Citrus Sinensis ID: 009154

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540--

MHIQVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQSLQDAHERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLLPLYNNHKGGTNRPRTD

cEEEEEccccccHHHHHHHHHccccccccEEcccccccccEEEEEcccccccccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc

cEEEEEEcccccHHHHHHHHHcccccccccccccccccccEEEEEEEccccccccccEEEEEEEcccccccccccccccHHHHHHHHHHcHEEEcccccccHHHHHHHHHHHHHHHHHHHcccccHEccccccEEEEEEHcccccccHHHHHHHHHHHccccccccHHHHcccHHHHHHHHccccEEEEEccccHHHHHHcccccHcccHHHHHHHHHHHHHHHHcccccEccccEEccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccHccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc

mhiqvigpyrsgksFLLNQLLslscdegfgvghmrdtktkgiwvwgnpvemeidgsrtsvfyldtegfesigksnvydDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYgrvkgqdvafePAKLVWLIQRDFLQGKSVQEMVHDALQrvpndkgdknidMVNQIRNSLAimgdnstafslpqphllrtklcdmkdeeldpIYVKRREQLKKLVASVtrpkivqgkflngNEFVAFMEQILEALnkgeipstgslVEVFNKGILERCLKLYNERMakvrlplpeqslqDAHERSKKeamdvfdvqhfgrqHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDkmdqlqvlrlpsmakfnagflqcnqsfahecvgpskaNYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTwetlvyspvldldrwavpLGCMIAVFVLYWRccgkrkygsrgllplynnhkggtnrprtd

mhiqvigpyrsgKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALqrvpndkgdkniDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLvasvtrpkivqgkflnGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAkvrlplpeqSLQDAHERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRkygsrgllplynnhkggtnrprtd

****VIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDAL***********IDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVR**********************FDVQHF**********QLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLLPLYN************

MHIQVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQSLQDAHERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCED*************AKFNAGFLQCNQSFAHECVGPSKANYEQRMMK*************NHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLL****************

MHIQVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQS*********KEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLLPLYNNHK*********

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MHIQVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQSLQDAHERSKKEAMDVFDVQHFGxxxxxxxxxxxxxxxxxxxxxVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLLPLYNNHKGGTNRPRTD

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		542	2.2.26 [Sep-21-2011]
Q96PP9		640	Guanylate-binding protein	yes	no	0.654	0.554	0.255	6e-23
Q9H0R5		595	Guanylate-binding protein	no	no	0.649	0.591	0.270	2e-22
Q8N8V2		638	Guanylate-binding protein	no	no	0.636	0.540	0.253	5e-22
Q96PP8		586	Guanylate-binding protein	no	no	0.630	0.583	0.272	6e-22
P32456		591	Interferon-induced guanyl	no	no	0.549	0.504	0.278	3e-21
Q61107		620	Guanylate-binding protein	no	no	0.643	0.562	0.247	4e-21
Q5R9T9		633	Guanylate-binding protein	no	no	0.627	0.537	0.250	8e-21
Q9Z0E6		589	Interferon-induced guanyl	no	no	0.595	0.548	0.263	1e-20
Q63663		589	Interferon-induced guanyl	no	no	0.594	0.546	0.259	1e-20
Q6ZN66		633	Guanylate-binding protein	no	no	0.627	0.537	0.242	5e-20

>sp\|Q96PP9\|GBP4_HUMAN Guanylate-binding protein 4 OS=Homo sapiens GN=GBP4 PE=1 SV=2	Back alignment and function desciption

 Score =  109 bits (272), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 101/395 (25%), Positives = 188/395 (47%), Gaps = 40/395 (10%)

Query: 3   IQVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFY 62
           + ++G YR+GKS+L+N+L       GF +G    ++TKGIW+W  P    +     ++  
Sbjct: 56  VAIVGLYRTGKSYLMNRLAGKR--NGFPLGSTVQSETKGIWMWCVP---HLSKPNHTLVL 110

Query: 63  LDTEGFESIGKSNVYDDR-IFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGR 121
           LDTEG   + KSN  +D  IFALA ++SS  +YN   TI    + +L +  ELAE    +
Sbjct: 111 LDTEGLGDVEKSNPKNDSWIFALAVLLSSSFVYNSVSTINHQALEQLHYVTELAELIRAK 170

Query: 122 V-----KGQD----VAFEPAKLVWLIQRDF-----LQGKSV--QEMVHDALQRVPNDKGD 165
                 + +D     +F P   +W + RDF     L G  +   E + +AL+ +P    +
Sbjct: 171 SCPRPDEAEDSSEFASFFP-DFIWTV-RDFTLELKLDGNPITEDEYLENALKLIPGK--N 226

Query: 166 KNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMK---DEELDPIYVKRREQLKKL 222
             I   N  R  +         F   +P   +  L  M    +E L+  ++ + +     
Sbjct: 227 PKIQNSNMPRECIRHFFRKRKCFVFDRPTNDKQYLNHMDEVPEENLERHFLMQSDNFCSY 286

Query: 223 VASVTRPKIV-QGKFLNGNEFVAFMEQILEALNKGEIP----STGSLVEVFNKGILERCL 277
           + +  + K + +G  + G      +   ++A+N G +P    +  +L ++ N   ++R  
Sbjct: 287 IFTHAKTKTLREGIIVTGKRLGTLVVTYVDAINSGAVPCLENAVTALAQLENPAAVQRAA 346

Query: 278 KLYNERMAKVRLPLPEQSLQ---DAHERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQE 334
             Y+++MA+ +L LP  +LQ   D H   ++EA+ VF ++H  +    +   +L + I++
Sbjct: 347 DHYSQQMAQ-QLRLPTDTLQELLDVHAACEREAIAVF-MEHSFKDENHEFQKKLVDTIEK 404

Query: 335 AYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLR 369
              + ++ NE  S+K C++   R  + + +  +LR
Sbjct: 405 KKGDFVLQNEEASAKYCQAELKRLSEHLTE-SILR 438

Binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. Plays a role in erythroid differentiation.
Homo sapiens (taxid: 9606)

>sp\|Q9H0R5\|GBP3_HUMAN Guanylate-binding protein 3 OS=Homo sapiens GN=GBP3 PE=2 SV=3	Back alignment and function description

>sp\|Q8N8V2\|GBP7_HUMAN Guanylate-binding protein 7 OS=Homo sapiens GN=GBP7 PE=2 SV=2	Back alignment and function description

>sp\|Q96PP8\|GBP5_HUMAN Guanylate-binding protein 5 OS=Homo sapiens GN=GBP5 PE=1 SV=1	Back alignment and function description

>sp\|P32456\|GBP2_HUMAN Interferon-induced guanylate-binding protein 2 OS=Homo sapiens GN=GBP2 PE=1 SV=3	Back alignment and function description

>sp\|Q61107\|GBP4_MOUSE Guanylate-binding protein 4 OS=Mus musculus GN=Gbp4 PE=1 SV=1	Back alignment and function description

>sp\|Q5R9T9\|GBP6_PONAB Guanylate-binding protein 6 OS=Pongo abelii GN=GBP6 PE=2 SV=1	Back alignment and function description

>sp\|Q9Z0E6\|GBP2_MOUSE Interferon-induced guanylate-binding protein 2 OS=Mus musculus GN=Gbp2 PE=1 SV=1	Back alignment and function description

>sp\|Q63663\|GBP2_RAT Interferon-induced guanylate-binding protein 2 OS=Rattus norvegicus GN=Gbp2 PE=1 SV=2	Back alignment and function description

>sp\|Q6ZN66\|GBP6_HUMAN Guanylate-binding protein 6 OS=Homo sapiens GN=GBP6 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		542
255559907		631	interferon-induced guanylate-binding pro	0.996	0.855	0.808	0.0
225437197		674	PREDICTED: guanylate-binding protein 4-l	0.996	0.801	0.837	0.0
297735482		602	unnamed protein product [Vitis vinifera]	0.996	0.897	0.837	0.0
356502780		601	PREDICTED: guanylate-binding protein 4-l	0.992	0.895	0.827	0.0
356536546		601	PREDICTED: guanylate-binding protein 4-l	0.992	0.895	0.824	0.0
449458450		626	PREDICTED: guanylate-binding protein 4-l	0.996	0.862	0.805	0.0
449503820		619	PREDICTED: guanylate-binding protein 4-l	0.996	0.872	0.805	0.0
334184802		602	guanylate-binding-like protein [Arabidop	0.996	0.897	0.798	0.0
224082718		663	predicted protein [Populus trichocarpa]	0.996	0.814	0.750	0.0
357440529		596	Guanylate-binding protein [Medicago trun	0.994	0.904	0.775	0.0

>gi\|255559907\|ref\|XP_002520972.1\| interferon-induced guanylate-binding protein, putative [Ricinus communis] gi\|223539809\|gb\|EEF41389.1\| interferon-induced guanylate-binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/569 (80%), Positives = 509/569 (89%), Gaps = 29/569 (5%)

Query: 3   IQVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFY 62
           + VIGPYRSGKSFLLNQLLSLSC EGFGVGHMRDTKTKGIWVWG PVE++I+G +TSVFY
Sbjct: 63  VAVIGPYRSGKSFLLNQLLSLSCYEGFGVGHMRDTKTKGIWVWGTPVELDINGVKTSVFY 122

Query: 63  LDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGR- 121
           LDTEGFES+GKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGR 
Sbjct: 123 LDTEGFESVGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRS 182

Query: 122 ----------------------------VKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVH 153
                                       VKGQDVAFEPAKL+WLIQRDFLQGKSVQ+MV+
Sbjct: 183 ALLLCSEFSRVSLLLFYGLADNYIMENRVKGQDVAFEPAKLLWLIQRDFLQGKSVQQMVN 242

Query: 154 DALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYV 213
           +ALQRVPN  GD+NID VNQIR SLAIMGDNSTAFSLPQPHL RTKLCDMKD ELD +YV
Sbjct: 243 EALQRVPNKDGDRNIDQVNQIRESLAIMGDNSTAFSLPQPHLQRTKLCDMKDGELDSVYV 302

Query: 214 KRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGIL 273
           +RREQLK++VAS+ RPKIVQGK LNG EFVAF+EQILEALNKGEIPSTGSLVEVFNKGIL
Sbjct: 303 QRREQLKEVVASIIRPKIVQGKTLNGEEFVAFLEQILEALNKGEIPSTGSLVEVFNKGIL 362

Query: 274 ERCLKLYNERMAKVRLPLPEQSLQDAHERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQ 333
           ERCLKLY E MAK+ LPLPEQSLQDAHERS++EAM  FD QHFGR HAK+SVMQLDEEI+
Sbjct: 363 ERCLKLYGESMAKLGLPLPEQSLQDAHERSREEAMKAFDEQHFGRHHAKRSVMQLDEEIE 422

Query: 334 EAYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVG 393
           + +KN+I+ANEY+S+K+CE+LYTRCED+MDQLQVLRLPSMAKFNAGFLQCN+SF  ECVG
Sbjct: 423 KVHKNIILANEYKSAKLCEALYTRCEDRMDQLQVLRLPSMAKFNAGFLQCNRSFELECVG 482

Query: 394 PSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVL 453
           PSKANYEQRM+KM+GKS+SLFIKEYNHRLFNWLVAFSLVMVVVGRFI+KFI+IE+GAW+L
Sbjct: 483 PSKANYEQRMVKMMGKSKSLFIKEYNHRLFNWLVAFSLVMVVVGRFIIKFILIEIGAWIL 542

Query: 454 FIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWR 513
           FIFLETYTRMFWSAESLYYNPVWHFIV+TWETLVYSP+LDLDRWAVP+G + AV V+YWR
Sbjct: 543 FIFLETYTRMFWSAESLYYNPVWHFIVATWETLVYSPILDLDRWAVPIGFVAAVLVIYWR 602

Query: 514 CCGKRKYGSRGLLPLYNNHKGGTNRPRTD 542
           C G+RK+GS+ LLPLY+N KGG NRPR+D
Sbjct: 603 CYGRRKHGSQWLLPLYSNQKGGPNRPRSD 631

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225437197\|ref\|XP_002275124.1\| PREDICTED: guanylate-binding protein 4-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297735482\|emb\|CBI17922.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356502780\|ref\|XP_003520194.1\| PREDICTED: guanylate-binding protein 4-like [Glycine max]	Back alignment and taxonomy information

>gi\|356536546\|ref\|XP_003536798.1\| PREDICTED: guanylate-binding protein 4-like [Glycine max]	Back alignment and taxonomy information

>gi\|449458450\|ref\|XP_004146960.1\| PREDICTED: guanylate-binding protein 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449503820\|ref\|XP_004162193.1\| PREDICTED: guanylate-binding protein 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|334184802\|ref\|NP_181418.3\| guanylate-binding-like protein [Arabidopsis thaliana] gi\|330254499\|gb\|AEC09593.1\| guanylate-binding-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|224082718\|ref\|XP_002306811.1\| predicted protein [Populus trichocarpa] gi\|222856260\|gb\|EEE93807.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357440529\|ref\|XP_003590542.1\| Guanylate-binding protein [Medicago truncatula] gi\|355479590\|gb\|AES60793.1\| Guanylate-binding protein [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		542
TAIR\|locus:2161358		1082	AT5G46070 [Arabidopsis thalian	0.647	0.324	0.276	3.6e-28
ZFIN\|ZDB-GENE-070912-176		965	gbp3 "guanylate binding protei	0.610	0.343	0.279	2.7e-23
ZFIN\|ZDB-GENE-041210-233		618	si:dkey-61p9.3 "si:dkey-61p9.3	0.647	0.567	0.260	5.2e-20
UNIPROTKB\|F1N9J3		623	GBP7 "Uncharacterized protein"	0.634	0.552	0.258	1.1e-19
RGD\|1583235		625	LOC685067 "similar to guanylat	0.630	0.547	0.256	1.5e-19
UNIPROTKB\|I3LE01		591	LOC100737841 "Uncharacterized	0.618	0.566	0.274	7.8e-19
DICTYBASE\|DDB_G0281639		796	DDB_G0281639 "guanylate-bindin	0.503	0.342	0.290	1.1e-18
UNIPROTKB\|F1NWK6		470	LOC415922 "Uncharacterized pro	0.210	0.242	0.336	3.2e-18
WB\|WBGene00012763		520	Y41E3.3 [Caenorhabditis elegan	0.627	0.653	0.253	7.2e-18
UNIPROTKB\|G3X842		612	GBP4 "Uncharacterized protein"	0.457	0.405	0.292	8.5e-18

TAIR\|locus:2161358 AT5G46070 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 344 (126.2 bits), Expect = 3.6e-28, P = 3.6e-28
 Identities = 106/384 (27%), Positives = 186/384 (48%)

Query:     3 IQVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEME-IDGSRTSVF 61
             + V G  R GKSF+LNQLL  S   GF V       TKG+W+W +P++   +DG+  ++ 
Sbjct:    73 VSVCGRARQGKSFILNQLLGRS--NGFQVASTHKPCTKGLWLWSSPIKRTALDGTEYNLL 130

Query:    62 YLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGR 121
              LD+EG ++  ++  Y  +IF+LA ++SS+ +YN    I EA + RLS   ++ +    +
Sbjct:   131 LLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFVYNQMGGIDEASLDRLSLVTQMTKHIRVK 190

Query:   122 VKGQDVA------FEPAKLVWLIQRDFL-----QGKSV--QEMVHDALQRVPNDKGDKNI 168
               G   +      F P   VWL+ RDF        + +  ++ +  AL+ V    GD  I
Sbjct:   191 ASGGTSSRSELGQFSPI-FVWLL-RDFYLDLVEDNRKISPRDYLEIALRPVQGSGGD--I 246

Query:   169 DMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKD----EELDPIYVKRREQLKKLVA 224
                N+IR+S+  +  +   F+L +P L   K     D    E+L P +    +   K V 
Sbjct:   247 GAKNEIRDSIRALFPDRECFTLVRP-LNNEKDLQRLDQISLEKLRPEFGAGLDAFTKFVF 305

Query:   225 SVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIP----STGSLVEVFNKGILERCLKLY 280
               TRPK + G  + G   V   +  L+ALN G +P    S  S+ E   +   +  ++ Y
Sbjct:   306 EKTRPKQLGGTVMTGPILVGITQSYLDALNNGAVPTITSSWQSVEETECRRAYDSGVEAY 365

Query:   281 NERMAKVRLPLPEQSLQDAHERSKKEAMDVFDVQHFGRQHAKKSVMQL-DEEIQEAYKNV 339
                  + + P  E +L++ HE + ++A+ +F+    G   A+K    L  +++++ +++ 
Sbjct:   366 MAAFDQSKAP-EEGALREEHEEAVRKALAIFNSNAVGNGSARKKFEDLLHKDLKKKFEDY 424

Query:   340 IMANEYQSSKI-CESLYTRCEDKM 362
                N +  + + C S   R E ++
Sbjct:   425 -KKNAFMEADLRCTSTIQRMEKQL 447

GO:0003924 "GTPase activity" evidence=IEA;ISS

GO:0005525 "GTP binding" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISM

GO:0006955 "immune response" evidence=ISS

GO:0009507 "chloroplast" evidence=IDA

GO:0005730 "nucleolus" evidence=IDA

GO:0000226 "microtubule cytoskeleton organization" evidence=RCA

GO:0000911 "cytokinesis by cell plate formation" evidence=RCA

ZFIN\|ZDB-GENE-070912-176 gbp3 "guanylate binding protein 3" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-041210-233 si:dkey-61p9.3 "si:dkey-61p9.3" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N9J3 GBP7 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

RGD\|1583235 LOC685067 "similar to guanylate binding protein family, member 6" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LE01 LOC100737841 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0281639 DDB_G0281639 "guanylate-binding protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NWK6 LOC415922 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

WB\|WBGene00012763 Y41E3.3 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|G3X842 GBP4 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.5	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00023826001	SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (596 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		542
cd01851		224	cd01851, GBP, Guanylate-binding protein (GBP) fami	1e-49
pfam02263		264	pfam02263, GBP, Guanylate-binding protein, N-termi	5e-28
pfam02841		297	pfam02841, GBP_C, Guanylate-binding protein, C-ter	3e-06
pfam05879		743	pfam05879, RHD3, Root hair defective 3 GTP-binding	3e-04
cd00882		161	cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s	0.001

>gnl\|CDD\|206650 cd01851, GBP, Guanylate-binding protein (GBP) family (N-terminal domain)	Back alignment and domain information

 Score =  170 bits (433), Expect = 1e-49
 Identities = 74/225 (32%), Positives = 112/225 (49%), Gaps = 13/225 (5%)

Query: 3   IQVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFY 62
           + V G   SGKSFLLN L   S  +GF V       TKGIW+W +P +   DG + +V  
Sbjct: 10  VSVFGSQSSGKSFLLNHLFGTS--DGFDVMDTSQQTTKGIWMWSDPFKDT-DGKKHAVLL 66

Query: 63  LDTEGFESIGKS-NVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGR 121
           LDTEG +   +     D R+FALAT++SSVLIYN+ +TI   D+ +L   ++ A E  G 
Sbjct: 67  LDTEGTDGRERGEFENDARLFALATLLSSVLIYNMWQTILGDDLDKLMGLLKTALETLGL 126

Query: 122 VKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIM 181
               + +     L++++ RDF                   +K +  I+ +N+I +S+   
Sbjct: 127 AGLHNFSKPKPLLLFVV-RDFTGPTP-------LEGLDVTEKSETLIEELNKIWSSIRKP 178

Query: 182 GDNSTAFSLPQPHLLRTKLC-DMKDEELDPIYVKRREQLKKLVAS 225
               T F LP P LL   L  D + ++L P + K  + L++   S
Sbjct: 179 FTPITCFVLPHPGLLHKLLQNDGRLKDLPPEFRKALKALRQRFFS 223

Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons. The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins. They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase. In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins. The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein (GAP) cannot approach. Length = 224

>gnl\|CDD\|111185 pfam02263, GBP, Guanylate-binding protein, N-terminal domain	Back alignment and domain information

>gnl\|CDD\|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|218791 pfam05879, RHD3, Root hair defective 3 GTP-binding protein (RHD3)	Back alignment and domain information

>gnl\|CDD\|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		542
PF02263		260	GBP: Guanylate-binding protein, N-terminal domain;	100.0
cd01851		224	GBP Guanylate-binding protein (GBP), N-terminal do	100.0
PF05879		742	RHD3: Root hair defective 3 GTP-binding protein (R	100.0
KOG2037		552	consensus Guanylate-binding protein [General funct	100.0
KOG2203		772	consensus GTP-binding protein [General function pr	99.96
PF02841		297	GBP_C: Guanylate-binding protein, C-terminal domai	99.92
KOG2037		552	consensus Guanylate-binding protein [General funct	99.2
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	98.48
PF04548		212	AIG1: AIG1 family; InterPro: IPR006703 This entry	98.46
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	98.24
COG1159		298	Era GTPase [General function prediction only]	98.13
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	98.01
PRK00089		292	era GTPase Era; Reviewed	97.9
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	97.72
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	97.7
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	97.69
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	97.62
TIGR00991		313	3a0901s02IAP34 GTP-binding protein (Chloroplast En	97.58
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	97.55
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	97.5
TIGR00993		763	3a0901s04IAP86 chloroplast protein import componen	97.48
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	97.36
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	97.36
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	97.35
PF05049		376	IIGP: Interferon-inducible GTPase (IIGP); InterPro	97.34
cd01850		276	CDC_Septin CDC/Septin. Septins are a conserved fam	97.32
KOG1423		379	consensus Ras-like GTPase ERA [Cell cycle control,	97.22
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	97.17
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	97.13
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	97.12
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	97.12
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	97.12
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	97.08
KOG0448		749	consensus Mitofusin 1 GTPase, involved in mitochon	97.08
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	97.07
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	97.07
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	97.02
PRK15494		339	era GTPase Era; Provisional	97.0
KOG4181		491	consensus Uncharacterized conserved protein [Funct	96.99
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	96.98
PRK09563		287	rbgA GTPase YlqF; Reviewed	96.97
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	96.95
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	96.93
PRK12289		352	GTPase RsgA; Reviewed	96.92
PRK12288		347	GTPase RsgA; Reviewed	96.91
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	96.9
PRK11058		426	GTPase HflX; Provisional	96.88
COG5019		373	CDC3 Septin family protein [Cell division and chro	96.87
COG1084		346	Predicted GTPase [General function prediction only	96.86
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	96.83
PF00735		281	Septin: Septin; InterPro: IPR000038 Septins consti	96.83
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	96.82
COG3596		296	Predicted GTPase [General function prediction only	96.81
PF10220		895	DUF2146: Uncharacterized conserved protein (DUF214	96.81
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	96.8
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	96.79
PRK12298		390	obgE GTPase CgtA; Reviewed	96.75
PF00350		168	Dynamin_N: Dynamin family; InterPro: IPR001401 Mem	96.74
KOG1547		336	consensus Septin CDC10 and related P-loop GTPases	96.74
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	96.72
PRK00093		435	GTP-binding protein Der; Reviewed	96.72
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	96.72
cd00881		189	GTP_translation_factor GTP translation factor fami	96.69
PRK00098		298	GTPase RsgA; Reviewed	96.69
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	96.68
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	96.67
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	96.65
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	96.65
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	96.65
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	96.64
COG1160		444	Predicted GTPases [General function prediction onl	96.64
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	96.63
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	96.62
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	96.62
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	96.58
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	96.54
cd01896		233	DRG The developmentally regulated GTP-binding prot	96.54
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	96.54
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	96.5
PRK00093		435	GTP-binding protein Der; Reviewed	96.49
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	96.47
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	96.46
cd01881		176	Obg_like The Obg-like subfamily consists of five w	96.44
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	96.42
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	96.41
TIGR02836		492	spore_IV_A stage IV sporulation protein A. A compa	96.41
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	96.39
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	96.39
KOG2655		366	consensus Septin family protein (P-loop GTPase) [C	96.39
PRK04213		201	GTP-binding protein; Provisional	96.39
PRK03003		472	GTP-binding protein Der; Reviewed	96.38
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	96.38
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	96.36
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	96.35
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	96.33
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	96.33
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	96.29
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	96.23
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	96.22
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	96.22
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	96.22
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	96.2
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	96.2
PRK03003		472	GTP-binding protein Der; Reviewed	96.18
COG0486		454	ThdF Predicted GTPase [General function prediction	96.17
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	96.15
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	96.13
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	96.12
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	96.11
COG1161		322	Predicted GTPases [General function prediction onl	96.11
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	96.07
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	96.07
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	96.07
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	96.05
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	96.03
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	96.03
PTZ00258		390	GTP-binding protein; Provisional	96.01
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	96.0
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	95.99
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	95.99
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	95.98
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	95.96
PLN03118		211	Rab family protein; Provisional	95.96
smart00178		184	SAR Sar1p-like members of the Ras-family of small	95.92
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	95.92
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	95.9
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	95.89
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	95.89
cd01900		274	YchF YchF subfamily. YchF is a member of the Obg f	95.88
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	95.86
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	95.86
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	95.84
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	95.82
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	95.82
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	95.82
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	95.82
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	95.79
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	95.76
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	95.72
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	95.69
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	95.69
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	95.68
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	95.68
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	95.65
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	95.63
CHL00071		409	tufA elongation factor Tu	95.62
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	95.61
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	95.6
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	95.59
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	95.59
COG1162		301	Predicted GTPases [General function prediction onl	95.54
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	95.53
PLN03110		216	Rab GTPase; Provisional	95.52
PRK12299		335	obgE GTPase CgtA; Reviewed	95.51
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	95.51
PRK09601		364	GTP-binding protein YchF; Reviewed	95.49
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	95.48
PRK13796		365	GTPase YqeH; Provisional	95.48
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	95.48
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	95.44
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	95.43
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	95.37
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	95.31
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	95.31
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	95.3
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	95.24
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	95.24
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	95.22
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	95.21
COG1160		444	Predicted GTPases [General function prediction onl	95.17
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	95.15
PLN03108		210	Rab family protein; Provisional	95.14
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	95.12
CHL00189		742	infB translation initiation factor 2; Provisional	95.11
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	95.1
PRK12296		500	obgE GTPase CgtA; Reviewed	94.96
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	94.94
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	94.92
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	94.89
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	94.83
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	94.82
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	94.78
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	94.75
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	94.75
PRK12297		424	obgE GTPase CgtA; Reviewed	94.74
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	94.74
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	94.73
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	94.72
PRK04004		586	translation initiation factor IF-2; Validated	94.7
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	94.66
PRK12735		396	elongation factor Tu; Reviewed	94.61
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	94.59
KOG1191		531	consensus Mitochondrial GTPase [Translation, ribos	94.57
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	94.54
cd04105		203	SR_beta Signal recognition particle receptor, beta	94.51
KOG0410		410	consensus Predicted GTP binding protein [General f	94.46
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	94.46
PRK09866		741	hypothetical protein; Provisional	94.4
PRK00300		205	gmk guanylate kinase; Provisional	94.38
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	94.36
COG1100		219	GTPase SAR1 and related small G proteins [General	94.33
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	94.3
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	94.29
PRK12736		394	elongation factor Tu; Reviewed	94.27
PTZ00369		189	Ras-like protein; Provisional	94.26
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	94.25
PF00005		137	ABC_tran: ABC transporter This structure is on hol	94.24
COG2262		411	HflX GTPases [General function prediction only]	94.24
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	94.14
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	94.03
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	94.01
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	93.99
COG4136		213	ABC-type uncharacterized transport system, ATPase	93.96
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	93.94
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	93.92
PRK10218		607	GTP-binding protein; Provisional	93.92
TIGR00235		207	udk uridine kinase. Model contains a number of lon	93.9
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	93.89
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	93.89
PLN03127		447	Elongation factor Tu; Provisional	93.88
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	93.81
PRK09602		396	translation-associated GTPase; Reviewed	93.77
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	93.76
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	93.74
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	93.73
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	93.71
TIGR00176		155	mobB molybdopterin-guanine dinucleotide biosynthes	93.66
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	93.65
COG3172		187	NadR Predicted ATPase/kinase involved in NAD metab	93.61
COG1163		365	DRG Predicted GTPase [General function prediction	93.59
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	93.51
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	93.48
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	93.47
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	93.46
TIGR03522		301	GldA_ABC_ATP gliding motility-associated ABC trans	93.39
COG0218		200	Predicted GTPase [General function prediction only	93.38
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	93.36
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	93.35
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	93.34
cd03269		210	ABC_putative_ATPase This subfamily is involved in	93.34
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	93.33
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	93.31
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	93.31
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	93.3
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	93.27
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	93.23
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	93.2
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	93.2
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	93.19
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	93.18
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	93.18
PTZ00133		182	ADP-ribosylation factor; Provisional	93.17
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	93.16
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	93.15
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	93.13
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	93.13
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	93.04
PRK00049		396	elongation factor Tu; Reviewed	93.04
PRK01889		356	GTPase RsgA; Reviewed	93.03
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	93.03
cd03216		163	ABC_Carb_Monos_I This family represents the domain	93.03
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	93.01
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	93.01
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	93.0
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	93.0
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	93.0
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	92.99
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	92.98
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	92.98
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	92.97
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	92.97
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	92.97
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	92.96
PRK14737		186	gmk guanylate kinase; Provisional	92.94
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	92.92
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	92.92
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	92.88
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	92.86
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	92.86
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	92.86
KOG2485		335	consensus Conserved ATP/GTP binding protein [Gener	92.85
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	92.84
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	92.79
PF13555		62	AAA_29: P-loop containing region of AAA domain	92.79
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	92.78
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	92.78
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	92.76
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	92.76
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	92.76
KOG1954		532	consensus Endocytosis/signaling protein EHD1 [Sign	92.72
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	92.72
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	92.71
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	92.7
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	92.7
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	92.68
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	92.68
PRK14239		252	phosphate transporter ATP-binding protein; Provisi	92.67
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	92.67
PRK05480		209	uridine/cytidine kinase; Provisional	92.66
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	92.66
PRK10416		318	signal recognition particle-docking protein FtsY;	92.65
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	92.64
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	92.63
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	92.63
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	92.63
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	92.62
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	92.62
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	92.59
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	92.57
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	92.56
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	92.56
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	92.53
TIGR00485		394	EF-Tu translation elongation factor TU. This align	92.53
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	92.52
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	92.52
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	92.52
PRK14738		206	gmk guanylate kinase; Provisional	92.51
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	92.5
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	92.45
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	92.45
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	92.45
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	92.44
cd03253		236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	92.41
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	92.4
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	92.39
PRK14245		250	phosphate ABC transporter ATP-binding protein; Pro	92.39
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	92.39
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	92.39
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	92.38
cd03246		173	ABCC_Protease_Secretion This family represents the	92.37
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	92.37
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	92.36
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	92.36
cd03116		159	MobB Molybdenum is an essential trace element in t	92.36
PRK08233		182	hypothetical protein; Provisional	92.35
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	92.35
cd03251		234	ABCC_MsbA MsbA is an essential ABC transporter, cl	92.3
PRK05433		600	GTP-binding protein LepA; Provisional	92.28
TIGR03740		223	galliderm_ABC gallidermin-class lantibiotic protec	92.28
cd03215		182	ABC_Carb_Monos_II This family represents domain II	92.27
PLN03046		460	D-glycerate 3-kinase; Provisional	92.25
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	92.25
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	92.25
TIGR00503		527	prfC peptide chain release factor 3. This translat	92.24
TIGR00972		247	3a0107s01c2 phosphate ABC transporter, ATP-binding	92.24
PRK14267		253	phosphate ABC transporter ATP-binding protein; Pro	92.24
PLN03126		478	Elongation factor Tu; Provisional	92.23
PRK10908		222	cell division protein FtsE; Provisional	92.22
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	92.21
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	92.19
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	92.15
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	92.13
PRK14270		251	phosphate ABC transporter ATP-binding protein; Pro	92.12
PRK14240		250	phosphate transporter ATP-binding protein; Provisi	92.11
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	92.1
KOG3859		406	consensus Septins (P-loop GTPases) [Cell cycle con	92.09
TIGR03410		230	urea_trans_UrtE urea ABC transporter, ATP-binding	92.09
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	92.08
PRK12317		425	elongation factor 1-alpha; Reviewed	92.08
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	92.06
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	92.06
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	92.06
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	92.04
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	92.02
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	92.02
cd03298		211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	92.01
PRK13538		204	cytochrome c biogenesis protein CcmA; Provisional	91.99
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	91.98
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	91.98
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	91.97
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	91.95
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	91.94
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	91.94
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	91.93
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	91.93
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	91.92
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	91.92
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	91.92
cd03234		226	ABCG_White The White subfamily represents ABC tran	91.89
PRK14256		252	phosphate ABC transporter ATP-binding protein; Pro	91.88
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	91.88
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	91.87
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	91.87
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	91.86
PRK11231		255	fecE iron-dicitrate transporter ATP-binding subuni	91.85
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	91.84
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	91.84
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	91.83
PRK13351		687	elongation factor G; Reviewed	91.82
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	91.82
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	91.81
PRK11300		255	livG leucine/isoleucine/valine transporter ATP-bin	91.8
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	91.78
PRK13548		258	hmuV hemin importer ATP-binding subunit; Provision	91.78
PRK14251		251	phosphate ABC transporter ATP-binding protein; Pro	91.77
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	91.77
PRK14272		252	phosphate ABC transporter ATP-binding protein; Pro	91.77
PRK14255		252	phosphate ABC transporter ATP-binding protein; Pro	91.76
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	91.75
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	91.74
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	91.74
TIGR01277		213	thiQ thiamine ABC transporter, ATP-binding protein	91.73
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	91.72
PRK14259		269	phosphate ABC transporter ATP-binding protein; Pro	91.71
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	91.7
PRK11614		237	livF leucine/isoleucine/valine transporter ATP-bin	91.69
PRK14253		249	phosphate ABC transporter ATP-binding protein; Pro	91.69
PRK05306		787	infB translation initiation factor IF-2; Validated	91.67
CHL00131		252	ycf16 sulfate ABC transporter protein; Validated	91.66
PRK10771		232	thiQ thiamine transporter ATP-binding subunit; Pro	91.65
COG1127		263	Ttg2A ABC-type transport system involved in resist	91.64
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	91.63
PRK14249		251	phosphate ABC transporter ATP-binding protein; Pro	91.63
cd03252		237	ABCC_Hemolysin The ABC-transporter hemolysin B is	91.62
PRK09580		248	sufC cysteine desulfurase ATPase component; Review	91.62
PRK09493		240	glnQ glutamine ABC transporter ATP-binding protein	91.61
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	91.6
PRK13644		274	cbiO cobalt transporter ATP-binding subunit; Provi	91.58
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	91.58
TIGR03005		252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	91.57
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	91.57
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	91.57
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	91.54
PRK03695		248	vitamin B12-transporter ATPase; Provisional	91.52
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	91.51
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	91.5
PRK09984		262	phosphonate/organophosphate ester transporter subu	91.5
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	91.5
COG0410		237	LivF ABC-type branched-chain amino acid transport	91.49
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	91.47
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	91.46
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	91.44
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	91.41
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	91.4
TIGR01188		302	drrA daunorubicin resistance ABC transporter ATP-b	91.4
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	91.39
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	91.38
cd03290		218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	91.37
PRK14244		251	phosphate ABC transporter ATP-binding protein; Pro	91.36
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	91.35
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	91.35
COG4559		259	ABC-type hemin transport system, ATPase component	91.35
PRK13547		272	hmuV hemin importer ATP-binding subunit; Provision	91.33
PRK14266		250	phosphate ABC transporter ATP-binding protein; Pro	91.31
COG4598		256	HisP ABC-type histidine transport system, ATPase c	91.3
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	91.29
PLN00223		181	ADP-ribosylation factor; Provisional	91.28
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	91.28
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	91.27
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	91.25
cd03300		232	ABC_PotA_N PotA is an ABC-type transporter and the	91.22
TIGR03411		242	urea_trans_UrtD urea ABC transporter, ATP-binding	91.2
PRK13652		277	cbiO cobalt transporter ATP-binding subunit; Provi	91.17
PRK14265		274	phosphate ABC transporter ATP-binding protein; Pro	91.17
PRK00007		693	elongation factor G; Reviewed	91.12
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	91.11
TIGR01288		303	nodI ATP-binding ABC transporter family nodulation	91.11
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	91.11
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	91.1
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	91.1
PLN02796		347	D-glycerate 3-kinase	91.06
PRK00741		526	prfC peptide chain release factor 3; Provisional	91.05
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	91.04
TIGR02982		220	heterocyst_DevA ABC exporter ATP-binding subunit,	91.02
PRK14243		264	phosphate transporter ATP-binding protein; Provisi	90.97
PTZ00301		210	uridine kinase; Provisional	90.96
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	90.94
TIGR00490		720	aEF-2 translation elongation factor aEF-2. This mo	90.94
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	90.93
PRK10418		254	nikD nickel transporter ATP-binding protein NikD;	90.93
PRK14275		286	phosphate ABC transporter ATP-binding protein; Pro	90.92
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	90.9
PRK13546		264	teichoic acids export protein ATP-binding subunit;	90.89
PRK14271		276	phosphate ABC transporter ATP-binding protein; Pro	90.89
PRK14252		265	phosphate ABC transporter ATP-binding protein; Pro	90.87
smart00382		148	AAA ATPases associated with a variety of cellular	90.86
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	90.86
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	90.84
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	90.84
TIGR03873		256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	90.78
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	90.76
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	90.74
TIGR02173		171	cyt_kin_arch cytidylate kinase, putative. Proteins	90.73
PRK14260		259	phosphate ABC transporter ATP-binding protein; Pro	90.73
COG1101		263	PhnK ABC-type uncharacterized transport system, AT	90.7
PRK14258		261	phosphate ABC transporter ATP-binding protein; Pro	90.67
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	90.66
KOG0086		214	consensus GTPase Rab4, small G protein superfamily	90.65
PRK14246		257	phosphate ABC transporter ATP-binding protein; Pro	90.63
PRK14731		208	coaE dephospho-CoA kinase; Provisional	90.61
PRK14254		285	phosphate ABC transporter ATP-binding protein; Pro	90.59
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	90.56
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	90.55
cd03291		282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	90.52
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	90.48
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	90.48
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	90.39
cd03115		173	SRP The signal recognition particle (SRP) mediates	90.34
cd03288		257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	90.32
PRK11000		369	maltose/maltodextrin transporter ATP-binding prote	90.28

>PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma	Back alignment and domain information

Probab=100.00  E-value=1.2e-52  Score=423.87  Aligned_cols=223  Identities=38%  Similarity=0.633  Sum_probs=187.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHcCCCCCCeeeeecCcCccceEEeeecccccccCCCceeEEEeecCCcccccCcc-hhhh
Q 009154            1 MHIQVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSN-VYDD   79 (542)
Q Consensus         1 ~VVsV~G~~rtGKSfLLN~Llg~~~~~gF~vg~~~~~~TkGIWmW~~p~~~~~~g~~~~vlllDTEG~~~~e~~~-~~D~   79 (542)
                      .||||+|++|||||||||+|+|.  ..||+||+++++||+|||||++|.+   .+++++|++|||||++|+++++ .+|+
T Consensus        22 ~vvsi~G~~rtGKSfLln~l~~~--~~gF~~~~~~~~~T~Giw~w~~~~~---~~~~~~v~llDteG~~~~~~~~~~~d~   96 (260)
T PF02263_consen   22 AVVSIVGPYRTGKSFLLNQLLGP--QSGFSWGPTVEPCTKGIWMWSEPLP---DGEKVAVVLLDTEGLGDVEQSDEKYDA   96 (260)
T ss_dssp             EEEEEEEETTSSHHHHHHHHCCB--SSSSESSSCSSST-SCEEEECCE-T---TSTCEEEEEEEEECBTTTTCCCCHHCH
T ss_pred             EEEEeecCCccchHHHHHHHhcc--cccccccCCCCCCCcceeeeecccc---cccceeEEEecchhccccccCcccccH
Confidence            48999999999999999999986  5899999999999999999999944   3688999999999999976665 5789


Q ss_pred             HHHHHHHhhhccEEEcCCCCcchHhhhhHHHHHHHHHHHhcccc-----CCCCCCCCcceEEEEeecccc-----c--cc
Q 009154           80 RIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVK-----GQDVAFEPAKLVWLIQRDFLQ-----G--KS  147 (542)
Q Consensus        80 ~IFaLa~LLSS~lIYN~~g~I~e~al~~L~~v~el~~~i~~r~~-----~~~~~~~P~~flw~vvRDf~~-----g--~t  147 (542)
                      +||+|++||||++|||+++.|+++++++|+++++++++|..+..     .+...++| .|+|++ |||..     |  .|
T Consensus        97 ~if~Ls~LLSS~~IyN~~~~i~~~~l~~L~~~~~l~~~i~~~~~~~~~~~~~~~~fp-~l~wlv-RDf~~~~~~~~~~~t  174 (260)
T PF02263_consen   97 KIFALSMLLSSVLIYNSMGNIDEDDLDQLELFTELAKHIRVKYGDSADSEDLGKPFP-SLVWLV-RDFSLELEDDGGKIT  174 (260)
T ss_dssp             HHHHHHHHH-SEEEEEECSSSSHHHHHCCHHHHHHHHHHHHTHHHHHHHHCTTTTCE-EEEEEE-ECE-SCTCCTTECHH
T ss_pred             HHHHHHHHHhCceeeCCCCccchhHHHHHHHHHHHHHHHHHhcccccchhhhcccch-HHHHHH-hhccchhhhccCCCC
Confidence            99999999999999999999999999999999999999865421     12345678 499997 99973     2  37


Q ss_pred             hHHHHHHHhhcCCCCCCCcchhhhhhHHHHHhccCCCcceeccCCccccccc---cCCCCCCCCChHHHHHHHHHHHHhh
Q 009154          148 VQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTK---LCDMKDEELDPIYVKRREQLKKLVA  224 (542)
Q Consensus       148 ~~eyLe~~L~~~~~~~~~~~~~e~N~iR~~I~~~F~~~~cF~Lp~P~~~~~~---L~~l~~~~L~p~F~e~~~~L~~~i~  224 (542)
                      +++||+++|+...+.  ++.++++|++|++|++||++++||+||||+.+++.   +++++.++|+|+|++++++|+++|+
T Consensus       175 ~~eyLe~~L~~~~~~--~~~~~~~N~iR~~I~~~F~~~~cf~Lp~P~~~~~~l~~l~~l~~~~L~~eF~~~l~~l~~~i~  252 (260)
T PF02263_consen  175 PQEYLEQALKPESGQ--DEEIQERNKIRECIRSCFPSRDCFTLPHPGSDVDKLQNLDGLSLDDLDPEFVEQLDELVKYIF  252 (260)
T ss_dssp             HHHHHHHHCCSSTSS--SCCCCCHHHHHHHHHHHECCEEEEEEE-SSCCCCC-TCGCCCBGGGS-HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcccch--hHHHHHhhHHHHHHHHHCCCCeEEEecCCCchhhhccCcccCChhhCCHHHHHHHHHHHHHHh
Confidence            999999999876553  46678899999999999999999999999999866   4556779999999999999999999


Q ss_pred             hccCCccc
Q 009154          225 SVTRPKIV  232 (542)
Q Consensus       225 ~~~~pK~l  232 (542)
                      +..++|++
T Consensus       253 ~~~~~k~~  260 (260)
T PF02263_consen  253 SSAKVKTL  260 (260)
T ss_dssp             CCT---BE
T ss_pred             ccCCcccC
Confidence            98888763

GTPases induced by IFN-gamma are key to the protective immunity against microbial and viral pathogens. These GTPases are classified into three groups: the small 47-kd GTPases, the Mx proteins, and the large 65- to 67-kd GTPases. Guanylate-binding proteins (GBP) fall into the last class. In humans, there are seven GBPs (hGBP1-7) []. Structurally, hGBP1 consists of two domains: a compact globular N-terminal domain harbouring the GTPase function, and an alpha-helical finger-like C-terminal domain (IPR003191 from INTERPRO). Human GBP1 is secreted from cells without the need of a leader peptide, and has been shown to exhibit antiviral activity against Vesicular stomatitis virus and Encephalomyocarditis virus, as well as being able to regulate the inhibition of proliferation and invasion of endothelial cells in response to IFN-gamma [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3QOF_A 3Q5E_C 3QNU_A 3Q5D_A 1DG3_A 2D4H_A 2B8W_B 2B92_A 2BC9_A 1F5N_A.

>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain	Back alignment and domain information

>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins	Back alignment and domain information

>KOG2037 consensus Guanylate-binding protein [General function prediction only]	Back alignment and domain information

>KOG2203 consensus GTP-binding protein [General function prediction only]	Back alignment and domain information

>PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma	Back alignment and domain information

>KOG2037 consensus Guanylate-binding protein [General function prediction only]	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase)	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence	Back alignment and domain information

>cd01850 CDC_Septin CDC/Septin	Back alignment and domain information

>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>KOG4181 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF10220 DUF2146: Uncharacterized conserved protein (DUF2146); InterPro: IPR019354 Smg8 and Smg9 are two subunits of the Smg-1 complex	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another	Back alignment and domain information

>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>TIGR02836 spore_IV_A stage IV sporulation protein A	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>COG1161 Predicted GTPases [General function prediction only]	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>PTZ00258 GTP-binding protein; Provisional	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>cd01900 YchF YchF subfamily	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>PRK09601 GTP-binding protein YchF; Reviewed	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>KOG0410 consensus Predicted GTP binding protein [General function prediction only]	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism]	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>PRK01889 GTPase RsgA; Reviewed	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only]	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>PRK14239 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PLN03046 D-glycerate 3-kinase; Provisional	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14240 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>CHL00131 ycf16 sulfate ABC transporter protein; Validated	Back alignment and domain information

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E	Back alignment and domain information

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed	Back alignment and domain information

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>PRK03695 vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>cd03290 ABCC_SUR1_N The SUR domain 1	Back alignment and domain information

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D	Back alignment and domain information

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD	Back alignment and domain information

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>PLN02796 D-glycerate 3-kinase	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family	Back alignment and domain information

>PRK14243 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>TIGR00490 aEF-2 translation elongation factor aEF-2	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional	Back alignment and domain information

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02173 cyt_kin_arch cytidylate kinase, putative	Back alignment and domain information

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14731 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>cd03288 ABCC_SUR2 The SUR domain 2	Back alignment and domain information

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		542
1dg3_A		592	Structure Of Human Guanylate Binding Protein-1 In N		3e-21
4idq_A		447	Human Atlastin-1 1-446, N440t, Gdpalf4- Length = 44		6e-17
3q5e_A		447	Crystal Structure Of Human Atlastin-1 (Residues 1-4		7e-17
3qnu_A		459	Crystal Structure Of The Cytosolic Domain Of Human		8e-17
4idn_A		457	Human Atlastin-1 1-446, C-his6, Gppnhp Length = 457		8e-17
2b8w_A		328	Crystal-Structure Of The N-Terminal Large Gtpase Do		3e-15
4idp_A		447	Human Atlastin-1 1-446, N440t, Gppnhp Length = 447		6e-15
3q5d_A		447	Crystal Structure Of Human Atlastin-1 (Residues 1-4		7e-15

>pdb|1DG3|A Chain A, Structure Of Human Guanylate Binding Protein-1 In Nucleotide Free Form Length = 592