~~~lk~~i~r~~~~v~~q~~~~~~~~~~~~i~  495 (547)
                      |||||+|+|.+|+++||||+||++||++|||||+|+||++|+++||.+|+|||++||||||+|||||+||+||||||||+
T Consensus       470 GYAS~DYe~~~y~~~~lVK~dIlvNge~VDALs~ivHrd~A~~rgr~~~~KlKelIPrq~FeipIQAaIg~kiIARetIk  549 (603)
T COG0481         470 GYASFDYEFIGYRESDLVKVDILVNGEKVDALSFIVHRDNAYERGRELVEKLKELIPRQQFEIPIQAAIGSKIIARETIK  549 (603)
T ss_pred             ceeeeccccccccccceEEEEEEecCccccceeeeechhHHHHHHHHHHHHHHhhccHhheeeeeehhhCCeEEEhhhhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccchhhhhccccCchhhhhhhHHHHHhhhhhhccccCeecCHHHHHHhhcc
Q 008991          496 AMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHQLLRV  546 (547)
Q Consensus       496 ~~~k~v~~k~~ggd~~rk~kll~~q~~gk~~~~~~~~~~~~~~~f~~~~~~  546 (547)
                      |+|||||||||||||||||||||||||||||||++|||+||||||+++||.
T Consensus       550 alRKdVlAKCYGGDisRKrKLLeKQKeGKKRMK~iG~VeiPQeAFlavLk~  600 (603)
T COG0481         550 ALRKDVLAKCYGGDISRKRKLLEKQKEGKKRMKQIGNVEIPQEAFLAVLKM  600 (603)
T ss_pred             HhhcchhhhhcCCcchHHHHHHHHhhhhhHHHHhcCCCcCCHHHHHHHHhc
Confidence            999999999999999999999999999999999999999999999999986

>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>PRK12740 elongation factor G; Reviewed	Back alignment and domain information

>PRK07560 elongation factor EF-2; Reviewed	Back alignment and domain information

>TIGR00490 aEF-2 translation elongation factor aEF-2	Back alignment and domain information

>PLN00116 translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>PTZ00416 elongation factor 2; Provisional	Back alignment and domain information

>PF06421 LepA_C: GTP-binding protein LepA C-terminus; InterPro: IPR013842 LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu	Back alignment and domain information

>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>PLN00043 elongation factor 1-alpha; Provisional	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03709 lepA_C lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>cd03710 BipA_TypA_C BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2	Back alignment and domain information

>PRK14845 translation initiation factor IF-2; Provisional	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>COG5258 GTPBP1 GTPase [General function prediction only]	Back alignment and domain information

>smart00838 EFG_C Elongation factor G C-terminus	Back alignment and domain information

>PF00679 EFG_C: Elongation factor G C-terminus; InterPro: IPR000640 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>cd04097 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes	Back alignment and domain information

>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03711 Tet_C Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O)	Back alignment and domain information

>cd04096 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03713 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G	Back alignment and domain information

>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd04098 eEF2_C_snRNP eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>cd01514 Elongation_Factor_C Elongation factor G C-terminus	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>PF14492 EFG_II: Elongation Factor G, domain II; PDB: 1WDT_A 2DY1_A 2XEX_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y 2XUY_Y 3J0E_H	Back alignment and domain information

>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only]	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes	Back alignment and domain information

>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes	Back alignment and domain information

>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes	Back alignment and domain information

>PTZ00099 rab6; Provisional	Back alignment and domain information

>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O)	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3)	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only]	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only]	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only]	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only]	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>KOG0394 consensus Ras-related GTPase [General function prediction only]	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only]	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only]	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3)	Back alignment and domain information

>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>KOG0395 consensus Ras-related GTPase [General function prediction only]	Back alignment and domain information

>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3)	Back alignment and domain information

>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]	Back alignment and domain information

>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu	Back alignment and domain information

>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins	Back alignment and domain information

>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu	Back alignment and domain information

>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only]	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II	Back alignment and domain information

>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase	Back alignment and domain information

>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]	Back alignment and domain information

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only]	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only]	Back alignment and domain information

>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu	Back alignment and domain information

>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>KOG0052 consensus Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01850 CDC_Septin CDC/Septin	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>TIGR02836 spore_IV_A stage IV sporulation protein A	Back alignment and domain information

>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1	Back alignment and domain information

>TIGR00101 ureG urease accessory protein UreG	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK01889 GTPase RsgA; Reviewed	Back alignment and domain information

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1673 consensus Ras GTPases [General function prediction only]	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>KOG2486 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only]	Back alignment and domain information

>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea	Back alignment and domain information

>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2	Back alignment and domain information

>cd03110 Fer4_NifH_child This protein family's function is unkown	Back alignment and domain information

>cd00066 G-alpha G protein alpha subunit	Back alignment and domain information

>smart00275 G_alpha G protein alpha subunit	Back alignment and domain information

>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms]	Back alignment and domain information

>PTZ00258 GTP-binding protein; Provisional	Back alignment and domain information

>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another	Back alignment and domain information

>cd04178 Nucleostemin_like Nucleostemin-like	Back alignment and domain information

>PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B	Back alignment and domain information

>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>PRK09601 GTP-binding protein YchF; Reviewed	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms]	Back alignment and domain information

>COG1161 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1)	Back alignment and domain information

>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only]	Back alignment and domain information

>KOG2484 consensus GTPase [General function prediction only]	Back alignment and domain information

>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PF09186 DUF1949: Domain of unknown function (DUF1949); InterPro: IPR015269 Members of this entry are a set of functionally uncharacterised hypothetical bacterial proteins	Back alignment and domain information

>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []	Back alignment and domain information

>PRK13760 putative RNA-associated protein; Provisional	Back alignment and domain information

>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0410 consensus Predicted GTP binding protein [General function prediction only]	Back alignment and domain information

>TIGR01007 eps_fam capsular exopolysaccharide family	Back alignment and domain information

>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only]	Back alignment and domain information

>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]	Back alignment and domain information

>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase)	Back alignment and domain information

>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily	Back alignment and domain information

>TIGR01969 minD_arch cell division ATPase MinD, archaeal	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>cd01900 YchF YchF subfamily	Back alignment and domain information

>PHA02518 ParA-like protein; Provisional	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK13849 putative crown gall tumor protein VirC1; Provisional	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster	Back alignment and domain information

>TIGR01968 minD_bact septum site-determining protein MinD	Back alignment and domain information

>TIGR00257 IMPACT_YIGZ uncharacterized protein, YigZ family	Back alignment and domain information

>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria	Back alignment and domain information

>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ	Back alignment and domain information

>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) []	Back alignment and domain information

>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>CHL00175 minD septum-site determining protein; Validated	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>cd03112 CobW_like The function of this protein family is unkown	Back alignment and domain information

>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK11568 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein	Back alignment and domain information

>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>TIGR00291 RNA_SBDS rRNA metabolism protein, SBDS family	Back alignment and domain information

>PRK10818 cell division inhibitor MinD; Provisional	Back alignment and domain information

>cd02032 Bchl_like This family of proteins contains bchL and chlL	Back alignment and domain information

>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG	Back alignment and domain information

>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases	Back alignment and domain information

>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional	Back alignment and domain information

>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation	Back alignment and domain information

>PRK13869 plasmid-partitioning protein RepA; Provisional	Back alignment and domain information

>PRK11670 antiporter inner membrane protein; Provisional	Back alignment and domain information

>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>TIGR03453 partition_RepA plasmid partitioning protein RepA	Back alignment and domain information

>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell	Back alignment and domain information

>KOG2423 consensus Nucleolar GTPase [General function prediction only]	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>PRK10037 cell division protein; Provisional	Back alignment and domain information

Homologous Structure Templates