Citrus Sinensis ID: 009084

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540----
MEHLKRIYLGRTAITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAISQLPSSVADSNVLGILDFSSCKGLVSLPRSLLLGLSSLGLLRISYSAVMEIPQEIACLSSLTGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELRDCKMLQSLPALPLCLESLNLTGCNMLRSLPALPLCLESLNLTGCNMLRSLPELPLCLKYLYLGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIPSCLQELDASVLETLSKPSPDLLQWAPGSLESQPIYFGFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEKAINQKISELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFAFCAVPDLKQVCSDCFRYFYVKCQLDLEIKTLSETKHVDLGYNSRFIEDHIDSDHVILGFKPCLNVGFPDGYHHTTATFKFFAERNLKGIKRCGVCPVYANPSETKDNTFTINFATEVWKLDDLSSASGTSDVEELEPSPKRICRANQINTP
cccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccHHHcccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccEEEEcccccccccccccccccEEEEEccccccccccEEEEEEEEEcccccccccccEEEEEEEEEEcccccccccEEEcccccccccccccccEEEEEEEcccccccccccEEEEEEEEEEEccccEEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEEccccccccccccccccccccEEEcccccccccccHHHcccccccEEEccccccccccccHcccccccEEEcccccccccccHHHcccHHHccEEEccccccccccccccccHHccEEEccccccccccccHHcHHcccEEEccccccccccccccccccEEEccccccHcccccccccccEEEccccccccccccHcccHHHHcHcccccHcccccccccccEEEccccccHccccHHHHHHHHHHHHccHcccccccccccHHHcccccccHHcccccccccccccccccccEEEEccccHHHHHccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccHHHcccccccEEEEEcccccccccccEEEEEEEEEcccccccccccEEEEEEEEEEcccccEEEccccccccccccccccccEEEEEEccccccccccccccEEEEEEEEEccccEEEEEcEEEEEEEccccccccccccccccccccccccccccccccHcccccccHHcccccccccc
MEHLKRIYLgrtaitelpssfenlpglevlfvedcskldklpdnignlkslgHISAAGsaisqlpssvadsnvlgildfssckglvslprSLLLGLSSLGLLRISYSAVMEIPQEIACLSsltglhlsgnnfeslPASIKQLSRLRSLHLEDckmlqslpelplclksLELRdckmlqslpalplcleslnltgcnmlrslpalplcleslnltgcnmlrslpelplCLKYLylgdcnmlrslpelSLCLQSLNAwncnrlqslpeipsCLQELDASVLetlskpspdllqwapgslesqpiyfgftnclklngkanNKILADSLLRIRHMAIASLRLGYEKAINQKISELRGSlivlpgseipdwfsnqssgssiciqlpphsfcrnligfafcavpdlkqvcSDCFRYFYVKCQLDLEIKtlsetkhvdlgynsrfiedhidsdhvilgfkpclnvgfpdgyhhtTATFKFFAERNlkgikrcgvcpvyanpsetkdntfTINFATEVwklddlssasgtsdveelepspkricranqintp
mehlkriylgrtaitelpssfenLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAISQLPSSVADSNVLGILDFSSCKGLVSLPRSLLLGLSSLGLLRISYSAVMEIPQEIACLSSLTGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELRDCKMLQSLPALPLCLESLNLTGCNMLRSLPALPLCLESLNLTGCNMLRSLPELPLCLKYLYLGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIPSCLQELDASVLETLSKPSPDLLQWAPGSLESQPIYFGFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEKAINQKISELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFAFCAVPDLKQVCSDCFRYFYVKCQLDLEIKTLSETKHVDLGYNSRFIEDHIDSDHVILGFKPCLNVGFPDGYHHTTATFKFFAERNLKGIKRCGVCPVyanpsetkdntFTINFATEVWKLDDLSSASgtsdveelepspkricranqintp
MEHLKRIYLGRTAITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAISQLPSSVADSNVLGILDFSSCKglvslprslllglsslgllRISYSAVMEIPQEIACLSSLTGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELRDCKMLQSLPALPLCLESLNLTGCNMLRSLPALPLCLESLNLTGCNMLRSLPELPLCLKYLYLGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIPSCLQELDASVLETLSKPSPDLLQWAPGSLESQPIYFGFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEKAINQKISELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFAFCAVPDLKQVCSDCFRYFYVKCQLDLEIKTLSETKHVDLGYNSRFIEDHIDSDHVILGFKPCLNVGFPDGYHHTTATFKFFAERNLKGIKRCGVCPVYANPSETKDNTFTINFATEVWKLDDLSSASGTSDVEELEPSPKRICRANQINTP
*****RIYLGRTAITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAISQLPSSVADSNVLGILDFSSCKGLVSLPRSLLLGLSSLGLLRISYSAVMEIPQEIACLSSLTGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELRDCKMLQSLPALPLCLESLNLTGCNMLRSLPALPLCLESLNLTGCNMLRSLPELPLCLKYLYLGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIPSCLQELDASVLETL*****DLLQWAPGSLESQPIYFGFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEKAINQKISELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFAFCAVPDLKQVCSDCFRYFYVKCQLDLEIKTLSETKHVDLGYNSRFIEDHIDSDHVILGFKPCLNVGFPDGYHHTTATFKFFAERNLKGIKRCGVCPVYANPSETKDNTFTINFATEVWKLD******************************
MEHLKRIYLGRTAITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAISQLPSSVADSNVLGILDFSSCKGLVSLPRSLLLGLSSLGLLRISYSAVMEIPQEIACLSSLTGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELRDCKMLQSLPALPLCLESLNLTGCNMLRSLPALPLCLESLNLTGCNMLRSLPELPLCLKYLYLGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIPSCLQELDASVLETLSKPSPDLLQWAPGSLESQPIYFGFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEKAINQKISELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFAFCAVPDLKQVCSDCFRYFYVKCQLDLEIKTLSETKHVDLGYNSRFIEDHIDSDHVILGFKPCLNVGFPDGYHHTTATFKFFAERNLKGIKRCGVCPVYA****************************************************
MEHLKRIYLGRTAITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAISQLPSSVADSNVLGILDFSSCKGLVSLPRSLLLGLSSLGLLRISYSAVMEIPQEIACLSSLTGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELRDCKMLQSLPALPLCLESLNLTGCNMLRSLPALPLCLESLNLTGCNMLRSLPELPLCLKYLYLGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIPSCLQELDASVLETLSKPSPDLLQWAPGSLESQPIYFGFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEKAINQKISELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFAFCAVPDLKQVCSDCFRYFYVKCQLDLEIKTLSETKHVDLGYNSRFIEDHIDSDHVILGFKPCLNVGFPDGYHHTTATFKFFAERNLKGIKRCGVCPVYANPSETKDNTFTINFATEVWKLDDL**************SPKRICRANQINTP
*EHLKRIYLGRTAITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAISQLPSSVADSNVLGILDFSSCKGLVSLPRSLLLGLSSLGLLRISYSAVMEIPQEIACLSSLTGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELRDCKMLQSLPALPLCLESLNLTGCNMLRSLPALPLCLESLNLTGCNMLRSLPELPLCLKYLYLGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIPSCLQELDASVLETLSKPSPDLLQWAPGSLESQPIYFGFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEKAINQKISELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFAFCAVPDLKQVCSDCFRYFYVKCQLDLEIKTLSETKHVDLGYNSRFIEDHIDSDHVILGFKPCLNVGFPDGYHHTTATFKFFAERNLKGIKRCGVCPVYANP**************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHLKRIYLGRTAITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAISQLPSSVADSNVLGILDFSSCKGLVSLPRSLLLGLSSLGLLRISYSAVMEIPQEIACLSSLTGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELRDCKMLQSLPALPLCLESLNLTGCNMLRSLPALPLCLESLNLTGCNMLRSLPELPLCLKYLYLGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIPSCLQELDASVLETLSKPSPDLLQWAPGSLESQPIYFGFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEKAINQKISELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFAFCAVPDLKQVCSDCFRYFYVKCQLDLEIKTLSETKHVDLGYNSRFIEDHIDSDHVILGFKPCLNVGFPDGYHHTTATFKFFAERNLKGIKRCGVCPVYANPSETKDNTFTINFATEVWKLDDLSSASGTSDVEELEPSPKRICRANQINTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query544 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.297 0.141 0.445 1e-20
D0ZVG2700 E3 ubiquitin-protein liga yes no 0.216 0.168 0.491 1e-13
O825001095 Putative disease resistan no no 0.382 0.189 0.286 2e-12
P18009574 Probable E3 ubiquitin-pro yes no 0.323 0.306 0.381 7e-12
Q7SXW3601 Leucine-rich repeat-conta yes no 0.511 0.462 0.305 7e-12
Q9FH83 1288 Probable WRKY transcripti no no 0.610 0.257 0.275 1e-11
P17778409 Outer membrane protein Yo yes no 0.441 0.586 0.321 2e-11
P0CB161201 Putative disease resistan no no 0.343 0.155 0.321 1e-10
Q80TH2 1402 Protein LAP2 OS=Mus muscu yes no 0.404 0.156 0.286 3e-10
O235301301 Protein SUPPRESSOR OF npr no no 0.474 0.198 0.276 3e-10
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  102 bits (253), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 95/166 (57%), Gaps = 4/166 (2%)

Query: 14  ITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAISQLPSSVADSNV 73
           +  LPSS   L  L  L V  CSKL+ LP+ IG+L +L    A+ + I + PSS+   N 
Sbjct: 749 LVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNK 808

Query: 74  LGILDFSSCKGLVSLPRS-LLLGLSSLGLLRISYSAVME--IPQEIACLSSLTGLHLSGN 130
           L IL F   K  V      +  GL SL  L +SY  +++  +P+EI  LSSL  L LS N
Sbjct: 809 LIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRN 868

Query: 131 NFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELRDCKM 176
           NFE LP+SI QL  L+SL L+DC+ L  LPELP  L  L + DC M
Sbjct: 869 NFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHV-DCHM 913
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|D0ZVG2|SSPH1_SALT1 E3 ubiquitin-protein ligase sspH1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=sspH1 PE=1 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|P18009|IPA4_SHIFL Probable E3 ubiquitin-protein ligase ipaH4.5 OS=Shigella flexneri GN=ipaH4.5 PE=1 SV=3 Back     alignment and function description
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|P17778|YOPM_YERPE Outer membrane protein YopM OS=Yersinia pestis GN=yopM PE=1 SV=2 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query544
255544956 1403 leucine-rich repeat containing protein, 0.875 0.339 0.317 2e-41
224089412 679 predicted protein [Populus trichocarpa] 0.718 0.575 0.327 7e-37
359496028 1284 PREDICTED: putative disease resistance p 0.816 0.345 0.289 3e-35
224145030 1435 tir-nbs-lrr resistance protein [Populus 0.860 0.326 0.297 4e-35
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.775 0.287 0.308 3e-34
359493273 1233 PREDICTED: TMV resistance protein N-like 0.856 0.377 0.309 1e-33
451798990 1335 TMV resistance protein N-like protein 7 0.860 0.350 0.302 1e-33
147769268 1236 hypothetical protein VITISV_013549 [Viti 0.854 0.376 0.299 2e-33
224145021 1561 tir-nbs-lrr resistance protein [Populus 0.893 0.311 0.290 4e-33
359486075 1291 PREDICTED: TMV resistance protein N-like 0.812 0.342 0.304 9e-33
>gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  176 bits (447), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 171/538 (31%), Positives = 262/538 (48%), Gaps = 62/538 (11%)

Query: 3    HLKRIYLGRTAITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAIS 62
            ++K + +G TAI ELPSS  +L  L  L ++D +++ +LP +IGNL SL  ++   S+I 
Sbjct: 803  NIKYLNVGHTAIEELPSSIGSLVSLTKLNLKD-TEIKELPSSIGNLSSLVELNLKESSIK 861

Query: 63   QLPSSVADSNVLGILDFSSCKGLVSLPRSLLLGLSSLGLLRISYSAVMEIPQEIACLSSL 122
            +LPSS+   + L  L+ +    +  LP SL   LSSL    +  S +  +P  I CL+SL
Sbjct: 862  ELPSSIGCLSSLVKLNIAVVD-IEELPSSLG-QLSSLVEFNLEKSTLTALPSSIGCLTSL 919

Query: 123  TGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQSLP----ELPLCLKSLELRDCKMLQ 178
              L+L+    + LP SI  LS L  L+L  C ML SLP    EL  CL+ L L   + L+
Sbjct: 920  VKLNLAVTEIKELPPSIGCLSSLVELNLSQCPMLGSLPFSIGELK-CLEKLYLCGLRRLR 978

Query: 179  SLPALPLCLESLNLTGCNMLRSLPALPLCLESLNLTGCNMLRSL-------PELPLCLKY 231
            S+P+    L+ L     N    L  LP      +L+GC+ LR L        ++P  L Y
Sbjct: 979  SIPSSIRELKRLQDVYLNHCTKLSKLP------SLSGCSSLRDLVLSYSGIVKVPGSLGY 1032

Query: 232  ------LYLGDCNMLR---SLPELSLCLQSLNAWNCNRLQSLPEIPSCLQELDASVLETL 282
                  L L   N +R   ++ +LS  L+ L+   C RL++LPE+P  ++ L A    +L
Sbjct: 1033 LSSLQVLLLKGNNFMRIPATIRQLSW-LEVLDISYCKRLKALPELPQRIRVLVAHNCTSL 1091

Query: 283  SKPSPDLLQWAPGSLESQPIYFGFT--NCLKLNGKANNKILADSLLRIRHMAIASLRL-- 338
               S  L+Q+     +S    +GFT  NC+ L   A + I+  +LL+ +H+A A L L  
Sbjct: 1092 KTVSSPLIQFQESQEQSPDDKYGFTFANCVSLEKNARSNIVESALLKTQHLATAVLELLT 1151

Query: 339  GYEKAINQKISELRGSLIVLPGSEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFAFCAVP 398
             YE+        L   ++  PGSEIP+ F  Q++G+S+   LP       L+GF FCAV 
Sbjct: 1152 SYEEI-------LVSPVVCFPGSEIPECFRYQNTGASVTTLLPSKWHNNKLVGFTFCAVI 1204

Query: 399  DLKQVCSDCFRYFYVKCQLDLEIKTLSETKHVDLG-YNSRFIEDHIDSDHVILGFKPCLN 457
            +L+         F   C+++ E     E    ++G + ++F     ++DHV L    C+ 
Sbjct: 1205 ELENRHYQDGFTFQCDCRIENEYGDSLEFTSKEIGEWGNQF---EFETDHVFLWNTSCIY 1261

Query: 458  VGFPDGYHHT-----TATFKF--FAERNLK---------GIKRCGVCPVYANPSETKD 499
            +   + Y        TA F+F  + E   K          +K  G  PVYA   +  D
Sbjct: 1262 ILTEERYEQLRKNSCTAIFEFACYTEDEYKVMLPGANSFKVKNSGFNPVYAKDEKEWD 1319

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224089412|ref|XP_002335049.1| predicted protein [Populus trichocarpa] gi|222832778|gb|EEE71255.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359496028|ref|XP_003635135.1| PREDICTED: putative disease resistance protein At4g11170-like [Vitis vinifera] gi|296090593|emb|CBI40962.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145030|ref|XP_002325501.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862376|gb|EEE99882.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493273|ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|147769268|emb|CAN68108.1| hypothetical protein VITISV_013549 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145021|ref|XP_002325498.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862373|gb|EEE99879.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query544
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.915 0.408 0.278 8.3e-27
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.575 0.263 0.306 2e-22
TAIR|locus:21532071165 AT5G45060 [Arabidopsis thalian 0.852 0.398 0.273 5.4e-22
TAIR|locus:21222091179 AT4G36150 [Arabidopsis thalian 0.845 0.390 0.268 7.1e-22
TAIR|locus:21533631261 AT5G45200 [Arabidopsis thalian 0.930 0.401 0.274 1.3e-21
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.838 0.352 0.265 1e-20
TAIR|locus:21229651210 AT4G19510 [Arabidopsis thalian 0.829 0.372 0.274 5.6e-20
TAIR|locus:21584751217 RPS4 "RESISTANT TO P. SYRINGAE 0.661 0.295 0.293 5.7e-20
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.549 0.150 0.284 1.3e-19
TAIR|locus:20534051215 AT2G14080 [Arabidopsis thalian 0.591 0.265 0.289 2.4e-18
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 332 (121.9 bits), Expect = 8.3e-27, P = 8.3e-27
 Identities = 154/553 (27%), Positives = 244/553 (44%)

Query:    23 NLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAG-SAISQLPSSVADSNVLGILDFSS 81
             N   LE L +E C+ L KLP  I  L+ L +++    +++  LP  +   + L  L  S 
Sbjct:   664 NAHNLERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQS-LQTLILSG 722

Query:    82 CKXXXXXXXXXXXXXXXXXXXRISYSAVMEIPQEIACLSSLTGLHLSG-NNFESLPASIK 140
             C                     +  + +  +P+ I     L  L+L      + L + + 
Sbjct:   723 CSSLKKFPLISENVEVLL----LDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLY 778

Query:   141 QLSRLRSLHLEDCKMLQSLPELPLCLKSLE--LRDCKMLQSLPALPLC--LESLNLTGCN 196
             +L  L+ L L  C  L+  PE+   ++SLE  L D   +  +P +     +++ +L G +
Sbjct:   779 KLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSLCGTS 838

Query:   197 MLRSLPA--LPLCLESLNLTGCNMLR-SLPELP------LCLKYLYLGDCNMLRSLPELS 247
                S+    +P  L    LT   + R SL +LP        L+ L L   N + +LPE  
Sbjct:   839 SHVSVSMFFMPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSG-NNIENLPESF 897

Query:   248 LCLQSLNAWN---CNRLQSLPEIPSCLQELDASVLETLSKPSPDLLQWAPGSLESQPIYF 304
               L +L  ++   C  L+SLP +P  LQ LDA   E+L   +  L     G  E     F
Sbjct:   898 NQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVG--ERIHSMF 955

Query:   305 GFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEKAINQKISELRGSLIVLPGSEIP 364
              F+NC KLN  A   ++  + ++ + MA AS +  Y   + +    L G  I  P +EIP
Sbjct:   956 IFSNCYKLNQDAQASLVGHARIKSQLMANASAKRYYRGFVPEP---LVG--ICYPATEIP 1010

Query:   365 DWFSNQSSGSSICIQLPPHSFCR-NLIGFAFCAVPDLKQVCSDCFRYFYVKCQLDLEIKT 423
              WF +Q  G S+ I LPPH +C  N +G A   V   K    D  + F VKC  + E K 
Sbjct:  1011 SWFCHQRLGRSLEIPLPPH-WCDINFVGLALSVVVSFKDY-EDSAKRFSVKCCGNFENKD 1068

Query:   424 LSETKHVDL---GYN----SRFIEDH-IDSDHVILGFKPCL---NV-GFPDGYHHTTATF 471
              S T+  D    G+N    S   E   + SDHV +G+  C    NV G  +   +T A+F
Sbjct:  1069 SSFTRF-DFTLAGWNEPCGSLSHESRKLTSDHVFMGYNSCFLVKNVHGESNSCCYTKASF 1127

Query:   472 KFFA--ERNLKGIKRCGV--CPVYANPSETKDNTFTINFATEVWKLDDLSSASGTSDVEE 527
             +F+   +   K I+ C V  C +        D+   +   T + +L   S  S + D+++
Sbjct:  1128 EFYVTDDETRKKIETCEVIKCGMSLMYVPEDDDCMLLK-KTNIVQLSLKSGPSCSYDLDD 1186

Query:   528 L--EPSPKR-ICR 537
             +  +  PKR +C+
Sbjct:  1187 VMDDVRPKRGLCQ 1199
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_2489000002
hypothetical protein (679 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query544
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-19
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 7e-14
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 6e-13
PRK15387788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 1e-12
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-10
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
PRK15386426 PRK15386, PRK15386, type III secretion protein Gog 3e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 91.5 bits (227), Expect = 3e-19
 Identities = 112/429 (26%), Positives = 175/429 (40%), Gaps = 83/429 (19%)

Query: 4    LKRIYLGR-TAITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAIS 62
            L+ + L   +++ ELPSS + L  LE L +  C  L+ LP  I NLKSL  ++ +G   S
Sbjct: 659  LETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGC--S 715

Query: 63   QLPSSVADSNVLGILDFSSCKGLVSLPRSLLL-GLSSLGLLRISYSAVMEIPQEIACL-- 119
            +L S    S  +  LD      +   P +L L  L  L L  +    + E  Q +  L  
Sbjct: 716  RLKSFPDISTNISWLDLDE-TAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMT 774

Query: 120  ---SSLTGLHLSGN-NFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELRDCK 175
                SLT L LS   +   LP+SI+ L +L  L +E+C  L++LP   + L+S       
Sbjct: 775  MLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPT-GINLES------- 826

Query: 176  MLQSLPALPLCLESLNLTGCNMLRSLPALPLCLESLNLTGCNMLRSLPELPLC------L 229
                       LESL+L+GC+ LR+ P +   +  LNL+       + E+P        L
Sbjct: 827  -----------LESLDLSGCSRLRTFPDISTNISDLNLSRT----GIEEVPWWIEKFSNL 871

Query: 230  KYLYLGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIPSCLQELDASVLETLSKPSPDL 289
             +L +  CN L+ +        SLN      L+++ +   C   L  +            
Sbjct: 872  SFLDMNGCNNLQRV--------SLNISKLKHLETV-DFSDC-GALTEASWNGSPSEVAMA 921

Query: 290  LQWAPGSLESQPIYFGFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEKAINQKIS 349
                   L S      F NC  L+ +A        LL+                  Q I 
Sbjct: 922  TDNIHSKLPSTVCIN-FINCFNLDQEA--------LLQ-----------------QQSIF 955

Query: 350  ELRGSLIVLPGSEIPDWFSNQSSGSS-ICIQLPPHSFCRNLIGFAFCAVPDLKQVCSDCF 408
            +     ++L G E+P +F+++++G+S   I L   S C+    F  CAV D +       
Sbjct: 956  K----QLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISV 1011

Query: 409  R-YFYVKCQ 416
                 V C+
Sbjct: 1012 SFDIQVCCR 1020

syringae 6; Provisional. Length = 1153
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 544
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 99.92
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.8
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.76
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.71
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.7
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.69
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.63
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.49
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.45
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.36
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.35
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.33
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.2
KOG4237498 consensus Extracellular matrix protein slit, conta 99.18
KOG4237498 consensus Extracellular matrix protein slit, conta 99.18
PRK15386426 type III secretion protein GogB; Provisional 99.12
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.95
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.89
PRK15386426 type III secretion protein GogB; Provisional 98.83
KOG4341483 consensus F-box protein containing LRR [General fu 98.81
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.8
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.79
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.77
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.7
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.68
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.57
PLN03150623 hypothetical protein; Provisional 98.51
PLN03150623 hypothetical protein; Provisional 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.4
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
KOG4341483 consensus F-box protein containing LRR [General fu 98.32
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.31
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.31
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.27
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.26
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.92
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.91
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.83
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.77
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.63
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.59
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.59
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.59
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.46
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.41
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.3
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.22
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.91
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.87
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.67
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.36
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.3
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.14
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.95
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.85
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.67
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.88
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.85
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.56
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.47
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.2
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.77
smart0037026 LRR Leucine-rich repeats, outliers. 87.77
smart0037026 LRR Leucine-rich repeats, outliers. 86.6
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.6
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.13
KOG4308478 consensus LRR-containing protein [Function unknown 83.18
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.22
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=2.6e-45  Score=424.02  Aligned_cols=492  Identities=23%  Similarity=0.315  Sum_probs=362.5

Q ss_pred             CCCcEEEecCCCCcccCcccCCCCCccEEeeecCCCCCccCcccccCccCcEeEeec-CCCccCCccCCCCCCccEEEEe
Q 009084            2 EHLKRIYLGRTAITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAG-SAISQLPSSVADSNVLGILDFS   80 (544)
Q Consensus         2 ~~L~~L~L~~~~i~~lp~~l~~l~~L~~L~L~~c~~l~~lp~~l~~l~~L~~L~L~~-~~l~~lp~~~~~l~~L~~L~l~   80 (544)
                      ++|++|+|+++.++.+|.++..+++|+.|+|++|..++.+|. ++.+++|+.|+|++ +.+..+|..++++++|+.|+++
T Consensus       611 ~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~-ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~  689 (1153)
T PLN03210        611 ENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMS  689 (1153)
T ss_pred             cCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCc-cccCCcccEEEecCCCCccccchhhhccCCCCEEeCC
Confidence            578889998888888888888899999999999888888886 78899999999954 5677899999999999999999


Q ss_pred             cCCCCCccChhhhcCCCCCCEEEEeccCCCC-CChhccCCCCccEEEEeCccCCCCchhhcCCCCccEEEecCCCCCC--
Q 009084           81 SCKGLVSLPRSLLLGLSSLGLLRISYSAVME-IPQEIACLSSLTGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQ--  157 (544)
Q Consensus        81 ~c~~l~~lp~~~~~~l~~L~~L~l~~~~~~~-lp~~l~~l~~L~~L~l~~~~l~~lp~~l~~l~~L~~L~L~~~~~l~--  157 (544)
                      +|..++.+|..  .++++|+.|++++|.... +|..   ..+|+.|++++|.++.+|..+ .+++|+.|.+.++....  
T Consensus       690 ~c~~L~~Lp~~--i~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~~-~l~~L~~L~l~~~~~~~l~  763 (1153)
T PLN03210        690 RCENLEILPTG--INLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFPSNL-RLENLDELILCEMKSEKLW  763 (1153)
T ss_pred             CCCCcCccCCc--CCCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCccccccccc-cccccccccccccchhhcc
Confidence            99989999885  378899999999986544 6543   468899999999999998765 67889988888754211  


Q ss_pred             ----CCC----CCCCCCCEEEEecCCCCCcCCCC---CCCccEEEEeCCCCCCCCCCC--CCCccEEEEeCCCCCCcCCC
Q 009084          158 ----SLP----ELPLCLKSLELRDCKMLQSLPAL---PLCLESLNLTGCNMLRSLPAL--PLCLESLNLTGCNMLRSLPE  224 (544)
Q Consensus       158 ----~lp----~~~~~L~~L~l~~~~~l~~l~~~---~~~L~~L~Ls~c~~l~~l~~~--~~~L~~L~Ls~c~~l~~lp~  224 (544)
                          .++    ..+++|+.|++++|..+..+|..   +.+|+.|+|++|..++.+|..  +++|+.|+|++|..+..+|.
T Consensus       764 ~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL~~L~Ls~c~~L~~~p~  843 (1153)
T PLN03210        764 ERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLRTFPD  843 (1153)
T ss_pred             ccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCCCccccCEEECCCCCccccccc
Confidence                111    23578999999999999988865   567899999999999998876  89999999999999999999


Q ss_pred             CCCCCCEEeEecCCCCCCCCcc---cCCCCeeeeccCCCCCCCCCCC---CCccEEeccCCCCCCCCCccccccCCCCC-
Q 009084          225 LPLCLKYLYLGDCNMLRSLPEL---SLCLQSLNAWNCNRLQSLPEIP---SCLQELDASVLETLSKPSPDLLQWAPGSL-  297 (544)
Q Consensus       225 ~~~~L~~L~L~~~~~l~~lp~~---~~~L~~L~l~~c~~L~~l~~lp---~sL~~L~i~~C~~L~~~~~~~~~~~~~~~-  297 (544)
                      ...+|+.|+|++| .++.+|..   +++|+.|++.+|++++.+|..+   ++|+.|++++|++|+.++........... 
T Consensus       844 ~~~nL~~L~Ls~n-~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~  922 (1153)
T PLN03210        844 ISTNISDLNLSRT-GIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMAT  922 (1153)
T ss_pred             cccccCEeECCCC-CCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhc
Confidence            9999999999987 45677754   4779999999999999998644   57888899999999987643211100000 


Q ss_pred             ------CCCCeEEEEecCCCchhHhhhhhhhhhHHHHhhhhhhhhhhhhhHHHHhhhhcccceEEEccCCCCCccceecC
Q 009084          298 ------ESQPIYFGFTNCLKLNGKANNKILADSLLRIRHMAIASLRLGYEKAINQKISELRGSLIVLPGSEIPDWFSNQS  371 (544)
Q Consensus       298 ------~~~~~~l~~~~C~~L~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~q~~~~~~~~~~~~Pg~~iP~wf~~~~  371 (544)
                            -.....+.|.+|++|++.+.  ++.      +                     .....+++||.++|+||.||+
T Consensus       923 ~n~~~~~p~~~~l~f~nC~~L~~~a~--l~~------~---------------------~~~~~~~l~g~evp~~f~hr~  973 (1153)
T PLN03210        923 DNIHSKLPSTVCINFINCFNLDQEAL--LQQ------Q---------------------SIFKQLILSGEEVPSYFTHRT  973 (1153)
T ss_pred             ccccccCCchhccccccccCCCchhh--hcc------c---------------------ccceEEECCCccCchhccCCc
Confidence                  00124568999999988652  110      0                     022468899999999999999


Q ss_pred             CCceEE-EeCCCCccccCccceEEEEEccCCCccC--CcceeEEEEEEEecCCCCccccceeEeeecccccccccCCCeE
Q 009084          372 SGSSIC-IQLPPHSFCRNLIGFAFCAVPDLKQVCS--DCFRYFYVKCQLDLEIKTLSETKHVDLGYNSRFIEDHIDSDHV  448 (544)
Q Consensus       372 ~g~si~-i~lp~~~~~~~~~gf~~c~v~~~~~~~~--~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sdH~  448 (544)
                      +|++++ |++|+.|+...|.||++|+|+++.....  ..+ ++.|.|+++++.|+..+.......|     ......+|+
T Consensus       974 ~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~~~~~-~~~~~c~~~~~~~~~~~~~~~~~~~-----~~~~~~~~l 1047 (1153)
T PLN03210        974 TGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISVSF-DIQVCCRFIDRLGNHFDSPYQPHVF-----SVTKKGSHL 1047 (1153)
T ss_pred             ccceeeeeccCCcccCCCccceEEEEEEecCccccCCCce-eEEEEEEEECCCCCccccCCCceeE-----eeeccccce
Confidence            999999 9999999988899999999998876543  234 6889999998877632110000001     012346677


Q ss_pred             EEEeeecccc------CCCCCcceeeEEEEEeccCCceeEEEeeeeEeecCCCCCCCCceeEEEeeee-eccccee--cc
Q 009084          449 ILGFKPCLNV------GFPDGYHHTTATFKFFAERNLKGIKRCGVCPVYANPSETKDNTFTINFATEV-WKLDDLS--SA  519 (544)
Q Consensus       449 ~~~~~~~~~~------~~~~~~~~~~~~f~f~~~~~~~~vk~cGv~~i~~~~~~~~~~~f~~~~~~~~-~~~~~~~--~~  519 (544)
                      ++|... ...      ..+..|+|+++.|+|...+..++||+||||++|++++.+...  ..-+.++. ...++.+  .+
T Consensus      1048 ~~~~~~-~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~cg~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~ 1124 (1153)
T PLN03210       1048 VIFDCC-FPLNEDNAPLAELNYDHVDIQFRLTNKNSQLKLKGCGIRLSEDDSSLNNTL--PNVEEADDDNPVNGSEHWED 1124 (1153)
T ss_pred             EEeccc-ccccccccchhccCCceeeEEEEEecCCCCeEEEeeeEEEeccCCCcccCC--Cccccccccccccccccccc
Confidence            766432 111      112347788899998776666899999999999877654322  11111111 1122222  22


Q ss_pred             CCCCCccccCCCccccccccc
Q 009084          520 SGTSDVEELEPSPKRICRANQ  540 (544)
Q Consensus       520 ~~~~~~ee~~~~~kr~~~~~~  540 (544)
                      .|+++ .|++.++||++...+
T Consensus      1125 ~~~~~-~~~~~~~~~~~~~~~ 1144 (1153)
T PLN03210       1125 CEDSA-LERESERTKDREMRD 1144 (1153)
T ss_pred             cCCcc-hhccccccchhhhhh
Confidence            34444 456889999887544

syringae 6; Provisional
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query544
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 2e-11
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 3e-10
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 6e-10
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 1e-09
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-08
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 7e-07
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure 
Iteration: 1

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/131 (43%), Positives = 76/131 (58%), Gaps = 10/131 (7%)
Query: 156 LQSLPE-LPLCLKSLELRDCKMLQSLPALPLCLESLNLTGC-NMLRSLPALPLCLESLNL 213
           L SLP+ LP  +  LE+    ++ SLP LP  LE L+   C N L +LP LP  L+ L++
Sbjct: 71  LSSLPDNLPPQITVLEITQNALI-SLPELPASLEYLD--ACDNRLSTLPELPASLKHLDV 127
Query: 214 TGCNMLRSLPELPLCLKYLYLGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIPSCLQE 273
              N L  LPELP  L+Y+   D N L  LPEL   L+ L+  N N+L  LPE+P  L+ 
Sbjct: 128 DN-NQLTXLPELPALLEYIN-ADNNQLTXLPELPTSLEVLSVRN-NQLTFLPELPESLEA 184
Query: 274 LDAS--VLETL 282
           LD S  +LE+L
Sbjct: 185 LDVSTNLLESL 195
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query544
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-37
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-34
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-34
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-27
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-24
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  138 bits (351), Expect = 5e-37
 Identities = 65/280 (23%), Positives = 105/280 (37%), Gaps = 43/280 (15%)

Query: 1   MEHLKRIYLGRTAITELPSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSA 60
                 + L    + + P     L  L+ + + D + L +LPD +     L  ++ A + 
Sbjct: 80  QPGRVALELRSVPLPQFPDQAFRLSHLQHMTI-DAAGLMELPDTMQQFAGLETLTLARNP 138

Query: 61  ISQLPSSVADSNVLGILDFSSCKGLVSLPRSL--------LLGLSSLGLLRISYSAVMEI 112
           +  LP+S+A  N L  L   +C  L  LP  L          GL +L  LR+ ++ +  +
Sbjct: 139 LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSL 198

Query: 113 PQEIACLSSLTGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELR 172
           P  IA L +L  L +  +   +L  +I  L +L  L L  C  L++ P            
Sbjct: 199 PASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPP--------IFG 250

Query: 173 DCKMLQSLPALPLCLESLNLTGCNMLRSLPA----LPLCLESLNLTGCNMLRSLPELPLC 228
                         L+ L L  C+ L +LP     L   LE L+L GC  L  LP L   
Sbjct: 251 GRA----------PLKRLILKDCSNLLTLPLDIHRLT-QLEKLDLRGCVNLSRLPSLIAQ 299

Query: 229 LKYLYLGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIP 268
           L            +   + +        + +R  + P  P
Sbjct: 300 LP-----------ANCIILVPPHLQAQLDQHRPVARPAEP 328
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query544
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.9
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.89
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.85
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.82
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.82
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.79
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.74
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.74
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.71
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.67
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.66
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.66
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.63
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.6
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.6
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.58
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.54
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.54
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.54
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.54
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.51
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.51
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.51
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.49
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.45
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.45
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.43
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.41
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.35
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.32
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.16
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.15
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.97
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.87
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.87
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.86
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.85
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.69
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.63
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.53
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.3
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.0
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.93
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.92
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.82
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.6
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.57
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.5
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.72
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.68
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.21
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.68
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.32
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.68
3ukw_C28 Bimax1 peptide; arm repeat, armadillo repeat, nucl 80.36
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
Probab=99.94  E-value=8.3e-26  Score=247.59  Aligned_cols=296  Identities=20%  Similarity=0.265  Sum_probs=235.0

Q ss_pred             CCCCcEEEecCCCCcc------------------cCcccC--CCCCccEEeeecCCCCCccCcccccCccCcEeEeecCC
Q 009084            1 MEHLKRIYLGRTAITE------------------LPSSFE--NLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSA   60 (544)
Q Consensus         1 l~~L~~L~L~~~~i~~------------------lp~~l~--~l~~L~~L~L~~c~~l~~lp~~l~~l~~L~~L~L~~~~   60 (544)
                      |++|++|+|++|.++.                  +|..++  ++++|++|+|++|...+.+|..++++++|++|++++|.
T Consensus       205 l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~ip~~l~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~  284 (636)
T 4eco_A          205 LTKLRQFYMGNSPFVAENICEAWENENSEYAQQYKTEDLKWDNLKDLTDVEVYNCPNLTKLPTFLKALPEMQLINVACNR  284 (636)
T ss_dssp             CTTCCEEEEESCCCCGGGBSSSCSCTTSHHHHHHTTSCCCGGGCTTCCEEEEECCTTCSSCCTTTTTCSSCCEEECTTCT
T ss_pred             ccCCCEEECcCCccccccccccccccccchhcccCchhhhhcccCCCCEEEecCCcCCccChHHHhcCCCCCEEECcCCC
Confidence            5789999999999998                  999998  99999999999998889999999999999999999998


Q ss_pred             -Ccc--CCccCCCC------CCccEEEEecCCCCCccCh--hhhcCCCCCCEEEEeccCCC-CCChhccCCCCccEEEEe
Q 009084           61 -ISQ--LPSSVADS------NVLGILDFSSCKGLVSLPR--SLLLGLSSLGLLRISYSAVM-EIPQEIACLSSLTGLHLS  128 (544)
Q Consensus        61 -l~~--lp~~~~~l------~~L~~L~l~~c~~l~~lp~--~~~~~l~~L~~L~l~~~~~~-~lp~~l~~l~~L~~L~l~  128 (544)
                       ++.  +|..++.+      ++|+.|++++|. +..+|.  . +..+++|+.|++++|.+. .+| .++.+++|+.|+++
T Consensus       285 ~l~~~~lp~~~~~L~~~~~l~~L~~L~L~~n~-l~~ip~~~~-l~~l~~L~~L~L~~N~l~g~ip-~~~~l~~L~~L~L~  361 (636)
T 4eco_A          285 GISGEQLKDDWQALADAPVGEKIQIIYIGYNN-LKTFPVETS-LQKMKKLGMLECLYNQLEGKLP-AFGSEIKLASLNLA  361 (636)
T ss_dssp             TSCHHHHHHHHHHHHHSGGGGTCCEEECCSSC-CSSCCCHHH-HTTCTTCCEEECCSCCCEEECC-CCEEEEEESEEECC
T ss_pred             CCccccchHHHHhhhccccCCCCCEEECCCCc-CCccCchhh-hccCCCCCEEeCcCCcCccchh-hhCCCCCCCEEECC
Confidence             884  89888776      999999999987 558887  5 899999999999999999 698 88999999999999


Q ss_pred             CccCCCCchhhcCCCC-ccEEEecCCCCCCCCCCCC-----CCCCEEEEecCCCCCcCCCCCC----------CccEEEE
Q 009084          129 GNNFESLPASIKQLSR-LRSLHLEDCKMLQSLPELP-----LCLKSLELRDCKMLQSLPALPL----------CLESLNL  192 (544)
Q Consensus       129 ~~~l~~lp~~l~~l~~-L~~L~L~~~~~l~~lp~~~-----~~L~~L~l~~~~~l~~l~~~~~----------~L~~L~L  192 (544)
                      +|.++.+|..+..+++ |+.|++++|... .+|..+     ++|+.|+++++.....+|..+.          +|+.|++
T Consensus       362 ~N~l~~lp~~l~~l~~~L~~L~Ls~N~l~-~lp~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~~~~~~~~~~~L~~L~L  440 (636)
T 4eco_A          362 YNQITEIPANFCGFTEQVENLSFAHNKLK-YIPNIFDAKSVSVMSAIDFSYNEIGSVDGKNFDPLDPTPFKGINVSSINL  440 (636)
T ss_dssp             SSEEEECCTTSEEECTTCCEEECCSSCCS-SCCSCCCTTCSSCEEEEECCSSCTTTTTTCSSCTTCSSCCCCCCEEEEEC
T ss_pred             CCccccccHhhhhhcccCcEEEccCCcCc-ccchhhhhcccCccCEEECcCCcCCCcchhhhcccccccccCCCCCEEEC
Confidence            9999999999999999 999999999844 777643     3688999988876666655444          7888999


Q ss_pred             eCCCCCCCCCCC----CCCccEEEEeCCCCCCcCCCCC-C----------CCCEEeEecCCCCCCCCccc-----CCCCe
Q 009084          193 TGCNMLRSLPAL----PLCLESLNLTGCNMLRSLPELP-L----------CLKYLYLGDCNMLRSLPELS-----LCLQS  252 (544)
Q Consensus       193 s~c~~l~~l~~~----~~~L~~L~Ls~c~~l~~lp~~~-~----------~L~~L~L~~~~~l~~lp~~~-----~~L~~  252 (544)
                      ++|... .+|..    +++|++|+|++| .+..+|... .          +|+.|++++|... .+|..+     ++|+.
T Consensus       441 s~N~l~-~lp~~~~~~l~~L~~L~Ls~N-~l~~i~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~-~lp~~~~~~~l~~L~~  517 (636)
T 4eco_A          441 SNNQIS-KFPKELFSTGSPLSSINLMGN-MLTEIPKNSLKDENENFKNTYLLTSIDLRFNKLT-KLSDDFRATTLPYLVG  517 (636)
T ss_dssp             CSSCCC-SCCTHHHHTTCCCSEEECCSS-CCSBCCSSSSEETTEECTTGGGCCEEECCSSCCC-BCCGGGSTTTCTTCCE
T ss_pred             cCCccC-cCCHHHHccCCCCCEEECCCC-CCCCcCHHHhccccccccccCCccEEECcCCcCC-ccChhhhhccCCCcCE
Confidence            998876 56653    788999999885 455777543 1          7889999888655 676543     56888


Q ss_pred             eeeccCCCCCCCCC---CCCCccEEeccCCC------CCCCCCccccccCCCCCCCCCeEEEEecCC
Q 009084          253 LNAWNCNRLQSLPE---IPSCLQELDASVLE------TLSKPSPDLLQWAPGSLESQPIYFGFTNCL  310 (544)
Q Consensus       253 L~l~~c~~L~~l~~---lp~sL~~L~i~~C~------~L~~~~~~~~~~~~~~~~~~~~~l~~~~C~  310 (544)
                      |++.++. +..+|.   -.++|+.|++++|.      -...+|..+...      ..++.|++.+|.
T Consensus       518 L~Ls~N~-l~~ip~~~~~l~~L~~L~Ls~N~~ls~N~l~~~~p~~l~~l------~~L~~L~Ls~N~  577 (636)
T 4eco_A          518 IDLSYNS-FSKFPTQPLNSSTLKGFGIRNQRDAQGNRTLREWPEGITLC------PSLTQLQIGSND  577 (636)
T ss_dssp             EECCSSC-CSSCCCGGGGCSSCCEEECCSCBCTTCCBCCCCCCTTGGGC------SSCCEEECCSSC
T ss_pred             EECCCCC-CCCcChhhhcCCCCCEEECCCCcccccCcccccChHHHhcC------CCCCEEECCCCc
Confidence            8888854 444664   23678888885533      344444433221      124667777664
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3ukw_C Bimax1 peptide; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding, protein transport-IN complex; HET: BTB; 2.10A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 544
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 59.3 bits (142), Expect = 3e-10
 Identities = 41/281 (14%), Positives = 87/281 (30%), Gaps = 24/281 (8%)

Query: 3   HLKRIYLGRTAITEL-PSSFENLPGLEVLFVEDCSKLDKLPDNIGNLKSLGHISAAGSAI 61
               + L    ITE+    F+NL  L  L + +       P     L  L  +  + + +
Sbjct: 32  DTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQL 91

Query: 62  SQLPSSVADSNVLGILDFSSCKGLVSLPRSLLLGLSSLGLLRISYSAVMEIPQEIACLSS 121
            +LP  +  +     +  +    +     + L  +  + L      +          +  
Sbjct: 92  KELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKK 151

Query: 122 LTGLHLSGNNFESLPASIKQLSRLRSLHLEDCKMLQSLPELPLCLKSLELRDCK------ 175
           L+ + ++  N  ++P  +     L  LHL+  K+ +        L +L            
Sbjct: 152 LSYIRIADTNITTIPQGL--PPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISA 209

Query: 176 MLQSLPALPLCLESLNLTGCNMLRSLPAL--PLCLESLNLTGCNMLRSLPELPLCLKYLY 233
           +     A    L  L+L    +++    L     ++ + L   N + ++     C     
Sbjct: 210 VDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHN-NNISAIGSNDFCPPGYN 268

Query: 234 LGDCNMLRSLPELSLCLQSLNAWNCNRLQSLPEIPSCLQEL 274
                   S   +SL          N +Q     PS  + +
Sbjct: 269 TK----KASYSGVSL--------FSNPVQYWEIQPSTFRCV 297
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query544
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.77
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.71
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.66
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.56
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.54
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.39
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.28
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.09
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.08
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.91
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.91
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.78
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.59
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.47
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.63
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.14
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.91
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.84  E-value=1e-21  Score=193.69  Aligned_cols=237  Identities=21%  Similarity=0.260  Sum_probs=123.3

Q ss_pred             CCcEEEecCCCCc---ccCcccCCCCCccEEeeecCCCC-CccCcccccCccCcEeEeecCCCccC-CccCCCCCCccEE
Q 009084            3 HLKRIYLGRTAIT---ELPSSFENLPGLEVLFVEDCSKL-DKLPDNIGNLKSLGHISAAGSAISQL-PSSVADSNVLGIL   77 (544)
Q Consensus         3 ~L~~L~L~~~~i~---~lp~~l~~l~~L~~L~L~~c~~l-~~lp~~l~~l~~L~~L~L~~~~l~~l-p~~~~~l~~L~~L   77 (544)
                      +++.|+|+++.+.   .+|..++++++|++|+|++|+.+ +.+|..++++++|++|+|++|++..+ +..+..+.+|+.+
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l  130 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL  130 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence            3555666665554   35555666666666666653333 35666666666666666666665533 3334555666666


Q ss_pred             EEecCCCCCccChhhhcCCCCCCEEEEeccCCCC-CChhccCCCCc-cEEEEeCccCC-CCchhhcCCCCccEEEecCCC
Q 009084           78 DFSSCKGLVSLPRSLLLGLSSLGLLRISYSAVME-IPQEIACLSSL-TGLHLSGNNFE-SLPASIKQLSRLRSLHLEDCK  154 (544)
Q Consensus        78 ~l~~c~~l~~lp~~~~~~l~~L~~L~l~~~~~~~-lp~~l~~l~~L-~~L~l~~~~l~-~lp~~l~~l~~L~~L~L~~~~  154 (544)
                      ++.+|.....+|.. +.+++.|+.+++++|.+.. +|..++.+.++ +.+++++|+++ ..|..+..+.. ..+++.++.
T Consensus       131 ~l~~N~~~~~~p~~-l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-~~l~l~~~~  208 (313)
T d1ogqa_         131 DFSYNALSGTLPPS-ISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-AFVDLSRNM  208 (313)
T ss_dssp             ECCSSEEESCCCGG-GGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-SEEECCSSE
T ss_pred             ccccccccccCchh-hccCcccceeecccccccccccccccccccccccccccccccccccccccccccc-ccccccccc
Confidence            66665555555554 5556666666666665553 55555555544 55555555555 23334444332 245555544


Q ss_pred             CCCCCCCCCCCCCEEEEecCCCCCcCCCCCCCccEEEEeCCCCCCCCCCC--CCCccEEEEeCCCCCCcCCCCC---CCC
Q 009084          155 MLQSLPELPLCLKSLELRDCKMLQSLPALPLCLESLNLTGCNMLRSLPAL--PLCLESLNLTGCNMLRSLPELP---LCL  229 (544)
Q Consensus       155 ~l~~lp~~~~~L~~L~l~~~~~l~~l~~~~~~L~~L~Ls~c~~l~~l~~~--~~~L~~L~Ls~c~~l~~lp~~~---~~L  229 (544)
                      ....+|...                  ....+++.|++++|...+.++..  +++|+.|+|++|...+.+|..+   ++|
T Consensus       209 ~~~~~~~~~------------------~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L  270 (313)
T d1ogqa_         209 LEGDASVLF------------------GSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFL  270 (313)
T ss_dssp             EEECCGGGC------------------CTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTC
T ss_pred             ccccccccc------------------cccccccccccccccccccccccccccccccccCccCeecccCChHHhCCCCC
Confidence            333333221                  12234455555555544444433  5556666666644444555433   456


Q ss_pred             CEEeEecCCCCCCCCcc--cCCCCeeeeccCC
Q 009084          230 KYLYLGDCNMLRSLPEL--SLCLQSLNAWNCN  259 (544)
Q Consensus       230 ~~L~L~~~~~l~~lp~~--~~~L~~L~l~~c~  259 (544)
                      ++|+|++|...+.+|..  +.+|+.+++.+.+
T Consensus       271 ~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         271 HSLNVSFNNLCGEIPQGGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CEEECCSSEEEEECCCSTTGGGSCGGGTCSSS
T ss_pred             CEEECcCCcccccCCCcccCCCCCHHHhCCCc
Confidence            66666666555455543  2334444444443
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure