Citrus Sinensis ID: 009076

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540----
MADYEVNGEDVDNNNNNNNNNYEYGSSPQPRSADDHSDSKPQHGSRDYERESSRSREKEKEKGRDRDRDRDRDRTREKDRDREKSRDMDREKSRDREKDREKDRHHRDRHRERSRERSERRKDRDDDDHYRSRDYDRRKDYDRDREDRHKRRSQSRSRGRSEHRSRSRSRSRSKSKRISGFDMAPPASAMLAAGAGAAAAGQIPGANPAIPGMFPNMFPLVTGQFGALPVMPVQAMTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQESVLLHAQQQIALQRLMLQPGSVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQFVYFYIHL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccHHcHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHccccccccccEEEEEEcccccEEEEEEEcHHHHHHHHHcccEEEcccccEEccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHccccEEEEEcccccccccccEEEEEEccHHHHHHHHHHHcccccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccEEEccccccccEEEEEEEc
cccccEccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHcccccccccEEEEEEccccccEEEEEEEcHHHHHHHHHccccEEcccEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEEEccccccEEEEEEEEEccHHHHHHHHHHHcccEEccEEcEEEEccccccccccHHccccccHcccccHHHHcccccccccEEEEEEccccHHHHcccHHHHHHHHHHHHHHHHcccEEEEEEccccccEEEEccccccEEEEEEEEc
madyevngedvdnnnnnnnnnyeygsspqprsaddhsdskpqhgsrdyeressrsrEKEKekgrdrdrdrdrdrtrekdrdreksrdmdreksrdrekdrekdrhhrdrhrersrerserrkdrddddhyrsrdydrrkdydrdredrhkrrsqsrsrgrsehrsrsrsrsrskskrisgfdmappaSAMLAAGAGaaaagqipganpaipgmfpnmfplvtgqfgalpvmpvqAMTQQATRHARRVyvgglpptaneqSVATFFSQVMAAiggntagpgdAVVNVYINHEKKFAFVEMRSVEEASNAmaldgiifegapvkvrrpsdynpslaatlgpsqpnpnlnlaavgltpgsagglegpdrifvgglpyyfTEAQIRELLEsfgplrgfdlvkdretgnskgyAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRanqganqpkpeqESVLLHAQQQIALQRLmlqpgsvpskvvCLTQVvsadelkddeEYEEILEDMRqeggkfafcsptfcykesgliytdrrlhnpqfVYFYIHL
MADYEVNGEDVDNNNNNNNNNYEYGSSPQPRSADDHSdskpqhgsrdyeressrsrekekekgrdrdrdrdrdrtrekdrdreksrdmdreksrdrekdrekdrhhrdrhrersrerserrkdrddddhyrsrdydrrkdydrdredrhkrrsqsrsrgrsehrsrsrsrsrskskrisgfdmAPPASAMLAAGAGAAAAGQIPGANPAIPGMFPNMFPLVTGQFGALPVMPVQAMTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQESVLLHAQQQIALQRLMLQPGSVPSKVVCLTQVvsadelkddeEYEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQFVYFYIHL
MAdyevngedvdnnnnnnnnnyeygSSPQPRSADDHSDSKPQHGsrdyeressrsrekekekgrdrdrdrdrdrtrekdrdreksrdmdreksrdrekdrekdrhhrdrhrersrerserrkdrddddhyrsrdydrrkdydrdredrhkrrsqsrsrgrsehrsrsrsrsrskskrisGFDMappasamlaagagaaaagqipganpaipgMFPNMFPLVTGQFGALPVMPVQAMTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQESVLLHAQQQIALQRLMLQPGSVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQFVYFYIHL
*************************************************************************************************************************************************************************************************************ANPAIPGMFPNMFPLVTGQFGALPVMPVQAMTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVE***************************************************AVGLT***AGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLT*******************LHAQQQIALQRLMLQPGSVPSKVVCLTQVVSADEL*****YEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQFVYFYIH*
***************************************************************************************************************************************************************************RSKSKR*******************************************************************RRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRR*************************************GPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRAN************************************VVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQFVYFYIHL
********EDVDNNNNNNNNNYEY**********************************************************************************************************RSRDYDRRK***************************************SGFDMAPPASAMLAAGAGAAAAGQIPGANPAIPGMFPNMFPLVTGQFGALPVMPVQAMTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRAN*************LLHAQQQIALQRLMLQPGSVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQFVYFYIHL
***********************************************************************************************************************************************************************************GFDMAPPASAMLAAGAGAAAAGQIPGANPAIPGMFPNMFPLVTGQFGALPVMPVQAMTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSD***********************GLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRANQGANQPKP**ESVLLHAQQQIALQRLMLQPGSVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQFVYFYIHL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADYEVNGEDVDNNNNNNNNNYEYGSSPQPRSADDHSDSKPQHGSRDYERESSRSREKEKEKGRDRDRDRDRDRTREKDRDREKSRDMDREKSRDREKDREKDRHHRDRHRERSRERSERRKDRDDDDHYRSRDYDRRKDYDRDREDRHKRRSQSRSRGRSEHRSRSRSRSRSKSKRISGFDMAPPASAMLAAGAGAAAAGQIPGANPAIPGMFPNMFPLVTGQFGALPVMPVQAMTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQESVLLHAQQQIALQRLMLQPGSVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQFVYFYIHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query544 2.2.26 [Sep-21-2011]
O23212573 Splicing factor U2af larg no no 0.913 0.867 0.699 0.0
Q9ZR40573 Splicing factor U2af larg N/A no 0.919 0.872 0.716 0.0
Q9ZR39555 Splicing factor U2af larg N/A no 0.650 0.637 0.856 1e-171
Q8L716589 Splicing factor U2af larg no no 0.643 0.594 0.851 1e-166
Q2QKB4543 Splicing factor U2af larg N/A no 0.818 0.819 0.708 1e-158
Q2QZL4548 Splicing factor U2af larg yes no 0.608 0.604 0.829 1e-156
Q2R0Q1574 Splicing factor U2af larg yes no 0.569 0.540 0.824 1e-152
Q2QKB3591 Splicing factor U2af larg N/A no 0.856 0.788 0.586 1e-146
P26368475 Splicing factor U2AF 65 k yes no 0.623 0.713 0.420 3e-58
P26369475 Splicing factor U2AF 65 k yes no 0.623 0.713 0.420 4e-58
>sp|O23212|U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana GN=U2AF65A PE=2 SV=2 Back     alignment and function desciption
 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/509 (69%), Positives = 407/509 (79%), Gaps = 12/509 (2%)

Query: 9   EDVDNNNNNNNNNYEYGSSPQPRSADDHSDSKPQHGSRDYERESSRSREKEKEKGRDRDR 68
           ED + N    +  Y+  +  +    +D  DSKP+  SRD+ERE+SRS+++E+EKGRD+DR
Sbjct: 5   EDHEGNGTVADAIYDEENGGRDGEIEDQLDSKPKRESRDHERETSRSKDREREKGRDKDR 64

Query: 69  DRDRDRTR-EKDRDREKSRDMDREKSRDREKDREKDRHHRD-RHRERSRERSERRKDRDD 126
           +RD + +R  +DRD EKS+    E+SRD+++D  ++RHHR  RHR+ SRER ERR+    
Sbjct: 65  ERDSEVSRRSRDRDGEKSK----ERSRDKDRDH-RERHHRSSRHRDHSRERGERRERGGR 119

Query: 127 DDHYRSRDYDRRKDYDRDREDRHKRRSQSRSRGRSEHRSRSRSRSRSKSKRISGFDMAPP 186
           DD    R  DR  D  RD     + R           R           +R+SGFDMAPP
Sbjct: 120 DDDDYRRSRDRDHDRRRDDRGGRRSRRSRSRSKDRSERRTRSRSPSKSKQRVSGFDMAPP 179

Query: 187 ASAMLAAGAGAAAAGQIPGANPAIPG--MFPNMFPLVTGQ-FGALPVMPVQAMTQQATRH 243
           ASAMLAAGA  A  GQ+P A P +PG  MFPNMFPL TGQ FG L +MP+QAMTQQATRH
Sbjct: 180 ASAMLAAGA--AVTGQVPPAPPTLPGAGMFPNMFPLPTGQSFGGLSMMPIQAMTQQATRH 237

Query: 244 ARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVE 303
           ARRVYVGGL PTANEQSVATFFSQVMAA+GGNTAGPGDAVVNVYINHEKKFAFVEMRSVE
Sbjct: 238 ARRVYVGGLSPTANEQSVATFFSQVMAAVGGNTAGPGDAVVNVYINHEKKFAFVEMRSVE 297

Query: 304 EASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEG 363
           EASNAM+LDGIIFEGAPVKVRRPSDYNPSLAATLGPSQP+P+LNLAAVGLTPG++GGLEG
Sbjct: 298 EASNAMSLDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPSPHLNLAAVGLTPGASGGLEG 357

Query: 364 PDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIAC 423
           PDRIFVGGLPYYFTE+Q+RELLESFG L+GFDLVKDRETGNSKGYAFCVYQDLSVTDIAC
Sbjct: 358 PDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIAC 417

Query: 424 AALNGIKMGDKTLTVRRANQGANQPKPEQESVLLHAQQQIALQRLMLQPGSVPSKVVCLT 483
           AALNGIKMGDKTLTVRRANQG    KPEQE+VLLHAQQQIA QR+MLQPG+V + VVCLT
Sbjct: 418 AALNGIKMGDKTLTVRRANQGTMLQKPEQENVLLHAQQQIAFQRVMLQPGAVATTVVCLT 477

Query: 484 QVVSADELKDDEEYEEILEDMRQEGGKFA 512
           QVV+ DEL+DDEEY +I+EDMRQEGGKF 
Sbjct: 478 QVVTEDELRDDEEYGDIMEDMRQEGGKFG 506
Necessary for the splicing of pre-mRNA.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZR40|U2A2B_NICPL Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1 Back     alignment and function description
>sp|Q9ZR39|U2A2A_NICPL Splicing factor U2af large subunit A OS=Nicotiana plumbaginifolia GN=U2AF65A PE=2 SV=1 Back     alignment and function description
>sp|Q8L716|U2A2B_ARATH Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2 Back     alignment and function description
>sp|Q2QKB4|U2A2B_WHEAT Splicing factor U2af large subunit B OS=Triticum aestivum GN=U2AF65B PE=2 SV=1 Back     alignment and function description
>sp|Q2QZL4|U2A2B_ORYSJ Splicing factor U2af large subunit B OS=Oryza sativa subsp. japonica GN=U2AF65B PE=2 SV=2 Back     alignment and function description
>sp|Q2R0Q1|U2A2A_ORYSJ Splicing factor U2af large subunit A OS=Oryza sativa subsp. japonica GN=U2AF65A PE=2 SV=2 Back     alignment and function description
>sp|Q2QKB3|U2A2A_WHEAT Splicing factor U2af large subunit A OS=Triticum aestivum GN=U2AF65A PE=2 SV=1 Back     alignment and function description
>sp|P26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens GN=U2AF2 PE=1 SV=4 Back     alignment and function description
>sp|P26369|U2AF2_MOUSE Splicing factor U2AF 65 kDa subunit OS=Mus musculus GN=U2af2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query544
255568277549 splicing factor u2af large subunit, puta 0.658 0.652 0.919 0.0
449496757587 PREDICTED: splicing factor U2af large su 0.917 0.850 0.761 0.0
42573197565 Splicing factor U2af large subunit A [Ar 0.955 0.920 0.687 0.0
449441167587 PREDICTED: splicing factor U2af large su 0.913 0.846 0.760 0.0
188998293554 U2 snRNP auxiliary factor large subunit 0.882 0.866 0.732 0.0
156070760553 unknown [Solanum melongena] 0.882 0.867 0.732 0.0
222423510565 AT4G36690 [Arabidopsis thaliana] 0.957 0.922 0.682 0.0
297798226567 hypothetical protein ARALYDRAFT_490965 [ 0.858 0.823 0.743 0.0
30690730542 Splicing factor U2af large subunit A [Ar 0.966 0.970 0.666 0.0
334187224551 Splicing factor U2af large subunit A [Ar 0.876 0.865 0.682 1e-180
>gi|255568277|ref|XP_002525113.1| splicing factor u2af large subunit, putative [Ricinus communis] gi|223535572|gb|EEF37240.1| splicing factor u2af large subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/362 (91%), Positives = 340/362 (93%), Gaps = 4/362 (1%)

Query: 180 GFDMAPPASAMLAAGAGAAAA-GQIPGANPAIPGMFPNMFPLVTGQ-FGALPVMPVQAMT 237
           GFDMAPP SAML   A  AAA GQIPG  PAIPGMFPNMFPL TGQ FG LPVMPVQAMT
Sbjct: 189 GFDMAPPPSAMLTGAAAVAAAAGQIPGTAPAIPGMFPNMFPLGTGQQFGTLPVMPVQAMT 248

Query: 238 QQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFV 297
           QQATRHARRVYVGGLPPTANEQSVATFFS VMAAIGGNTAGPGDAVVNVYINHEKKFAFV
Sbjct: 249 QQATRHARRVYVGGLPPTANEQSVATFFSHVMAAIGGNTAGPGDAVVNVYINHEKKFAFV 308

Query: 298 EMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGS 357
           EMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNL AVGLTPGS
Sbjct: 309 EMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLGAVGLTPGS 368

Query: 358 AGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLS 417
           AGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLS
Sbjct: 369 AGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLS 428

Query: 418 VTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQESVLLHAQQQIALQRLMLQPGSVPS 477
           VTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQE+VLLHAQQQIALQRLMLQP  VP+
Sbjct: 429 VTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQETVLLHAQQQIALQRLMLQP--VPT 486

Query: 478 KVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQF 537
           KVVCLTQVV+ADELKDD+EYE+ILEDMR EGGKFAFCS TFCYKESGL YTDRR H P F
Sbjct: 487 KVVCLTQVVTADELKDDDEYEDILEDMRTEGGKFAFCSATFCYKESGLTYTDRRHHYPLF 546

Query: 538 VY 539
           ++
Sbjct: 547 IF 548

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449496757|ref|XP_004160219.1| PREDICTED: splicing factor U2af large subunit B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|42573197|ref|NP_974695.1| Splicing factor U2af large subunit A [Arabidopsis thaliana] gi|332661288|gb|AEE86688.1| Splicing factor U2af large subunit A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449441167|ref|XP_004138355.1| PREDICTED: splicing factor U2af large subunit B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|188998293|gb|ACD67872.1| U2 snRNP auxiliary factor large subunit [Solanum melongena] Back     alignment and taxonomy information
>gi|156070760|gb|ABU45175.1| unknown [Solanum melongena] Back     alignment and taxonomy information
>gi|222423510|dbj|BAH19725.1| AT4G36690 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297798226|ref|XP_002866997.1| hypothetical protein ARALYDRAFT_490965 [Arabidopsis lyrata subsp. lyrata] gi|297312833|gb|EFH43256.1| hypothetical protein ARALYDRAFT_490965 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30690730|ref|NP_849509.1| Splicing factor U2af large subunit A [Arabidopsis thaliana] gi|19310597|gb|AAL85029.1| putative splicing factor [Arabidopsis thaliana] gi|332661289|gb|AEE86689.1| Splicing factor U2af large subunit A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334187224|ref|NP_001190937.1| Splicing factor U2af large subunit A [Arabidopsis thaliana] gi|332661290|gb|AEE86690.1| Splicing factor U2af large subunit A [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query544
TAIR|locus:2206001589 AT1G60900 [Arabidopsis thalian 0.549 0.507 0.893 9.9e-142
TAIR|locus:2115280573 ATU2AF65A [Arabidopsis thalian 0.549 0.521 0.886 3.4e-141
UNIPROTKB|Q24JZ8475 U2AF2 "Uncharacterized protein 0.523 0.6 0.451 1.2e-58
ZFIN|ZDB-GENE-050706-131470 u2af2a "U2 small nuclear RNA a 0.529 0.612 0.439 2.5e-58
UNIPROTKB|P26368475 U2AF2 "Splicing factor U2AF 65 0.523 0.6 0.448 3.2e-58
UNIPROTKB|E2R0G3471 U2AF2 "Uncharacterized protein 0.523 0.605 0.447 4e-58
MGI|MGI:98886475 U2af2 "U2 small nuclear ribonu 0.523 0.6 0.448 4e-58
RGD|1597319475 LOC690372 "similar to U2 (RNU2 0.523 0.6 0.448 4e-58
ZFIN|ZDB-GENE-040426-1881475 u2af2b "U2 small nuclear RNA a 0.523 0.6 0.435 5.9e-57
FB|FBgn0005411416 U2af50 "U2 small nuclear ribop 0.505 0.661 0.427 5.6e-52
TAIR|locus:2206001 AT1G60900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1386 (493.0 bits), Expect = 9.9e-142, P = 9.9e-142
 Identities = 268/300 (89%), Positives = 282/300 (94%)

Query:   213 MFPNMFPLVTGQ-FGALPVMPVQAMTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAA 271
             MF NMFP+V GQ  GALPV+PVQAMTQQATRHARRVYVGGLPPTANEQSV+TFFSQVM+A
Sbjct:   222 MFSNMFPMVPGQQLGALPVLPVQAMTQQATRHARRVYVGGLPPTANEQSVSTFFSQVMSA 281

Query:   272 IGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNP 331
             IGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGII EG PVKVRRP+DYNP
Sbjct:   282 IGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIILEGVPVKVRRPTDYNP 341

Query:   332 SLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPL 391
             SLAATLGPSQPNPNLNL AVGL+ GS GGLEGPDRIFVGGLPYYFTE QIRELLESFGPL
Sbjct:   342 SLAATLGPSQPNPNLNLGAVGLSSGSTGGLEGPDRIFVGGLPYYFTEVQIRELLESFGPL 401

Query:   392 RGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRANQGANQPKPE 451
             RGF+LVKDRETGNSKGYAFCVYQD SVTDIACAALNGIKMGDKTLTVRRA QGA QPKPE
Sbjct:   402 RGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAALNGIKMGDKTLTVRRAIQGAIQPKPE 461

Query:   452 QESVLLHAQQQIALQRLMLQPGSVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKF 511
             QE VLL+AQQQIALQRLM QPG  P+K+VCLTQVV+AD+L+DDEEY EI+EDMRQEGGKF
Sbjct:   462 QEEVLLYAQQQIALQRLMFQPGGTPTKIVCLTQVVTADDLRDDEEYAEIMEDMRQEGGKF 521
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0006397 "mRNA processing" evidence=IEA
TAIR|locus:2115280 ATU2AF65A [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q24JZ8 U2AF2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050706-131 u2af2a "U2 small nuclear RNA auxiliary factor 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P26368 U2AF2 "Splicing factor U2AF 65 kDa subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0G3 U2AF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:98886 U2af2 "U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1597319 LOC690372 "similar to U2 (RNU2) small nuclear RNA auxiliary factor 2 isoform b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1881 u2af2b "U2 small nuclear RNA auxiliary factor 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0005411 U2af50 "U2 small nuclear riboprotein auxiliary factor 50" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZR39U2A2A_NICPLNo assigned EC number0.85670.65070.6378N/Ano
Q2QZL4U2A2B_ORYSJNo assigned EC number0.82930.60840.6040yesno
Q2QKB4U2A2B_WHEATNo assigned EC number0.70870.81800.8195N/Ano
Q2R0Q1U2A2A_ORYSJNo assigned EC number0.82420.56980.5400yesno
Q9ZR40U2A2B_NICPLNo assigned EC number0.71620.91910.8726N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.7__398__AT4G36690.1
annotation not avaliable (567 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query544
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-173
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 3e-44
cd1223082 cd12230, RRM1_U2AF65, RNA recognition motif 1 foun 3e-40
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-21
smart0036073 smart00360, RRM, RNA recognition motif 6e-19
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-16
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-16
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 2e-15
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-15
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-14
PRK12678672 PRK12678, PRK12678, transcription termination fact 2e-13
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 4e-13
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 4e-13
PRK12678672 PRK12678, PRK12678, transcription termination fact 2e-12
PRK12678672 PRK12678, PRK12678, transcription termination fact 2e-12
PRK12678672 PRK12678, PRK12678, transcription termination fact 2e-12
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 5e-12
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 6e-12
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 9e-12
PRK12678672 PRK12678, PRK12678, transcription termination fact 1e-11
PRK12678672 PRK12678, PRK12678, transcription termination fact 2e-11
PRK12678672 PRK12678, PRK12678, transcription termination fact 3e-11
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 4e-11
smart0036073 smart00360, RRM, RNA recognition motif 7e-11
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 8e-11
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 9e-11
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-10
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 1e-10
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 2e-10
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 3e-10
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 5e-10
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 7e-10
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 8e-10
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 9e-10
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-09
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-09
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 2e-09
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-09
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 2e-09
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 2e-09
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-09
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 3e-09
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 3e-09
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 3e-09
PRK12678672 PRK12678, PRK12678, transcription termination fact 4e-09
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 5e-09
PRK12678672 PRK12678, PRK12678, transcription termination fact 1e-08
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 1e-08
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 1e-08
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 1e-08
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 1e-08
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-08
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-08
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 2e-08
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 3e-08
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 4e-08
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 4e-08
PRK12678672 PRK12678, PRK12678, transcription termination fact 5e-08
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 6e-08
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 6e-08
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 6e-08
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 9e-08
PRK12678672 PRK12678, PRK12678, transcription termination fact 1e-07
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-07
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-07
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 4e-07
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 4e-07
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 4e-07
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 4e-07
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 4e-07
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 5e-07
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 5e-07
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 5e-07
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 5e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 5e-07
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 8e-07
PRK12678672 PRK12678, PRK12678, transcription termination fact 9e-07
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 9e-07
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 9e-07
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 1e-06
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-06
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 2e-06
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 2e-06
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 2e-06
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 3e-06
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 3e-06
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-06
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 4e-06
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 4e-06
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 4e-06
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 4e-06
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 4e-06
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 5e-06
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 5e-06
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 5e-06
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 6e-06
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 8e-06
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 9e-06
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 1e-05
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-05
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 1e-05
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 1e-05
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 1e-05
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 1e-05
PRK12678672 PRK12678, PRK12678, transcription termination fact 2e-05
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 2e-05
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 2e-05
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 2e-05
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 2e-05
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 2e-05
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 3e-05
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 3e-05
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 3e-05
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 3e-05
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 3e-05
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 4e-05
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 5e-05
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 5e-05
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 5e-05
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 5e-05
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 5e-05
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 6e-05
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 7e-05
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 7e-05
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 7e-05
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 7e-05
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 8e-05
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 8e-05
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 8e-05
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 8e-05
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 8e-05
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 9e-05
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-04
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 1e-04
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 1e-04
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 1e-04
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 1e-04
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 1e-04
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-04
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-04
cd1229172 cd12291, RRM1_La, RNA recognition motif 1 in La au 2e-04
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 2e-04
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 2e-04
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 2e-04
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 2e-04
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 2e-04
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 3e-04
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 3e-04
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 3e-04
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 3e-04
cd1229971 cd12299, RRM4_Prp24, RNA recognition motif 4 in fu 3e-04
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 3e-04
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 3e-04
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 3e-04
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 4e-04
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 4e-04
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 4e-04
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 4e-04
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 5e-04
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 5e-04
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 5e-04
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 6e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 7e-04
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 7e-04
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 8e-04
cd1246588 cd12465, RRM_UHMK1, RNA recognition motif found in 8e-04
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 9e-04
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 0.001
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 0.001
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 0.001
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 0.001
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 0.001
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 0.001
PTZ00112 1164 PTZ00112, PTZ00112, origin recognition complex 1 p 0.001
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 0.001
cd1240375 cd12403, RRM1_NCL, RNA recognition motif 1 in vert 0.001
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 0.001
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 0.001
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 0.001
cd1266177 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in v 0.001
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 0.002
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 0.002
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 0.002
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 0.002
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 0.002
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 0.002
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 0.002
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 0.002
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 0.002
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 0.002
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 0.002
COG1681209 COG1681, FlaB, Archaeal flagellins [Cell motility 0.002
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 0.002
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 0.002
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 0.003
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 0.003
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 0.003
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 0.003
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 0.003
cd1242079 cd12420, RRM_RBPMS_like, RNA recognition motif in 0.003
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 0.003
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 0.003
PRK12678672 PRK12678, PRK12678, transcription termination fact 0.004
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 0.004
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 0.004
pfam1389356 pfam13893, RRM_5, RNA recognition motif 0.004
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 0.004
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 0.004
PHA02896616 PHA02896, PHA02896, A-type inclusion like protein; 0.004
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 0.004
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information 
 Score =  498 bits (1284), Expect = e-173
 Identities = 192/458 (41%), Positives = 252/458 (55%), Gaps = 19/458 (4%)

Query: 58  KEKEKGRDRDRDRDRDRTREKDRDREKSRDMDREKSRDREKDREKDRHHRDRHRERSRER 117
           +++E  R+R++ R RDR R  +R R +SRD  R + R R   RE+      R R+R R  
Sbjct: 1   RDEEPDREREKSRGRDRDRSSERPRRRSRDRSRFRDRHRR-SRERSYREDSRPRDRRRYD 59

Query: 118 SERRKDRDDDDHYRSRDYDRRKDYDRDREDRHKRRSQSRSRGRSEHRSRSRSRSRSKSKR 177
           S   +        RSRD  RR+       ++H+RR + RS      +           K+
Sbjct: 60  SRSPRSLRYSSVRRSRDRPRRRSRSVRSIEQHRRRLRDRSPSNQWRKD---------DKK 110

Query: 178 ISGFDMAPPASAMLAAGAGAAAAGQ---IPGANPAIPGMFPNMFPLVTGQFGALPVMPVQ 234
            S +D+ PP        A  A A Q   +PG  P  P M      L  G    +  +PV 
Sbjct: 111 RSLWDIKPPG--YELVTADQAKASQVFSVPGTAP-RPAMTDPEKLLAEGS--IITPLPVL 165

Query: 235 AMTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKF 294
              QQATR ARR+YVGG+PP   E++V  FF+ +M A G + A  G  V +V IN EK F
Sbjct: 166 PYQQQATRQARRLYVGGIPPEFVEEAVVDFFNDLMIATGYHKAEDGKHVSSVNINKEKNF 225

Query: 295 AFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLT 354
           AF+E R+VEEA+ AMALD II+    +K+RRP DY P    T   SQ NP+ N   V   
Sbjct: 226 AFLEFRTVEEATFAMALDSIIYSNVFLKIRRPHDYIPVPQITPEVSQKNPDDNAKNVEKL 285

Query: 355 PGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQ 414
             S   L+  DRI++G LP Y  E QI+ELLESFG L+ F+L+KD  TG SKGYAFC Y+
Sbjct: 286 VNSTTVLDSKDRIYIGNLPLYLGEDQIKELLESFGDLKAFNLIKDIATGLSKGYAFCEYK 345

Query: 415 DLSVTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQ-ESVLLHAQQQIALQRLMLQPG 473
           D SVTD+A AALNG   GD  L V+RA  GANQ   +    +        AL + +LQ G
Sbjct: 346 DPSVTDVAIAALNGKDTGDNKLHVQRACVGANQATIDTSNGMAPVTLLAKALSQSILQIG 405

Query: 474 SVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKF 511
             P+KVV LT +V+ D+L DDEEYEEI ED++ E  K+
Sbjct: 406 GKPTKVVQLTNLVTGDDLMDDEEYEEIYEDVKTEFSKY 443

These splicing factors consist of an N-terminal arginine-rich low complexity domain followed by three tandem RNA recognition motifs (pfam00076). The well-characterized members of this family are auxilliary components of the U2 small nuclear ribonuclearprotein splicing factor (U2AF). These proteins are closely related to the CC1-like subfamily of splicing factors (TIGR01622). Members of this subfamily are found in plants, metazoa and fungi. Length = 509
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240676 cd12230, RRM1_U2AF65, RNA recognition motif 1 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240911 cd12465, RRM_UHMK1, RNA recognition motif found in U2AF homology motif kinase 1 (UHMK1) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240274 PTZ00112, PTZ00112, origin recognition complex 1 protein; Provisional Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240849 cd12403, RRM1_NCL, RNA recognition motif 1 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241105 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|224595 COG1681, FlaB, Archaeal flagellins [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240866 cd12420, RRM_RBPMS_like, RNA recognition motif in RNA-binding protein with multiple splicing (RBP-MS)-like proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|165222 PHA02896, PHA02896, A-type inclusion like protein; Provisional Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 544
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 100.0
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 100.0
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.98
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.97
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.97
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.97
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.97
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.97
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.97
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.97
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.96
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.96
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.96
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.96
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.95
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.95
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.94
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.94
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.93
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.93
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 99.92
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.92
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.91
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.89
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.89
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.88
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.88
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.87
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.83
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.83
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.83
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.83
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.8
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.79
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.78
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.77
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.76
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.71
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.7
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.69
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.66
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.63
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.63
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.63
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.63
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.59
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.59
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.56
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.55
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.55
KOG0122270 consensus Translation initiation factor 3, subunit 99.52
KOG4207256 consensus Predicted splicing factor, SR protein su 99.51
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.5
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.48
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.47
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.47
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.47
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 99.46
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.46
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.45
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.43
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 99.43
PLN03120260 nucleic acid binding protein; Provisional 99.42
PLN03213 759 repressor of silencing 3; Provisional 99.39
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.39
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 99.36
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.34
smart0036272 RRM_2 RNA recognition motif. 99.34
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.34
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.34
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.33
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.32
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.32
PLN03121243 nucleic acid binding protein; Provisional 99.32
smart0036071 RRM RNA recognition motif. 99.31
PLN03120260 nucleic acid binding protein; Provisional 99.31
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.31
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 99.3
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.29
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.29
KOG0122270 consensus Translation initiation factor 3, subunit 99.26
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.26
smart0036170 RRM_1 RNA recognition motif. 99.26
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.25
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 99.25
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.25
PLN03121243 nucleic acid binding protein; Provisional 99.25
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.23
KOG0129520 consensus Predicted RNA-binding protein (RRM super 99.2
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.2
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 99.18
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.18
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.17
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.16
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.16
KOG4207256 consensus Predicted splicing factor, SR protein su 99.13
PLN03213 759 repressor of silencing 3; Provisional 99.12
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.11
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.1
smart0036272 RRM_2 RNA recognition motif. 99.08
KOG0226290 consensus RNA-binding proteins [General function p 99.07
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.07
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 99.06
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 99.05
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.05
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 99.04
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 99.02
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.0
smart0036071 RRM RNA recognition motif. 98.99
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.96
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.94
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.91
KOG4210285 consensus Nuclear localization sequence binding pr 98.91
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 98.91
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.84
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.83
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.79
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.78
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.78
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 98.74
smart0036170 RRM_1 RNA recognition motif. 98.73
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.69
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.66
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.64
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.61
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.59
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.57
KOG0151 877 consensus Predicted splicing regulator, contains R 98.53
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.48
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.48
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.42
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 98.42
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.42
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.42
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.29
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.26
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.26
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 98.24
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 98.24
KOG0151 877 consensus Predicted splicing regulator, contains R 98.16
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.16
KOG1996378 consensus mRNA splicing factor [RNA processing and 98.03
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.0
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.95
KOG0226290 consensus RNA-binding proteins [General function p 97.92
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.91
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.9
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.81
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 97.58
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.58
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.56
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.53
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 97.51
KOG0129520 consensus Predicted RNA-binding protein (RRM super 97.47
KOG2314 698 consensus Translation initiation factor 3, subunit 97.44
KOG4210285 consensus Nuclear localization sequence binding pr 97.43
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.39
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 97.36
KOG1996378 consensus mRNA splicing factor [RNA processing and 97.3
KOG1855484 consensus Predicted RNA-binding protein [General f 97.19
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.14
KOG3152278 consensus TBP-binding protein, activator of basal 97.14
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 97.05
KOG1855484 consensus Predicted RNA-binding protein [General f 96.93
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.89
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.68
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.54
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.41
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.05
KOG3152278 consensus TBP-binding protein, activator of basal 95.97
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 95.9
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 95.86
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.83
KOG2591 684 consensus c-Mpl binding protein, contains La domai 95.83
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 95.72
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 95.71
KOG2548653 consensus SWAP mRNA splicing regulator [RNA proces 95.62
KOG2068327 consensus MOT2 transcription factor [Transcription 95.39
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 95.31
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 94.98
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 94.92
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 94.63
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 94.62
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 94.34
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 94.1
PF15023166 DUF4523: Protein of unknown function (DUF4523) 94.04
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 93.54
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 93.52
KOG2314 698 consensus Translation initiation factor 3, subunit 92.95
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 92.46
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 92.27
KOG4246 1194 consensus Predicted DNA-binding protein, contains 91.74
KOG2135526 consensus Proteins containing the RNA recognition 91.47
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 91.43
KOG2135526 consensus Proteins containing the RNA recognition 91.38
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 91.01
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 90.68
KOG2548653 consensus SWAP mRNA splicing regulator [RNA proces 90.45
PF15023166 DUF4523: Protein of unknown function (DUF4523) 90.24
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 90.19
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 89.47
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 87.44
PF10567 309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 87.2
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 86.88
KOG2891445 consensus Surface glycoprotein [General function p 86.57
KOG2318 650 consensus Uncharacterized conserved protein [Funct 86.19
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 85.62
PF06495182 Transformer: Fruit fly transformer protein; InterP 84.61
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 83.73
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 83.08
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 81.96
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 81.36
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information 
Probab=100.00  E-value=1.1e-52  Score=442.17  Aligned_cols=303  Identities=48%  Similarity=0.669  Sum_probs=236.2

Q ss_pred             ccHHhhhccceEEEcCCCCCCcHHHHHHHHHHHHHhhcCCCCCCCCceEEEeecCCCcEEEEEecCHHHHHHHHHcCCce
Q 009076          236 MTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGII  315 (544)
Q Consensus       236 ~~~~~~~~~~~l~V~nLp~~~te~~L~~~f~~~G~i~~~~~~~~~~~v~~~~~~~~kg~afV~f~~~~~A~~Al~l~~~~  315 (544)
                      ..++.....++|||+|||+.+|+++|.+||..++...+.....++.+|..+.++..+|||||+|.+.++|..||+|+|+.
T Consensus       167 ~~~~~~~~~r~lyVgnLp~~~t~~~l~~~F~~~~~~~~~~~~~~~~~v~~~~~~~~kg~afVeF~~~e~A~~Al~l~g~~  246 (509)
T TIGR01642       167 YQQQATRQARRLYVGGIPPEFVEEAVVDFFNDLMIATGYHKAEDGKHVSSVNINKEKNFAFLEFRTVEEATFAMALDSII  246 (509)
T ss_pred             cCccCCccccEEEEeCCCCCCCHHHHHHHHHHHHHhcCCCCCCCCCceEEEEECCCCCEEEEEeCCHHHHhhhhcCCCeE
Confidence            34566778899999999999999999999999988777665566778999999999999999999999999999999999


Q ss_pred             eCCceeEEcCCCCCCccccccCCCCCCCCCcccccccCCCCCCCCCCCCCEEEEcCCCCCCcHHHHHHHHHhcCCceEEE
Q 009076          316 FEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFD  395 (544)
Q Consensus       316 l~g~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nl~~~~~ee~l~~~f~~~G~i~~v~  395 (544)
                      |.|+.|+|.++..+.+............+.....................+|||+|||..+++++|+++|+.||.|..+.
T Consensus       247 ~~g~~l~v~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nlp~~~~~~~l~~~f~~~G~i~~~~  326 (509)
T TIGR01642       247 YSNVFLKIRRPHDYIPVPQITPEVSQKNPDDNAKNVEKLVNSTTVLDSKDRIYIGNLPLYLGEDQIKELLESFGDLKAFN  326 (509)
T ss_pred             eeCceeEecCccccCCccccCCCCCCCCCcccccccccccccccCCCCCCEEEEeCCCCCCCHHHHHHHHHhcCCeeEEE
Confidence            99999999988877643322211111111111111111112222334567999999999999999999999999999999


Q ss_pred             EccCCCCCCcceEEEEEEcChHHHHHHHHHhCCCeeCCeEEEEEEcCCCCCCCChhhHH-HHHHHHHHHHHHHhhcCCCC
Q 009076          396 LVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQES-VLLHAQQQIALQRLMLQPGS  474 (544)
Q Consensus       396 i~~~~~~g~~~g~afV~f~~~e~A~~A~~~l~g~~~~g~~i~v~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~  474 (544)
                      |+.+..+|.++|||||+|.+.++|..||..|||..|+|+.|.|.++............. ..........+.........
T Consensus       327 ~~~~~~~g~~~g~afv~f~~~~~a~~A~~~l~g~~~~~~~l~v~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  406 (509)
T TIGR01642       327 LIKDIATGLSKGYAFCEYKDPSVTDVAIAALNGKDTGDNKLHVQRACVGANQATIDTSNGMAPVTLLAKALSQSILQIGG  406 (509)
T ss_pred             EEecCCCCCcCeEEEEEECCHHHHHHHHHHcCCCEECCeEEEEEECccCCCCCCccccccccccccccccchhhhccccC
Confidence            99998899999999999999999999999999999999999999986554332221111 00000011111111223345


Q ss_pred             CCcceeEecCCCCcccCCChHHHHHHHHHHHHHHhhcCCceee------------ccCceEEEEecCCCCCCCceE
Q 009076          475 VPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPT------------FCYKESGLIYTDRRLHNPQFV  538 (544)
Q Consensus       475 ~~~~~~~l~n~~~~~~l~~~~~~~~~~~~l~~~f~~fG~V~~i------------~~~g~a~V~f~~~~~A~a~~~  538 (544)
                      .++.|++|.|+++.++|.++++|++|+++|+++|++||.|+.|            .+.|+|||+|.++++|++|+.
T Consensus       407 ~~s~v~~l~N~~~~~~l~~d~~~~~~~edl~~~f~~~G~v~~v~i~~~~~~~~~~~~~G~~fV~F~~~e~A~~A~~  482 (509)
T TIGR01642       407 KPTKVVQLTNLVTGDDLMDDEEYEEIYEDVKTEFSKYGPLINIVIPRPNGDRNSTPGVGKVFLEYADVRSAEKAME  482 (509)
T ss_pred             CCceEEEeccCCchhHhcCcchHHHHHHHHHHHHHhcCCeeEEEeeccCcCCCcCCCcceEEEEECCHHHHHHHHH
Confidence            6899999999999999999999999999999999999999998            136899999999999977753

Members of this subfamily are found in plants, metazoa and fungi.
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG2548 consensus SWAP mRNA splicing regulator [RNA processing and modification] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4246 consensus Predicted DNA-binding protein, contains SAP domain [General function prediction only] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2548 consensus SWAP mRNA splicing regulator [RNA processing and modification] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF06495 Transformer: Fruit fly transformer protein; InterPro: IPR010519 This family consists of transformer proteins from several Drosophila species and also from Ceratitis capitata (Mediterranean fruit fly) Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query544
2yh0_A198 Solution Structure Of The Closed Conformation Of Hu 1e-47
2g4b_A172 Structure Of U2af65 Variant With Polyuridine Tract 2e-45
3vaf_A174 Structure Of U2af65 Variant With Bru3 Dna Length = 2e-45
2u2f_A85 Solution Structure Of The Second Rna-Binding Domain 4e-23
1u2f_A90 Solution Structure Of The First Rna-Binding Domain 2e-19
2hzc_A87 Crystal Structure Of The N-terminal Rrm Of The U2af 3e-17
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 7e-12
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 2e-09
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 2e-09
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 4e-09
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 8e-09
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 2e-07
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 1e-08
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 2e-08
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 7e-08
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 3e-08
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 5e-08
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 2e-07
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 7e-07
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 2e-07
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 3e-07
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 1e-06
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 1e-06
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-06
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 1e-06
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 1e-06
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 1e-06
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-06
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 2e-06
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 2e-06
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 3e-06
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 1e-05
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 1e-05
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 2e-05
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 3e-05
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 3e-05
3vf0_B285 Raver1 In Complex With Metavinculin L954 Deletion M 4e-05
3smz_A284 Human Raver1 Rrm1-3 Domains (Residues 39-320) Lengt 4e-05
3h2u_B283 Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Comple 5e-05
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 6e-05
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 7e-05
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 7e-05
2xs5_A87 Crystal Structure Of The Rrm Domain Of Mouse Delete 1e-04
2xsf_A89 Crystal Structure Of The Rrm Domain Of Mouse Delete 2e-04
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 2e-04
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 2e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 2e-04
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 2e-04
1x5u_A105 Solution Structure Of Rrm Domain In Splicing Factor 3e-04
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 3e-04
2do4_A100 Solution Structure Of The Rna Binding Domain Of Squ 4e-04
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 4e-04
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 4e-04
2f9d_A125 2.5 Angstrom Resolution Structure Of The Spliceosom 5e-04
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 6e-04
3pgw_S 437 Crystal Structure Of Human U1 Snrnp Length = 437 7e-04
2khc_A118 Bruno Rrm3+ Length = 118 7e-04
>pdb|2YH0|A Chain A, Solution Structure Of The Closed Conformation Of Human U2af65 Tandem Rrm1 And Rrm2 Domains Length = 198 Back     alignment and structure 
Iteration: 1

 Score =  187 bits (476), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 100/202 (49%), Positives = 133/202 (65%), Gaps = 10/202 (4%)
Query: 244 ARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVE 303
           ARR+YVG +P    E+++  FF+  M  +GG T  PG+ V+ V IN +K FAF+E RSV+
Sbjct: 4   ARRLYVGNIPFGITEEAMMDFFNAQMR-LGGLTQAPGNPVLAVQINQDKNFAFLEFRSVD 62
Query: 304 EASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEG 363
           E + AMA DGIIF+G  +K+RRP DY P    +  PS   P +    V   P SA     
Sbjct: 63  ETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVV---PDSA----- 114
Query: 364 PDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIAC 423
             ++F+GGLP Y  + Q++ELL SFGPL+ F+LVKD  TG SKGYAFC Y D++VTD A 
Sbjct: 115 -HKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAI 173
Query: 424 AALNGIKMGDKTLTVRRANQGA 445
           A LNG+++GDK L V+RA+ GA
Sbjct: 174 AGLNGMQLGDKKLLVQRASVGA 195
>pdb|2G4B|A Chain A, Structure Of U2af65 Variant With Polyuridine Tract Length = 172 Back     alignment and structure
>pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 Back     alignment and structure
>pdb|2U2F|A Chain A, Solution Structure Of The Second Rna-Binding Domain Of Hu2af65 Length = 85 Back     alignment and structure
>pdb|1U2F|A Chain A, Solution Structure Of The First Rna-Binding Domain Of Hu2af65 Length = 90 Back     alignment and structure
>pdb|2HZC|A Chain A, Crystal Structure Of The N-terminal Rrm Of The U2af Large Subunit Length = 87 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|3VF0|B Chain B, Raver1 In Complex With Metavinculin L954 Deletion Mutant Length = 285 Back     alignment and structure
>pdb|3SMZ|A Chain A, Human Raver1 Rrm1-3 Domains (Residues 39-320) Length = 284 Back     alignment and structure
>pdb|3H2U|B Chain B, Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Complex With Human Vinculin Tail Domain Vt Length = 283 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 Back     alignment and structure
>pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|1X5U|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 3b Length = 105 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|2DO4|A Chain A, Solution Structure Of The Rna Binding Domain Of Squamous Cell Carcinoma Antigen Recognized By T Cells 3 Length = 100 Back     alignment and structure
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2F9D|A Chain A, 2.5 Angstrom Resolution Structure Of The Spliceosomal Protein P14 Bound To Region Of Sf3b155 Length = 125 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3PGW|S Chain S, Crystal Structure Of Human U1 Snrnp Length = 437 Back     alignment and structure
>pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query544
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-73
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 7e-15
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 7e-63
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-15
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-06
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-31
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 7e-20
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 5e-07
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 4e-31
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 1e-11
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-26
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-16
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-05
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 5e-25
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-07
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-23
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-23
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 3e-10
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-23
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 7e-20
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-07
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-23
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 8e-17
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-04
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-22
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 7e-17
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-05
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-22
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-12
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-21
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 6e-12
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-20
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-12
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 9e-08
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 1e-19
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-08
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-19
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-13
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-06
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-19
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-09
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-18
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 6e-18
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-06
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 7e-18
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-08
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-17
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 7e-11
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-17
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 6e-08
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-17
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-08
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-17
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 1e-07
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 4e-17
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-08
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 4e-17
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 3e-09
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 5e-17
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 9e-08
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 6e-17
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 3e-09
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 7e-17
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-06
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-16
1x4e_A85 RNA binding motif, single-stranded interacting pro 3e-10
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-16
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-09
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-16
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-07
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-16
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 7e-09
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 3e-16
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-07
2la6_A99 RNA-binding protein FUS; structural genomics, nort 3e-16
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-11
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-16
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-15
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-15
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-15
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-15
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-14
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-14
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 6e-12
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-10
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 7e-10
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 5e-06
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-04
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 7e-04
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 6e-16
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 8e-08
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-15
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 7e-07
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-15
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 4e-06
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-15
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 5e-07
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 2e-15
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 9e-07
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-15
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-06
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-05
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-15
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-10
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-15
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-06
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-15
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-07
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 6e-15
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-08
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 8e-15
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 4e-09
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 9e-15
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 7e-07
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-14
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 7e-06
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 1e-14
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-12
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-14
3n9u_C156 Cleavage and polyadenylation specificity factor S; 6e-06
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-14
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 8e-05
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-14
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 4e-06
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-14
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-06
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-14
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-06
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 4e-14
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 7e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-14
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-07
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 4e-14
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-06
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-14
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-08
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-06
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 6e-14
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 9e-06
3p5t_L90 Cleavage and polyadenylation specificity factor S; 6e-14
3p5t_L90 Cleavage and polyadenylation specificity factor S; 6e-08
2cqd_A116 RNA-binding region containing protein 1; RNA recog 6e-14
2cqd_A116 RNA-binding region containing protein 1; RNA recog 7e-04
2dis_A109 Unnamed protein product; structural genomics, RRM 7e-14
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-07
2div_A99 TRNA selenocysteine associated protein; structural 7e-14
2div_A99 TRNA selenocysteine associated protein; structural 4e-06
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 7e-14
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 5e-07
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 8e-14
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-05
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 9e-14
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-07
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-13
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 7e-09
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 1e-13
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-05
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-13
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-06
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-13
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-05
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-13
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 5e-07
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-13
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-05
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-13
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-10
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-13
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 6e-07
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-13
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 6e-05
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-13
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 5e-06
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 4e-13
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-04
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-13
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 5e-13
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-05
2cph_A107 RNA binding motif protein 19; RNA recognition moti 5e-13
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-06
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-13
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-10
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-13
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 8e-07
2kt5_A124 RNA and export factor-binding protein 2; chaperone 8e-13
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-04
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 1e-12
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-12
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 6e-05
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-12
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 6e-05
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-12
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 4e-05
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-12
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-06
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-12
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-08
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-12
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 5e-08
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-12
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-07
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 3e-12
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 4e-12
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 6e-12
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-10
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 7e-12
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-06
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 8e-12
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 7e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 9e-12
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-11
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-06
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 1e-11
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 2e-11
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 2e-08
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-11
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 6e-06
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-11
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 4e-08
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-11
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 3e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 1e-09
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-11
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-08
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 3e-11
2f3j_A177 RNA and export factor binding protein 2; RRM domai 3e-11
2f3j_A177 RNA and export factor binding protein 2; RRM domai 3e-04
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 6e-11
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 5e-08
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 7e-11
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-09
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 1e-10
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-10
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-10
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-10
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 3e-09
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 4e-10
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 8e-04
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 4e-10
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-07
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 4e-10
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 5e-09
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 7e-10
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 3e-07
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 7e-10
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 7e-10
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 3e-09
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 9e-10
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-04
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-09
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-04
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-09
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 8e-06
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-09
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 3e-09
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-09
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 6e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-09
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-04
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 6e-09
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-06
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 6e-09
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 9e-07
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 7e-09
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-06
2krb_A81 Eukaryotic translation initiation factor 3 subunit 7e-09
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 7e-09
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 9e-05
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-08
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 8e-08
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-08
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 7e-05
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-08
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-07
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-08
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 3e-05
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 3e-08
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 4e-07
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 3e-08
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 7e-08
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 5e-08
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 8e-05
2i2y_A150 Fusion protein consists of immunoglobin G- binding 5e-08
2i2y_A150 Fusion protein consists of immunoglobin G- binding 4e-07
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 6e-08
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 3e-07
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 9e-08
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-08
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-07
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-07
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-05
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-07
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 4e-06
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-07
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-07
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-07
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-07
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-05
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 3e-07
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 6e-07
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-07
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 4e-06
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 4e-07
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 6e-06
1x5p_A97 Negative elongation factor E; structure genomics, 4e-07
1x5p_A97 Negative elongation factor E; structure genomics, 2e-06
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 4e-07
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 1e-06
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-07
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-07
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-05
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-04
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 5e-07
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 5e-07
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-04
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 5e-07
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 4e-06
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 7e-07
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-06
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 8e-07
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-05
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 8e-07
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-06
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 1e-06
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 1e-05
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-06
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 7e-06
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-06
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-06
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-06
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-06
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 3e-04
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 3e-06
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 5e-06
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 9e-06
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-05
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 4e-05
2dit_A112 HIV TAT specific factor 1 variant; structural geno 6e-05
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 9e-05
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-04
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 3e-04
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
 Score =  231 bits (591), Expect = 1e-73
 Identities = 97/204 (47%), Positives = 131/204 (64%), Gaps = 10/204 (4%)

Query: 244 ARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVE 303
           ARR+YVG +P    E+++  FF+  M  +GG T  PG+ V+ V IN +K FAF+E RSV+
Sbjct: 4   ARRLYVGNIPFGITEEAMMDFFNAQMR-LGGLTQAPGNPVLAVQINQDKNFAFLEFRSVD 62

Query: 304 EASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEG 363
           E + AMA DGIIF+G  +K+RRP DY P    +  PS   P +    V          + 
Sbjct: 63  ETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVP---------DS 113

Query: 364 PDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIAC 423
             ++F+GGLP Y  + Q++ELL SFGPL+ F+LVKD  TG SKGYAFC Y D++VTD A 
Sbjct: 114 AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAI 173

Query: 424 AALNGIKMGDKTLTVRRANQGANQ 447
           A LNG+++GDK L V+RA+ GA  
Sbjct: 174 AGLNGMQLGDKKLLVQRASVGAKN 197
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query544
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 100.0
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.97
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.97
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.97
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.97
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.97
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.97
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.97
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.97
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.96
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.96
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.96
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.95
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.95
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.95
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.95
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.95
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.89
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.89
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.88
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.88
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.87
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.87
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.87
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.86
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.85
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.85
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.84
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.83
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.83
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.83
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.82
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.82
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.81
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.81
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.8
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.78
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.78
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.77
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.75
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.74
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.74
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.74
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.74
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.74
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.74
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.74
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.74
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.74
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.74
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.74
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.73
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.73
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.73
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.73
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.73
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.73
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.73
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.73
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.73
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.73
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.73
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.73
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.73
2div_A99 TRNA selenocysteine associated protein; structural 99.72
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.72
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.72
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.72
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.72
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.72
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.72
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.71
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.71
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.71
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.71
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.71
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.71
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.71
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.71
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.71
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.71
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.71
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.71
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.71
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.7
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.7
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.7
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.7
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.7
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.7
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.7
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.7
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.7
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.7
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.7
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.7
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.7
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.69
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.69
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.69
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.69
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.69
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.69
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.69
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.69
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.69
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.69
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.68
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.68
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.68
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.68
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.68
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.68
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.68
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.67
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.67
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.67
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.67
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.67
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.67
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.67
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.67
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.67
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.67
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.67
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.66
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.66
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.66
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.66
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.66
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.66
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.66
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.65
2dis_A109 Unnamed protein product; structural genomics, RRM 99.65
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.65
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.65
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.65
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.65
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.65
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.65
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.65
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.64
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.64
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.64
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.64
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.64
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.64
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.64
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.64
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.63
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.63
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.63
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.63
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.63
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.63
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.63
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.63
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.62
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.62
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.62
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.62
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.62
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.62
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.62
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.62
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.62
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.62
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.61
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.61
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.61
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.61
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.6
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.6
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.6
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.6
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.6
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.6
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.59
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.59
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.59
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.59
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.59
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.58
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.58
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.36
1x5p_A97 Negative elongation factor E; structure genomics, 99.58
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.58
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.58
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.58
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.57
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.57
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.57
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.57
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.57
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.57
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.57
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.57
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.57
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.56
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.56
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.56
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.56
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.56
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.56
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.56
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.56
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.56
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.55
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.55
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.55
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.55
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.55
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.55
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.55
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.54
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.54
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.54
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.54
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.54
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.54
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.54
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.54
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.54
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.54
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.54
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.54
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.54
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.54
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.53
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.53
2div_A99 TRNA selenocysteine associated protein; structural 99.53
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.53
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.53
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.53
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.52
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.52
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.52
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.52
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.52
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.52
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.52
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.52
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.52
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.52
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.52
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.52
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.52
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.52
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.52
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.52
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.51
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.51
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.51
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.51
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.51
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.51
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.51
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.51
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.51
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.51
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.51
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.51
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.51
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.5
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.5
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.5
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.5
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.5
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.5
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.5
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.5
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.5
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.5
2dis_A109 Unnamed protein product; structural genomics, RRM 99.5
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.5
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.49
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.49
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.49
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.49
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.49
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.49
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.49
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.49
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.49
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.49
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.48
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.48
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.48
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.48
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.48
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.48
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.48
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.48
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.48
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.48
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.48
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.47
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.47
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.47
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.46
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.46
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.46
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.46
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.46
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.46
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.46
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.46
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.46
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.45
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.45
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.45
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.45
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.45
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.45
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.45
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.45
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.45
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.44
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.44
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.44
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.44
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.44
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.44
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.44
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.44
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.43
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.43
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.43
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.43
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.43
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.43
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.14
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.42
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.42
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.41
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.41
1x5p_A97 Negative elongation factor E; structure genomics, 99.4
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.4
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.4
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.4
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.4
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.4
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.38
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.38
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.38
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.38
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.38
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.36
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.35
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.33
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.33
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.33
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.32
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.32
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.32
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.3
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.29
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.29
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.29
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.27
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.24
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.23
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.21
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.17
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.08
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.05
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.03
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.01
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.96
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.95
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.94
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.92
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.84
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.68
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.49
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.4
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.31
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.25
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.09
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.07
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.99
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.51
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.44
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.42
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.17
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.93
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.81
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.78
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.7
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.59
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.65
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 95.32
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 94.59
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 94.43
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 94.42
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.5
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 92.48
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 84.59
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
Probab=100.00  E-value=3.4e-35  Score=284.72  Aligned_cols=218  Identities=23%  Similarity=0.325  Sum_probs=188.4

Q ss_pred             HhhhccceEEEcCCCCCCcHHHHHHHHHHHHHhhcCCCCCCCCceEEEeecCCCcEEEEEecCHHHHHHHH-HcCCceeC
Q 009076          239 QATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAM-ALDGIIFE  317 (544)
Q Consensus       239 ~~~~~~~~l~V~nLp~~~te~~L~~~f~~~G~i~~~~~~~~~~~v~~~~~~~~kg~afV~f~~~~~A~~Al-~l~~~~l~  317 (544)
                      ......++|||+|||+.+|+++|+++|+.|| |            +.+.++.++|||||+|.+.++|.+|+ .|++..|.
T Consensus        17 ~~~~~~~~l~V~nLp~~~te~~l~~~F~~~G-i------------~~~~~~~~~g~afV~f~~~~~A~~A~~~l~~~~~~   83 (284)
T 3smz_A           17 RQFRNRRKILIRGLPGDVTNQEVHDLLSDYE-L------------KYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRLR   83 (284)
T ss_dssp             HHHHCCCEEEEECCCTTCCHHHHHHHTTTSC-E------------EEEEEETTTTEEEEEESSHHHHHHHHHHHTTCEET
T ss_pred             ccCCCCCEEEEeCCCCCCCHHHHHHHHHHcC-C------------EEEEEecCCCEEEEEeCCHHHHHHHHHHcCCCeeC
Confidence            3455778999999999999999999999997 4            44455889999999999999999999 89999999


Q ss_pred             CceeEEcCCCCCCccccccCCCCCCCCCcccccccCCCCCCCCCCCCCEEEEcCCCCCCcHHHHHHHHHhcCCceEEEEc
Q 009076          318 GAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLV  397 (544)
Q Consensus       318 g~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nl~~~~~ee~l~~~f~~~G~i~~v~i~  397 (544)
                      |+.|.|.+..                                   ...+|||+|||..+++++|+++|+.||.|..+.++
T Consensus        84 g~~i~v~~~~-----------------------------------~~~~l~v~nlp~~~t~~~l~~~f~~~G~i~~~~i~  128 (284)
T 3smz_A           84 ERELSVQLQP-----------------------------------TDALLCVANLPPSLTQQQFEELVRPFGSLERCFLV  128 (284)
T ss_dssp             TEECEEEECC-----------------------------------CSCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEE
T ss_pred             CeEEEEEecC-----------------------------------CCCEEEEcCCCCcCCHHHHHHHHHhcCCeeEEEEE
Confidence            9999998632                                   12489999999999999999999999999999999


Q ss_pred             cCCCCCCcceEEEEEEcChHHHHHHHHHhCCCeeCCeEEEEEEcCCCCCCCChhhHHHHHHHHHHHHHHHhhcCCCCCCc
Q 009076          398 KDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQESVLLHAQQQIALQRLMLQPGSVPS  477 (544)
Q Consensus       398 ~~~~~g~~~g~afV~f~~~e~A~~A~~~l~g~~~~g~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  477 (544)
                      .+..+|.++|+|||+|.+.++|.+|+..|+|..|+|+.|.|.|+......                        ....+.
T Consensus       129 ~~~~~g~~~g~afV~f~~~~~a~~A~~~l~~~~~~g~~i~v~~a~~~~~~------------------------~~~~~~  184 (284)
T 3smz_A          129 YSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDAGQLT------------------------PALLHS  184 (284)
T ss_dssp             ECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECCGGGCC------------------------TTTTSC
T ss_pred             eeCCCCccceEEEEEECCHHHHHHHHHHhCCCEeCCcEEEEEECCCCCCC------------------------cccCCc
Confidence            99889999999999999999999999999999999999999999544221                        123467


Q ss_pred             ceeEecCCCCcccCCChHHHHHHHHHHHHHHhhcCCceee--------ccCceEEEEecCCCCCCCce
Q 009076          478 KVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPT--------FCYKESGLIYTDRRLHNPQF  537 (544)
Q Consensus       478 ~~~~l~n~~~~~~l~~~~~~~~~~~~l~~~f~~fG~V~~i--------~~~g~a~V~f~~~~~A~a~~  537 (544)
                      .++++.|+  +.++++.       ++|+++|++||.|..+        ...|+|||+|.+.++|.+|+
T Consensus       185 ~~l~v~nl--p~~~~~~-------~~l~~~f~~~G~i~~v~i~~~~~g~~~g~afV~f~~~~~A~~A~  243 (284)
T 3smz_A          185 RCLCVDRL--PPGFNDV-------DALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEEAQ  243 (284)
T ss_dssp             SEEEEECC--CTTCCCH-------HHHHHHTCSSSCCSEEEEEECSSCCEEEEEEEECSSHHHHHHHH
T ss_pred             cEEEEecC--CcccCCH-------HHHHHHhhCCCCeEEEEEEECCCCCcccEEEEEeCCHHHHHHHH
Confidence            78999998  4444333       3899999999999888        24799999999999996654
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 544
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-17
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-12
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 6e-17
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 5e-05
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-16
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 3e-04
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-15
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-08
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-14
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-06
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-14
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-10
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 4e-14
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 5e-08
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 7e-14
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 7e-09
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 4e-13
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-06
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-12
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-12
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 3e-07
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-12
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-06
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-12
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-12
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-09
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 3e-12
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 5e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-12
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 5e-11
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 3e-12
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-07
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 4e-12
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-06
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 5e-12
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 5e-06
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 6e-12
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-06
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 6e-12
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-07
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 6e-12
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 8e-06
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 9e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 9e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-11
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 0.001
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-11
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 7e-07
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-11
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 7e-10
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-11
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-08
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 2e-11
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 9e-06
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-05
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 3e-11
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 2e-06
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 5e-11
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 3e-05
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 9e-11
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 6e-07
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 5e-09
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-10
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-05
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-10
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 0.001
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-10
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-05
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-10
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 5e-05
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-10
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-05
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 3e-10
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 5e-07
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 4e-10
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 4e-05
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 5e-10
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 3e-06
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 5e-10
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 7e-09
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-10
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-05
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 8e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 9e-06
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 2e-04
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-09
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-07
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-09
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 3e-09
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 4e-08
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 3e-09
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-08
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 7e-09
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 9e-07
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 8e-09
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 0.001
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-08
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 7e-04
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-08
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 4e-06
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-08
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 3e-05
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 3e-08
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 7e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-08
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 3e-08
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 0.002
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-08
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 6e-08
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 1e-07
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 1e-06
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 6e-04
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 3e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-05
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 3e-07
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 5e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 9e-07
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-04
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-06
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 9e-04
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 3e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-05
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 5e-06
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 4e-05
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 6e-06
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 0.002
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 7e-06
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-05
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-05
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-05
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-04
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-05
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-04
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-05
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.002
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 3e-04
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 5e-04
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 5e-04
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 0.001
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 0.003
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Splicing factor U2AF 65 KDa subunit
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 74.8 bits (183), Expect = 3e-17
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 1/88 (1%)

Query: 244 ARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVE 303
           ARR+YVG +P    E+++  FF+  M   G   A PG+ V+ V IN +K FAF+E RSV+
Sbjct: 1   ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQA-PGNPVLAVQINQDKNFAFLEFRSVD 59

Query: 304 EASNAMALDGIIFEGAPVKVRRPSDYNP 331
           E + AMA DGIIF+G  +K+RRP DY P
Sbjct: 60  ETTQAMAFDGIIFQGQSLKIRRPHDYQP 87
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query544
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.96
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.81
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.8
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.8
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.8
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.8
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.8
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.8
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.79
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.79
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.79
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.79
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.79
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.78
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.78
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.78
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.77
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.77
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.77
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.77
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.76
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.76
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.76
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.76
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.76
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.76
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.75
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.75
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.75
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.75
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.74
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.73
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.73
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.73
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.73
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.73
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.73
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.73
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.72
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.72
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.72
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.71
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.71
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.7
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.7
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.7
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.7
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.7
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.69
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.69
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.69
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.69
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.69
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.68
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.68
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.68
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.68
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.67
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.67
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.67
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.66
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.66
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.66
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.66
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.66
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.66
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.66
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.66
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.66
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.66
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.66
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.66
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.65
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.65
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.65
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.65
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.65
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.65
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.65
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.65
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.65
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.64
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.64
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.64
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.64
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.64
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.64
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.63
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.63
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.63
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.63
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.63
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.63
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.63
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.63
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.63
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.63
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.63
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.62
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.62
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.62
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.62
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.62
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.61
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.61
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.61
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.61
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.61
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.61
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.6
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.6
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.59
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.59
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.59
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.59
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.58
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.58
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.58
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.58
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.57
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.57
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.57
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.57
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.57
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.56
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.56
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.56
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.55
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.55
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.55
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.55
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.55
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.54
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.52
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.52
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.51
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.51
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.51
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.51
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.5
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.5
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.49
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.49
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.49
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.48
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.48
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.48
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.47
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.47
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.46
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.46
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.46
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.45
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.44
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.44
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.42
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.42
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.42
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.41
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.4
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.4
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.38
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.36
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.26
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.23
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.17
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.14
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.09
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.99
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.82
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.52
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.51
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.15
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.44
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 94.95
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 94.94
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 88.59
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=1.8e-29  Score=225.37  Aligned_cols=171  Identities=23%  Similarity=0.401  Sum_probs=145.1

Q ss_pred             hccceEEEcCCCCCCcHHHHHHHHHHHHHhhcCCCCCCCCceEEEeecCCCcEEEEEecCHHHHHHHHHcCCceeCCcee
Q 009076          242 RHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPV  321 (544)
Q Consensus       242 ~~~~~l~V~nLp~~~te~~L~~~f~~~G~i~~~~~~~~~~~v~~~~~~~~kg~afV~f~~~~~A~~Al~l~~~~l~g~~l  321 (544)
                      .+.++|||+|||+.+|+++|+++|++||.|..+.      ++.+..++.++|||||+|.+.++|.+|+.+++..+.++.+
T Consensus         4 ~~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~------~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~   77 (183)
T d1u1qa_           4 EQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCV------VMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVV   77 (183)
T ss_dssp             HHHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEE------EEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEEC
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEE------eeecccCCCccCceecccCCHHHHHHHHHhcCCcccccch
Confidence            3468999999999999999999999999876654      3444457788999999999999999999888888999888


Q ss_pred             EEcCCCCCCccccccCCCCCCCCCcccccccCCCCCCCCCCCCCEEEEcCCCCCCcHHHHHHHHHhcCCceEEEEccCCC
Q 009076          322 KVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRE  401 (544)
Q Consensus       322 ~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nl~~~~~ee~l~~~f~~~G~i~~v~i~~~~~  401 (544)
                      .+.+.........                       ........+|||+|||..+++++|+++|+.||.|..+.|+.+..
T Consensus        78 ~~~~~~~~~~~~~-----------------------~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~  134 (183)
T d1u1qa_          78 EPKRAVSREDSQR-----------------------PGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRG  134 (183)
T ss_dssp             EEEECCCTTGGGS-----------------------TTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTT
T ss_pred             hhhhhhhcccccc-----------------------cccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccc
Confidence            8876443322111                       11122345899999999999999999999999999999999988


Q ss_pred             CCCcceEEEEEEcChHHHHHHHHHhCCCeeCCeEEEEEEcC
Q 009076          402 TGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRAN  442 (544)
Q Consensus       402 ~g~~~g~afV~f~~~e~A~~A~~~l~g~~~~g~~i~v~~~~  442 (544)
                      +|.++|+|||+|.+.++|.+|+. +++..|.|+.|.|.++.
T Consensus       135 ~~~~~g~~fV~f~~~e~A~~Al~-~~~~~~~G~~i~V~~A~  174 (183)
T d1u1qa_         135 SGKKRGFAFVTFDDHDSVDKIVI-QKYHTVNGHNCEVRKAL  174 (183)
T ss_dssp             TCCEEEEEEEEESCHHHHHHHHT-SSCEEETTEEEEEEECC
T ss_pred             cCccceeEEEEECCHHHHHHHHH-hCCCeECCEEEEEEecC
Confidence            99999999999999999999995 79999999999999983
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure