Citrus Sinensis ID: 009224

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540
MVSNQMAASTKIGIGTGIGTGTAPTHHHRVAMSTLSPLHPPLSHSNSIFLFNSTLSTRHRSLRVNSTSGPHHLPALRVRAASSVDALSSAEKSVENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAELHQEDVEFIDVKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKGLFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVNNNLLIEFHQPQAEEPKKDLTDRDVQEGFDITCTKHKGQYALRKLYHESPRLICVLYTSPTCGPCRTLKPILGKVIDEFDENVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMIRTVPGVKMKKEYREFIEANK
ccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccEEEEEEEEEEEcccccEEEEEccEEEEEcEEEEEccccccccccccccccccccEEEEEcccccccccccccEEEEcccHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHccccEEEEEccEEEEEEEcccccEEEEEEEEcccccEEEEEccEEEEEEccccccccccccccccccccEEEcccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHcccccEEEEEEEcccccccccHHHHHHHHHHHccccEEEEEEEccccHHHHHHcccccccEEEEEEcccccccccccccHHHHHHHHHHcc
cccccccccccEEEEEEEcccccccccHHHHHHHHHHccccccccccEEEEcccccEEEcEEEEccccccccHHHHHHHHccccccHHcccccccEEEEEcccHHHHHHHHHHHHcccccEEEccccEccEccHHHHHccEcccccccccccEHHHHHHHHHHHHHHcccEEEcccEEEEEcccccEEEEEcccEEEEEEEEEcccEEEcccccHHHHHcEcccEEccHHHHHccHHHEccEEEEEcccHHHHHHHHHHHHHEcEEEEEcccccccccHHHHHHHcccccEEEEccEEEEEEEEcccccEEEEEEEEcccccEEEEEccEEEEcccEEEccHHHcccccEcccccEcccccccEcccccEEEcHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHcccccccccccccccccccccccHHHcHcccHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHHHHHcEccEEEEEEEcccccccHHHHcccEEcEEEEEEccEEEEEEEccccHHHHHHHHHHHc
mvsnqmaastkigigtgigtgtapthhhrvamstlsplhpplshsnsiflfnstlstrhrslrvnstsgphhlpALRVRAASSVDALSSAEKSVENVVIIGSGPAGYTAAIYAARANLkpvvfegyqaggvpggqlmtttevenfpgfpdgitgpdLMDRMRRQAERWGaelhqedvefidvksnpftvksgerkvkchSIVFATgatakrlnlpredefwsrgisacaicdgasplfkgQVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQdrvfnnpnitvhfntetvdvvsntkgqmsgillrkvdtgeeSVLEAKGLfygighspnsqllqgqveldssgYVIVEEGTAKTSVEgvfaagdvqdhEWRQAVTAAGSGCIAALSVERYLVNNNlliefhqpqaeepkkdltdrdvqegfditctkhkGQYALRKLYHESPRLICVlytsptcgpcrtlkpiLGKVIDefdenvhfveidieedpeiaeaagimgtpcvqffknkemirtvpgvkmKKEYREFIEANK
MVSNQMAASTKIGIGTGIGTGTAPTHHHRVAMSTLSPLHPPLSHSNSIFLFNSTLSTRHRSLRVnstsgphhlpALRVRAASSVDALSSAEKSVENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAelhqedvefidvksnpftvksgerkvkchsivfatgatakrlnlpREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQdrvfnnpnitvhfntetvdvvsnTKGQMSGILLRKVDTGEESVLEAKGLFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVNNNLLIEFhqpqaeepkkdltDRDVQEGFDITCTKHKGQYALRKLYHESPRLICVLYTSPTCGPCRTLKPILGKVIDEFDENVHFVEIDIEEDPEIAEAAGIMGTPcvqffknkemirtvpgvkmkkeYREFIEANK
MVSNQMAASTKigigtgigtgtAPTHHHRVAMSTlsplhpplshsNSIFLFNSTLSTRHRSLRVNSTSGPHHLPALRVRAASSVDALSSAEKSVENVVIIGSGPagytaaiyaaraNLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAELHQEDVEFIDVKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKGLFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVNNNLLIEFHQPQAEEPKKDLTDRDVQEGFDITCTKHKGQYALRKLYHESPRLICVLYTSPTCGPCRTLKPILGKVIDEFDENVHFVeidieedpeiaeaaGIMGTPCVQFFKNKEMIRTVPGVKMKKEYREFIEANK
*************IGTGI*****************************IFLFN*****************************************VENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPDGIT*************RWGAELHQEDVEFIDVKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKGLFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVNNNLLIEFH***************VQEGFDITCTKHKGQYALRKLYHESPRLICVLYTSPTCGPCRTLKPILGKVIDEFDENVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMIRTVPGVKM************
*************IGTGIGTGTAPTHHHRV******************************************************************VVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAELHQEDVEFIDVKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKGLFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVNNN***************************ITCTKHKGQYALRKLYHESPRLICVLYTSPTCGPCRTLKPILGKVIDEFDENVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMIRTVPGVK*KKEY***I****
*********TKIGIGTGIGTGTAPTHHHRVAMSTLSPLHPPLSHSNSIFLFNSTLSTRHRSLRVNSTSGPHHLPALRVRA************SVENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAELHQEDVEFIDVKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKGLFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVNNNLLIEFHQPQAEEPKKDLTDRDVQEGFDITCTKHKGQYALRKLYHESPRLICVLYTSPTCGPCRTLKPILGKVIDEFDENVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMIRTVPGVKMKKEYREFIEANK
********STKIGIGTGIGTGTAPTHHHRVAMSTLSPLHPPLSHSNSIFLFNSTLSTRHRSLRVNSTSGPHHLPALRVRAAS*********KSVENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAELHQEDVEFIDVKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKGLFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVNNNLL**F*******************GFDITCTKHKGQYALRKLYHESPRLICVLYTSPTCGPCRTLKPILGKVIDEFDENVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMIRTVPGVKMKKEYREFIEANK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSNQMAASTKIGIGTGIGTGTAPTHHHRVAMSTLSPLHPPLSHSNSIFLFNSTLSTRHRSLRVNSTSGPHHLPALRVRAASSVDALSSAEKSVENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAELHQEDVEFIDVKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKGLFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVNNNLLIEFHQPQAEEPKKDLTDRDVQEGFDITCTKHKGQYALRKLYHESPRLICVLYTSPTCGPCRTLKPILGKVIDEFDENVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMIRTVPGVKMKKEYREFIEANK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query540 2.2.26 [Sep-21-2011]
O22229529 NADPH-dependent thioredox yes no 0.972 0.992 0.773 0.0
Q70G58515 Thioredoxin reductase NTR no no 0.831 0.871 0.857 0.0
P51978334 Thioredoxin reductase OS= N/A no 0.568 0.919 0.559 1e-100
Q9Z8M4311 Thioredoxin reductase OS= yes no 0.561 0.974 0.545 2e-96
Q54UU8319 Thioredoxin reductase OS= yes no 0.572 0.968 0.543 4e-96
P46843458 Bifunctional thioredoxin yes no 0.787 0.927 0.411 3e-92
O84101312 Thioredoxin reductase OS= no no 0.555 0.961 0.514 4e-92
Q39242383 Thioredoxin reductase 2 O no no 0.668 0.942 0.474 1e-91
Q9PKT7312 Thioredoxin reductase OS= yes no 0.551 0.955 0.501 1e-90
Q6FR39319 Thioredoxin reductase OS= yes no 0.566 0.959 0.515 3e-90
>sp|O22229|TRXB3_ARATH NADPH-dependent thioredoxin reductase 3 OS=Arabidopsis thaliana GN=NTRC PE=1 SV=2 Back     alignment and function desciption
 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/539 (77%), Positives = 468/539 (86%), Gaps = 14/539 (2%)

Query: 6   MAASTKIGIGTGIGTGTAPTHHHRVAMSTLSPLHPPLSHSNSIFLFNSTLSTRHR-SLRV 64
           MAAS KIGIG  I + ++P H    A S LSP  PP      +F   +T +TRH  S  +
Sbjct: 1   MAASPKIGIG--IASVSSP-HRVSAASSALSP--PP-----HLFFLTTTTTTRHGGSYLL 50

Query: 65  NSTSGPHHLPALRVRAASSVDALSSAEKS---VENVVIIGSGPAGYTAAIYAARANLKPV 121
              +      +LR+R +++ ++ SS+      +ENVVIIGSGPAGYTAAIYAARANLKPV
Sbjct: 51  RQPTRTRSSDSLRLRVSATANSPSSSSSGGEIIENVVIIGSGPAGYTAAIYAARANLKPV 110

Query: 122 VFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAELHQEDVEFID 181
           VFEGYQ GGVPGGQLMTTTEVENFPGFPDGITGPDLM++MR+QAERWGAEL+ EDVE + 
Sbjct: 111 VFEGYQMGGVPGGQLMTTTEVENFPGFPDGITGPDLMEKMRKQAERWGAELYPEDVESLS 170

Query: 182 VKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKGQ 241
           V + PFTV++ ERKVKCHSI++ATGATA+RL LPRE+EFWSRGISACAICDGASPLFKGQ
Sbjct: 171 VTTAPFTVQTSERKVKCHSIIYATGATARRLRLPREEEFWSRGISACAICDGASPLFKGQ 230

Query: 242 VLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVD 301
           VLAVVGGGDTATEEA+YLTK+ARHVHLLVRR+QLRAS+AMQDRV NNPNITVH+NTETVD
Sbjct: 231 VLAVVGGGDTATEEALYLTKYARHVHLLVRRDQLRASKAMQDRVINNPNITVHYNTETVD 290

Query: 302 VVSNTKGQMSGILLRKVDTGEESVLEAKGLFYGIGHSPNSQLLQGQVELDSSGYVIVEEG 361
           V+SNTKGQMSGILLR++DTGEE+ LEAKGLFYGIGHSPNSQLL+GQVELDSSGYV+V EG
Sbjct: 291 VLSNTKGQMSGILLRRLDTGEETELEAKGLFYGIGHSPNSQLLEGQVELDSSGYVLVREG 350

Query: 362 TAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVNNNLLIEFHQPQAEEPKK 421
           T+ TSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALS ERYL +NNLL+EFHQPQ EE KK
Sbjct: 351 TSNTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSAERYLTSNNLLVEFHQPQTEEAKK 410

Query: 422 DLTDRDVQEGFDITCTKHKGQYALRKLYHESPRLICVLYTSPTCGPCRTLKPILGKVIDE 481
           + T RDVQE FDIT TKHKGQYALRKLYHESPR+I VLYTSPTCGPCRTLKPIL KV+DE
Sbjct: 411 EFTQRDVQEKFDITLTKHKGQYALRKLYHESPRVILVLYTSPTCGPCRTLKPILNKVVDE 470

Query: 482 FDENVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMIRTVPGVKMKKEYREFIEANK 540
           ++ +VHFVEIDIEED EIAEAAGIMGTPCVQFFKNKEM+RT+ GVKMKKEYREFIEANK
Sbjct: 471 YNHDVHFVEIDIEEDQEIAEAAGIMGTPCVQFFKNKEMLRTISGVKMKKEYREFIEANK 529
Thioredoxin reductase (TR) that exhibits both TR and thioredoxin (Trx) activities. Contains a C-terminal functional Trx domain. Functions as an electron donor for plastidial 2-Cys peroxiredoxins and participates in a NADPH-dependent hydrogen peroxide scavenging system in chloroplasts in the dark. Required for chlorophyll biosynthesis and biogenesis of the photosynthetic apparatus. Activates aerobic cyclase which converts Mg-protoporhyrin monomethyl ester into protochlorophyllide. Involved in a light-dependent regulation of starch biosynthesis by redox activation of the ADP-glucose pyrophosphorylase (AGPase), a central enzyme of starch synthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 8EC: .EC: 1EC: .EC: 9
>sp|Q70G58|NTRC_ORYSJ Thioredoxin reductase NTRC OS=Oryza sativa subsp. japonica GN=Os07g0657900 PE=1 SV=2 Back     alignment and function description
>sp|P51978|TRXB_NEUCR Thioredoxin reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-9 PE=3 SV=1 Back     alignment and function description
>sp|Q9Z8M4|TRXB_CHLPN Thioredoxin reductase OS=Chlamydia pneumoniae GN=trxB PE=3 SV=1 Back     alignment and function description
>sp|Q54UU8|TRXB_DICDI Thioredoxin reductase OS=Dictyostelium discoideum GN=trrA PE=3 SV=1 Back     alignment and function description
>sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 Back     alignment and function description
>sp|O84101|TRXB_CHLTR Thioredoxin reductase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxB PE=3 SV=2 Back     alignment and function description
>sp|Q39242|TRXB2_ARATH Thioredoxin reductase 2 OS=Arabidopsis thaliana GN=NTR2 PE=2 SV=2 Back     alignment and function description
>sp|Q9PKT7|TRXB_CHLMU Thioredoxin reductase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxB PE=3 SV=1 Back     alignment and function description
>sp|Q6FR39|TRXB_CANGA Thioredoxin reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRR1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query540
225441864529 PREDICTED: NADPH-dependent thioredoxin r 0.970 0.990 0.807 0.0
297739640512 unnamed protein product [Vitis vinifera] 0.918 0.968 0.844 0.0
356534651519 PREDICTED: NADPH-dependent thioredoxin r 0.95 0.988 0.793 0.0
224090085462 predicted protein [Populus trichocarpa] 0.842 0.984 0.892 0.0
356500529522 PREDICTED: NADPH-dependent thioredoxin r 0.959 0.992 0.783 0.0
111550247514 NADP-thioredoxin reductase C [Medicago t 0.940 0.988 0.777 0.0
449463328523 PREDICTED: NADPH-dependent thioredoxin r 0.966 0.998 0.783 0.0
18405775529 NADPH-dependent thioredoxin reductase 3 0.972 0.992 0.773 0.0
15912233529 At2g41680/T32G6.20 [Arabidopsis thaliana 0.972 0.992 0.771 0.0
255577262504 disulfide oxidoreductase, putative [Rici 0.901 0.966 0.819 0.0
>gi|225441864|ref|XP_002278551.1| PREDICTED: NADPH-dependent thioredoxin reductase 3-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/540 (80%), Positives = 481/540 (89%), Gaps = 16/540 (2%)

Query: 6   MAASTKIGIGTGIGTGTAPTHHHRVAMSTLSPLHPPLSHSNSI-----FLFNSTLSTRHR 60
           MAA  KIG+G G  T        R AM+ ++P   P   SN++      +F  + S R R
Sbjct: 1   MAA--KIGLGLGSVT-------QRAAMAAVTPSPSPSPLSNALPPPHSVIFLKSWSARRR 51

Query: 61  SLRVNSTSGPHHLPALRVRAASSVDALSSAEKSVENVVIIGSGPAGYTAAIYAARANLKP 120
           SLR++S+       +LRV+A++S D+ +S+ K VENVVIIGSGPAGYTAAIYAARANLKP
Sbjct: 52  SLRLDSSRKSPF--SLRVKASTSSDSEASSAKGVENVVIIGSGPAGYTAAIYAARANLKP 109

Query: 121 VVFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAELHQEDVEFI 180
           VVFEGYQ GGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAEL QEDVEF+
Sbjct: 110 VVFEGYQVGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAELFQEDVEFL 169

Query: 181 DVKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKG 240
           DVK+ PFTV+S ERKVKC+S++FATGATAKRL LPREDEFWSRGISACAICDGASPLFKG
Sbjct: 170 DVKTTPFTVQSSERKVKCYSVIFATGATAKRLKLPREDEFWSRGISACAICDGASPLFKG 229

Query: 241 QVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETV 300
           QVLAVVGGGDTATEEA+YLTK+ARHVHLLVRR +LRAS+AMQDRV NNPNIT+HFNTE V
Sbjct: 230 QVLAVVGGGDTATEEALYLTKYARHVHLLVRRNELRASKAMQDRVHNNPNITLHFNTEAV 289

Query: 301 DVVSNTKGQMSGILLRKVDTGEESVLEAKGLFYGIGHSPNSQLLQGQVELDSSGYVIVEE 360
           D+VSN +GQMSGILLRKVDTGEESVLEAKGLFYGIGH+PNSQLL+GQVELDSSGYVIVEE
Sbjct: 290 DIVSNNRGQMSGILLRKVDTGEESVLEAKGLFYGIGHTPNSQLLKGQVELDSSGYVIVEE 349

Query: 361 GTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVNNNLLIEFHQPQAEEPK 420
           G+A+TSVEGVFAAGDVQDHEWRQAVTAAGSGC+AALSVERYLV NNLLIEFHQPQ EE K
Sbjct: 350 GSARTSVEGVFAAGDVQDHEWRQAVTAAGSGCVAALSVERYLVGNNLLIEFHQPQTEEVK 409

Query: 421 KDLTDRDVQEGFDITCTKHKGQYALRKLYHESPRLICVLYTSPTCGPCRTLKPILGKVID 480
           K+LTDRDV+EGFDIT TKH+GQY+LRKLYHESPRLICVLYT+PTCGPCRTLKPIL KVID
Sbjct: 410 KELTDRDVREGFDITLTKHRGQYSLRKLYHESPRLICVLYTAPTCGPCRTLKPILSKVID 469

Query: 481 EFDENVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMIRTVPGVKMKKEYREFIEANK 540
           EFD+NVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMI+T+ GVKMK EYREFIE+NK
Sbjct: 470 EFDQNVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMIKTLSGVKMKNEYREFIESNK 529

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297739640|emb|CBI29822.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356534651|ref|XP_003535866.1| PREDICTED: NADPH-dependent thioredoxin reductase 3-like [Glycine max] Back     alignment and taxonomy information
>gi|224090085|ref|XP_002308935.1| predicted protein [Populus trichocarpa] gi|222854911|gb|EEE92458.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356500529|ref|XP_003519084.1| PREDICTED: NADPH-dependent thioredoxin reductase 3-like [Glycine max] Back     alignment and taxonomy information
>gi|111550247|gb|ABH10139.1| NADP-thioredoxin reductase C [Medicago truncatula] Back     alignment and taxonomy information
>gi|449463328|ref|XP_004149386.1| PREDICTED: NADPH-dependent thioredoxin reductase 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18405775|ref|NP_565954.1| NADPH-dependent thioredoxin reductase 3 [Arabidopsis thaliana] gi|75097382|sp|O22229.2|TRXB3_ARATH RecName: Full=NADPH-dependent thioredoxin reductase 3; Short=NTR3; AltName: Full=NADPH-dependent thioredoxin reductase C; Short=ANTR-C; Short=AtNTRC; Flags: Precursor gi|20196949|gb|AAB84351.2| putative thioredoxin reductase [Arabidopsis thaliana] gi|330254921|gb|AEC10015.1| NADPH-dependent thioredoxin reductase 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15912233|gb|AAL08250.1| At2g41680/T32G6.20 [Arabidopsis thaliana] gi|23308231|gb|AAN18085.1| At2g41680/T32G6.20 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255577262|ref|XP_002529513.1| disulfide oxidoreductase, putative [Ricinus communis] gi|223531029|gb|EEF32882.1| disulfide oxidoreductase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query540
TAIR|locus:2062683529 NTRC "NADPH-dependent thioredo 0.912 0.931 0.758 4.4e-203
UNIPROTKB|Q70G58515 LOC_Os07g46410 "Thioredoxin re 0.892 0.935 0.758 5.6e-203
ASPGD|ASPL0000009801339 trxR [Emericella nidulans (tax 0.566 0.902 0.525 1.9e-83
DICTYBASE|DDB_G0280815319 trrA "thioredoxin reductase" [ 0.572 0.968 0.525 3.9e-83
TAIR|locus:2117612375 NTRB "NADPH-dependent thioredo 0.644 0.928 0.453 4.7e-80
SGD|S000002761319 TRR1 "Cytoplasmic thioredoxin 0.574 0.971 0.470 1.1e-76
SGD|S000001148342 TRR2 "Mitochondrial thioredoxi 0.564 0.891 0.475 6.3e-76
CGD|CAL0000375320 TRR1 [Candida albicans (taxid: 0.564 0.953 0.475 1e-75
UNIPROTKB|Q5AG89320 TRR1 "Thioredoxin reductase" [ 0.564 0.953 0.475 1e-75
POMBASE|SPBC3F6.03322 trr1 "thioredoxin reductase Tr 0.564 0.947 0.479 2.5e-72
TAIR|locus:2062683 NTRC "NADPH-dependent thioredoxin reductase C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1965 (696.8 bits), Expect = 4.4e-203, P = 4.4e-203
 Identities = 377/497 (75%), Positives = 420/497 (84%)

Query:    48 IFLFNSTLSTRHRS---LRVNSTSGPHHLPALRVRA-ASSVDALSSAEKSVENVVIIGSG 103
             +F   +T +TRH     LR  + +       LRV A A+S  + SS  + +ENVVIIGSG
Sbjct:    33 LFFLTTTTTTRHGGSYLLRQPTRTRSSDSLRLRVSATANSPSSSSSGGEIIENVVIIGSG 92

Query:   104 PXXXXXXXXXXXXNLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRR 163
             P            NLKPVVFEGYQ GGVPGGQLMTTTEVENFPGFPDGITGPDLM++MR+
Sbjct:    93 PAGYTAAIYAARANLKPVVFEGYQMGGVPGGQLMTTTEVENFPGFPDGITGPDLMEKMRK 152

Query:   164 QAERWGAELHQEDVEFIDVKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSR 223
             QAERWGAEL+ EDVE + V + PFTV++ ERKVKCHSI++ATGATA+RL LPRE+EFWSR
Sbjct:   153 QAERWGAELYPEDVESLSVTTAPFTVQTSERKVKCHSIIYATGATARRLRLPREEEFWSR 212

Query:   224 GISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQLRASRAMQD 283
             GISACAICDGASPLFKGQVLAVVGGGDTATEEA+YLTK+ARHVHLLVRR+QLRAS+AMQD
Sbjct:   213 GISACAICDGASPLFKGQVLAVVGGGDTATEEALYLTKYARHVHLLVRRDQLRASKAMQD 272

Query:   284 RVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKGLFYGIGHSPNSQL 343
             RV NNPNITVH+NTETVDV+SNTKGQMSGILLR++DTGEE+ LEAKGLFYGIGHSPNSQL
Sbjct:   273 RVINNPNITVHYNTETVDVLSNTKGQMSGILLRRLDTGEETELEAKGLFYGIGHSPNSQL 332

Query:   344 LQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLV 403
             L+GQVELDSSGYV+V EGT+ TSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALS ERYL 
Sbjct:   333 LEGQVELDSSGYVLVREGTSNTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSAERYLT 392

Query:   404 NNNLLIEFHQPQAEEPKKDLTDRDVQEGFDITCTKHKGQYALRKLYHESPRLICVLYTSP 463
             +NNLL+EFHQPQ EE KK+ T RDVQE FDIT TKHKGQYALRKLYHESPR+I VLYTSP
Sbjct:   393 SNNLLVEFHQPQTEEAKKEFTQRDVQEKFDITLTKHKGQYALRKLYHESPRVILVLYTSP 452

Query:   464 TCGPCRTLKPILGKVIDEFDENVHFVXXXXXXXXXXXXXXGIMGTPCVQFFKNKEMIRTV 523
             TCGPCRTLKPIL KV+DE++ +VHFV              GIMGTPCVQFFKNKEM+RT+
Sbjct:   453 TCGPCRTLKPILNKVVDEYNHDVHFVEIDIEEDQEIAEAAGIMGTPCVQFFKNKEMLRTI 512

Query:   524 PGVKMKKEYREFIEANK 540
              GVKMKKEYREFIEANK
Sbjct:   513 SGVKMKKEYREFIEANK 529
GO:0004791 "thioredoxin-disulfide reductase activity" evidence=IEA;ISS;IMP;IDA
GO:0005737 "cytoplasm" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0019430 "removal of superoxide radicals" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA;IDA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0008047 "enzyme activator activity" evidence=IDA
GO:0016671 "oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor" evidence=IDA
GO:0043085 "positive regulation of catalytic activity" evidence=IDA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA;IMP
GO:0010380 "regulation of chlorophyll biosynthetic process" evidence=IMP
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0010581 "regulation of starch biosynthetic process" evidence=IMP
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0016117 "carotenoid biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
UNIPROTKB|Q70G58 LOC_Os07g46410 "Thioredoxin reductase NTRC" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
ASPGD|ASPL0000009801 trxR [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280815 trrA "thioredoxin reductase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2117612 NTRB "NADPH-dependent thioredoxin reductase B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000002761 TRR1 "Cytoplasmic thioredoxin reductase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
SGD|S000001148 TRR2 "Mitochondrial thioredoxin reductase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0000375 TRR1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AG89 TRR1 "Thioredoxin reductase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
POMBASE|SPBC3F6.03 trr1 "thioredoxin reductase Trr1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q70G58NTRC_ORYSJ1, ., 8, ., 1, ., 90.85740.83140.8718nono
O22229TRXB3_ARATH1, ., 8, ., 1, ., 90.77360.97220.9924yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.8.1.90.979
3rd Layer1.8.10.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query540
TIGR01292299 TIGR01292, TRX_reduct, thioredoxin-disulfide reduc 1e-149
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 1e-123
PRK10262321 PRK10262, PRK10262, thioredoxin reductase; Provisi 3e-89
TIGR03143 555 TIGR03143, AhpF_homolog, putative alkyl hydroperox 6e-78
cd0294997 cd02949, TRX_NTR, TRX domain, novel NADPH thioredo 1e-64
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 2e-64
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase 8e-61
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, larg 4e-59
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase sub 6e-57
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 1e-23
cd0294793 cd02947, TRX_family, TRX family; composed of two g 1e-21
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 7e-20
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 5e-18
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homot 1e-17
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 2e-17
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 5e-17
TIGR04018316 TIGR04018, Bthiol_YpdA, putative bacillithiol syst 7e-17
TIGR01068101 TIGR01068, thioredoxin, thioredoxin 9e-16
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provi 1e-15
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 5e-15
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 2e-14
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 2e-14
TIGR02053463 TIGR02053, MerA, mercuric reductase 4e-14
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 6e-14
PRK098531019 PRK09853, PRK09853, putative selenate reductase su 2e-12
pfam00085104 pfam00085, Thioredoxin, Thioredoxin 3e-12
TIGR01317485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH 3e-12
PRK09381109 PRK09381, trxA, thioredoxin; Provisional 5e-12
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, Y 6e-12
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 1e-11
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polypr 2e-11
PRK12770352 PRK12770, PRK12770, putative glutamate synthase su 3e-11
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 7e-11
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 5e-10
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 7e-10
TIGR01318467 TIGR01318, gltD_gamma_fam, glutamate synthase smal 1e-09
cd02961101 cd02961, PDI_a_family, Protein Disulfide Isomerase 4e-09
pfam13738202 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulp 5e-09
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 6e-09
cd0298497 cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-int 6e-09
COG0526127 COG0526, TrxA, Thiol-disulfide isomerase and thior 7e-09
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reducta 1e-08
PRK13748561 PRK13748, PRK13748, putative mercuric reductase; P 2e-08
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 2e-08
PRK12775 1006 PRK12775, PRK12775, putative trifunctional 2-polyp 4e-08
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 7e-08
cd0165969 cd01659, TRX_superfamily, Thioredoxin (TRX) superf 7e-08
COG3118 304 COG3118, COG3118, Thioredoxin domain-containing pr 7e-08
PRK10996139 PRK10996, PRK10996, thioredoxin 2; Provisional 9e-08
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 2e-07
PRK12814652 PRK12814, PRK12814, putative NADPH-dependent gluta 2e-07
PLN02507499 PLN02507, PLN02507, glutathione reductase 3e-07
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase 6e-07
pfam0046260 pfam00462, Glutaredoxin, Glutaredoxin 6e-07
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisi 7e-07
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 1e-06
pfam13098105 pfam13098, Thioredoxin_2, Thioredoxin-like domain 2e-06
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 3e-06
PRK12779 944 PRK12779, PRK12779, putative bifunctional glutamat 4e-06
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 4e-06
TIGR0041182 TIGR00411, redox_disulf_1, small redox-active disu 6e-06
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase 7e-06
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 7e-06
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 8e-06
PRK12809639 PRK12809, PRK12809, putative oxidoreductase Fe-S b 8e-06
PRK07233434 PRK07233, PRK07233, hypothetical protein; Provisio 1e-05
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 1e-05
TIGR0219674 TIGR02196, GlrX_YruB, Glutaredoxin-like protein, Y 3e-05
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 3e-05
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 4e-05
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 5e-05
cd0297673 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is 6e-05
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase 6e-05
cd0297367 cd02973, TRX_GRX_like, Thioredoxin (TRX)-Glutaredo 6e-05
PTZ00102 477 PTZ00102, PTZ00102, disulphide isomerase; Provisio 7e-05
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 9e-05
PRK14727479 PRK14727, PRK14727, putative mercuric reductase; P 9e-05
PTZ0005198 PTZ00051, PTZ00051, thioredoxin; Provisional 1e-04
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 1e-04
cd0295696 cd02956, ybbN, ybbN protein family; ybbN is a hypo 2e-04
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 2e-04
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 3e-04
cd0206672 cd02066, GRX_family, Glutaredoxin (GRX) family; co 3e-04
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 3e-04
TIGR00292254 TIGR00292, TIGR00292, thiazole biosynthesis enzyme 3e-04
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD( 4e-04
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 5e-04
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 5e-04
pfam01946229 pfam01946, Thi4, Thi4 family 6e-04
TIGR01126102 TIGR01126, pdi_dom, protein disulfide-isomerase do 6e-04
cd02997104 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; 0.001
PRK07208479 PRK07208, PRK07208, hypothetical protein; Provisio 0.001
cd03000104 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; 0.001
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 0.001
cd02998105 cd02998, PDI_a_ERp38, PDIa family, endoplasmic ret 0.002
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 0.002
TIGR03997645 TIGR03997, mycofact_OYE_2, mycofactocin system Fad 0.002
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase f 0.002
PRK12843578 PRK12843, PRK12843, putative FAD-binding dehydroge 0.003
PRK12769654 PRK12769, PRK12769, putative oxidoreductase Fe-S b 0.004
PLN02546558 PLN02546, PLN02546, glutathione reductase 0.004
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 0.004
>gnl|CDD|233345 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information 
 Score =  429 bits (1105), Expect = e-149
 Identities = 166/307 (54%), Positives = 226/307 (73%), Gaps = 10/307 (3%)

Query: 97  VVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPD 156
           V+IIG+GPAG TAAIYAARANLKP++ EG    G PGGQL TTTEVEN+PGFP+GI+GP+
Sbjct: 2   VIIIGAGPAGLTAAIYAARANLKPLLIEG----GEPGGQLTTTTEVENYPGFPEGISGPE 57

Query: 157 LMDRMRRQAERWGAELHQEDVEFIDVKSNPFTVKSG-ERKVKCHSIVFATGATAKRLNLP 215
           LM++M+ QA ++GAE+  E+V  +D    PF V +G  ++    +++ ATGA+A++L +P
Sbjct: 58  LMEKMKEQAVKFGAEIIYEEVIKVDKSGRPFKVYTGDGKEYTAKAVIIATGASARKLGIP 117

Query: 216 REDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLVRREQL 275
            EDEFW RG+S CA CDG  P FK + +AVVGGGD+A EEA+YLT+ A+ V L+ RR++ 
Sbjct: 118 GEDEFWGRGVSYCATCDG--PFFKNKEVAVVGGGDSAIEEALYLTRIAKKVTLVHRRDKF 175

Query: 276 RASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKGLFYGI 335
           RA + + DR+  NP I   +N+   ++V + K  + G+ ++   TGEE  LE  G+F  I
Sbjct: 176 RAEKILLDRLKKNPKIEFLWNSTVKEIVGDNK--VEGVKIKNTVTGEEEELEVDGVFIAI 233

Query: 336 GHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAA 395
           GH PN++LL+G +ELD +GY++ +EG  +TSV GVFAAGDV+D  +RQAVTAAG GCIAA
Sbjct: 234 GHEPNTELLKGLLELDENGYIVTDEGM-RTSVPGVFAAGDVRDKGYRQAVTAAGDGCIAA 292

Query: 396 LSVERYL 402
           LS ERYL
Sbjct: 293 LSAERYL 299

This model describes thioredoxin-disulfide reductase, a member of the pyridine nucleotide-disulphide oxidoreductases (pfam00070) [Energy metabolism, Electron transport]. Length = 299
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182343 PRK10262, PRK10262, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|132187 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>gnl|CDD|239247 cd02949, TRX_NTR, TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|237942 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|226160 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234119 TIGR03140, AhpF, alkyl hydroperoxide reductase subunit F Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|188533 TIGR04018, Bthiol_YpdA, putative bacillithiol system oxidoreductase, YpdA family Back     alignment and domain information
>gnl|CDD|200072 TIGR01068, thioredoxin, thioredoxin Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|215704 pfam00085, Thioredoxin, Thioredoxin Back     alignment and domain information
>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|181812 PRK09381, trxA, thioredoxin; Provisional Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>gnl|CDD|222355 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|239282 cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>gnl|CDD|223600 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236112 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|238829 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>gnl|CDD|225660 COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182889 PRK10996, PRK10996, thioredoxin 2; Provisional Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|215281 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|235779 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|221921 pfam13098, Thioredoxin_2, Thioredoxin-like domain Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|129505 TIGR00411, redox_disulf_1, small redox-active disulfide protein 1 Back     alignment and domain information
>gnl|CDD|236106 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183762 PRK12809, PRK12809, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|131251 TIGR02196, GlrX_YruB, Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|239274 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|239271 cd02973, TRX_GRX_like, Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237806 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|173347 PTZ00051, PTZ00051, thioredoxin; Provisional Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|239254 cd02956, ybbN, ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|232901 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|145231 pfam01946, Thi4, Thi4 family Back     alignment and domain information
>gnl|CDD|200074 TIGR01126, pdi_dom, protein disulfide-isomerase domain Back     alignment and domain information
>gnl|CDD|239295 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|239298 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|239296 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|234436 TIGR03997, mycofact_OYE_2, mycofactocin system FadH/OYE family oxidoreductase 2 Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|237225 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 540
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 100.0
KOG0404322 consensus Thioredoxin reductase [Posttranslational 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 100.0
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 100.0
PRK12779 944 putative bifunctional glutamate synthase subunit b 100.0
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 100.0
PRK06370463 mercuric reductase; Validated 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
PRK06116450 glutathione reductase; Validated 100.0
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 100.0
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 100.0
PLN02546558 glutathione reductase 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
PLN02507499 glutathione reductase 100.0
PRK098531019 putative selenate reductase subunit YgfK; Provisio 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK12814652 putative NADPH-dependent glutamate synthase small 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 100.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 100.0
PRK14694468 putative mercuric reductase; Provisional 100.0
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 100.0
PTZ00058561 glutathione reductase; Provisional 100.0
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 100.0
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK14727479 putative mercuric reductase; Provisional 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 100.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK07846451 mycothione reductase; Reviewed 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PTZ00153659 lipoamide dehydrogenase; Provisional 100.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 100.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 100.0
PTZ00052499 thioredoxin reductase; Provisional 100.0
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 100.0
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PRK09564444 coenzyme A disulfide reductase; Reviewed 100.0
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 100.0
PRK12771564 putative glutamate synthase (NADPH) small subunit; 100.0
PRK13984604 putative oxidoreductase; Provisional 100.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 100.0
PRK12770352 putative glutamate synthase subunit beta; Provisio 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 100.0
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 100.0
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 100.0
PLN02852491 ferredoxin-NADP+ reductase 100.0
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 99.98
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.97
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.97
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 99.97
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.97
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.96
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.96
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.96
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.96
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.95
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.92
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 99.89
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.88
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.87
PTZ00188506 adrenodoxin reductase; Provisional 99.86
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.86
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.86
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 99.86
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.84
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.84
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.83
PHA02278103 thioredoxin-like protein 99.83
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 99.8
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 99.8
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.8
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 99.8
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.79
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.79
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 99.79
KOG0907106 consensus Thioredoxin [Posttranslational modificat 99.78
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 99.78
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.77
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.77
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 99.77
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 99.77
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.77
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 99.77
PRK09381109 trxA thioredoxin; Provisional 99.77
COG3118 304 Thioredoxin domain-containing protein [Posttransla 99.77
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 99.75
PRK10996139 thioredoxin 2; Provisional 99.75
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.74
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 99.74
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 99.73
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 99.73
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 99.72
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 99.71
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 99.71
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 99.71
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 99.71
KOG2755334 consensus Oxidoreductase [General function predict 99.7
PTZ00443224 Thioredoxin domain-containing protein; Provisional 99.7
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 99.69
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 99.69
cd02962152 TMX2 TMX2 family; composed of proteins similar to 99.69
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 99.69
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.69
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 99.68
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 99.67
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 99.67
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.66
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 99.65
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 99.65
PTZ0005198 thioredoxin; Provisional 99.64
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 99.63
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 99.63
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.62
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 99.62
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 99.61
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 99.59
KOG0908 288 consensus Thioredoxin-like protein [Posttranslatio 99.59
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 99.58
cd0294793 TRX_family TRX family; composed of two groups: Gro 99.56
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 99.54
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 99.51
PTZ00062 204 glutaredoxin; Provisional 99.5
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 99.49
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 99.48
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 99.48
PLN02309457 5'-adenylylsulfate reductase 99.48
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 99.47
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 99.47
COG2081408 Predicted flavoproteins [General function predicti 99.46
KOG0190 493 consensus Protein disulfide isomerase (prolyl 4-hy 99.46
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 99.45
KOG0912 375 consensus Thiol-disulfide isomerase and thioredoxi 99.41
PTZ00102477 disulphide isomerase; Provisional 99.41
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.41
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.4
PTZ00102 477 disulphide isomerase; Provisional 99.39
TIGR02187 215 GlrX_arch Glutaredoxin-like domain protein. This f 99.39
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 99.39
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 99.37
PHA0212575 thioredoxin-like protein 99.36
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.34
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 99.33
cd02955124 SSP411 TRX domain, SSP411 protein family; members 99.33
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 99.33
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 99.32
KOG4277 468 consensus Uncharacterized conserved protein, conta 99.31
PRK09897534 hypothetical protein; Provisional 99.29
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 99.25
PRK00293571 dipZ thiol:disulfide interchange protein precursor 99.24
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.24
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 99.24
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 99.22
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 99.21
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 99.21
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 99.2
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 99.2
TIGR02740271 TraF-like TraF-like protein. This protein is relat 99.2
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 99.19
PLN02697529 lycopene epsilon cyclase 99.19
cd02958114 UAS UAS family; UAS is a domain of unknown functio 99.18
PRK03147173 thiol-disulfide oxidoreductase; Provisional 99.18
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.16
PLN02463447 lycopene beta cyclase 99.1
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.1
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 99.09
PRK08275554 putative oxidoreductase; Provisional 99.09
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 99.08
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 99.08
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 99.07
PRK13728181 conjugal transfer protein TrbB; Provisional 99.07
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 99.06
PRK06847375 hypothetical protein; Provisional 99.04
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.03
PRK07804541 L-aspartate oxidase; Provisional 99.03
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.03
PRK10015429 oxidoreductase; Provisional 99.02
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.02
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 99.01
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.0
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.99
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 98.99
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.98
PRK10157428 putative oxidoreductase FixC; Provisional 98.98
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 98.97
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.97
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.97
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.96
smart00594122 UAS UAS domain. 98.96
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.96
PRK08071510 L-aspartate oxidase; Provisional 98.95
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.95
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 98.95
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.94
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.93
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 98.92
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.92
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 98.91
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 98.9
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.89
cd02967114 mauD Methylamine utilization (mau) D family; mauD 98.89
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.89
PRK06834488 hypothetical protein; Provisional 98.89
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.88
PRK12842574 putative succinate dehydrogenase; Reviewed 98.88
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.88
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 98.88
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.87
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.86
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 98.86
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.86
PRK06184502 hypothetical protein; Provisional 98.86
KOG1731 606 consensus FAD-dependent sulfhydryl oxidase/quiesci 98.85
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.84
PRK09077536 L-aspartate oxidase; Provisional 98.84
PRK07190487 hypothetical protein; Provisional 98.84
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.84
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.84
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.84
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.83
PRK08626657 fumarate reductase flavoprotein subunit; Provision 98.83
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.83
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.82
PTZ00056199 glutathione peroxidase; Provisional 98.82
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.81
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.8
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.8
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 98.8
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.8
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 98.8
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.79
PRK07512513 L-aspartate oxidase; Provisional 98.79
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.78
PRK08244493 hypothetical protein; Provisional 98.78
PRK13977576 myosin-cross-reactive antigen; Provisional 98.78
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.78
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.77
PLN02412167 probable glutathione peroxidase 98.77
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.77
PRK08013400 oxidoreductase; Provisional 98.77
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 98.76
PRK08401466 L-aspartate oxidase; Provisional 98.75
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.75
PRK09126392 hypothetical protein; Provisional 98.74
COG2143182 Thioredoxin-related protein [Posttranslational mod 98.74
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.74
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.74
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.74
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.74
PLN02661357 Putative thiazole synthesis 98.74
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 98.73
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 98.73
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.73
PRK08163396 salicylate hydroxylase; Provisional 98.73
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.72
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.72
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.72
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.72
COG4232569 Thiol:disulfide interchange protein [Posttranslati 98.71
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.7
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 98.7
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.69
PRK11445351 putative oxidoreductase; Provisional 98.69
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.69
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 98.69
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.68
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.68
PRK07588391 hypothetical protein; Provisional 98.68
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.67
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.67
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.67
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.65
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 98.65
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 98.65
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.64
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.64
PRK06126545 hypothetical protein; Provisional 98.63
PRK11728393 hydroxyglutarate oxidase; Provisional 98.63
PRK06996398 hypothetical protein; Provisional 98.63
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.63
PRK07045388 putative monooxygenase; Reviewed 98.63
TIGR02053463 MerA mercuric reductase. This model represents the 98.63
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 98.63
KOG0914265 consensus Thioredoxin-like protein [Posttranslatio 98.63
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.62
PRK05868372 hypothetical protein; Validated 98.62
PRK06753373 hypothetical protein; Provisional 98.62
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.61
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.6
PRK07236386 hypothetical protein; Provisional 98.6
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.6
KOG1672211 consensus ATP binding protein [Posttranslational m 98.6
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 98.6
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.59
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.58
PRK06370463 mercuric reductase; Validated 98.57
PRK14694468 putative mercuric reductase; Provisional 98.57
PRK06116450 glutathione reductase; Validated 98.57
PRK06185407 hypothetical protein; Provisional 98.56
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.56
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 98.56
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.56
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.55
PLN02507499 glutathione reductase 98.54
PRK07121492 hypothetical protein; Validated 98.54
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.53
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.53
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.52
PLN02985514 squalene monooxygenase 98.52
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.52
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.52
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.51
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.51
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 98.51
PRK08274466 tricarballylate dehydrogenase; Validated 98.51
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.51
PRK14727479 putative mercuric reductase; Provisional 98.5
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.5
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.5
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.5
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.49
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.49
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.49
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 98.48
PRK07846451 mycothione reductase; Reviewed 98.47
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 98.47
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.47
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.47
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.47
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.47
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.47
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.47
PRK06475400 salicylate hydroxylase; Provisional 98.46
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.46
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.45
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.45
PRK06175433 L-aspartate oxidase; Provisional 98.45
PRK13748561 putative mercuric reductase; Provisional 98.44
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.44
PF13728215 TraF: F plasmid transfer operon protein 98.44
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.44
PRK13512438 coenzyme A disulfide reductase; Provisional 98.43
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.43
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.43
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.42
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 98.42
PRK07538413 hypothetical protein; Provisional 98.41
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.4
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.4
PLN02815 594 L-aspartate oxidase 98.39
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.39
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.39
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.39
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.39
PTZ00256183 glutathione peroxidase; Provisional 98.38
PTZ00058561 glutathione reductase; Provisional 98.38
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 98.38
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.38
PTZ00052499 thioredoxin reductase; Provisional 98.37
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 98.37
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.37
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.36
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.36
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 98.34
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.34
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.33
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.32
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.32
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 98.31
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.31
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 98.31
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.3
KOG0913 248 consensus Thiol-disulfide isomerase and thioredoxi 98.28
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 98.28
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.27
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.26
COG1231450 Monoamine oxidase [Amino acid transport and metabo 98.25
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.25
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 98.25
KOG0911 227 consensus Glutaredoxin-related protein [Posttransl 98.25
PRK1120085 grxA glutaredoxin 1; Provisional 98.25
COG0579429 Predicted dehydrogenase [General function predicti 98.24
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.24
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 98.24
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 98.23
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 98.23
PLN02546558 glutathione reductase 98.23
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 98.23
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 98.23
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 98.21
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.2
PLN02464 627 glycerol-3-phosphate dehydrogenase 98.2
PTZ00153659 lipoamide dehydrogenase; Provisional 98.2
TIGR02739256 TraF type-F conjugative transfer system pilin asse 98.2
PRK08294 634 phenol 2-monooxygenase; Provisional 98.19
PTZ00367567 squalene epoxidase; Provisional 98.18
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 98.17
PRK07395553 L-aspartate oxidase; Provisional 98.17
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.17
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.15
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.15
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 98.14
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.14
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.12
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 98.12
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.1
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 98.1
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.1
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 98.1
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.09
PRK10606183 btuE putative glutathione peroxidase; Provisional 98.08
PRK12839 572 hypothetical protein; Provisional 98.08
PRK10877232 protein disulfide isomerase II DsbC; Provisional 98.07
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 98.06
PRK10262321 thioredoxin reductase; Provisional 98.06
PRK13703248 conjugal pilus assembly protein TraF; Provisional 98.06
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.04
COG3349485 Uncharacterized conserved protein [Function unknow 98.03
PLN02661357 Putative thiazole synthesis 98.02
PRK13190202 putative peroxiredoxin; Provisional 98.01
COG2907447 Predicted NAD/FAD-binding protein [General functio 98.0
PRK07208479 hypothetical protein; Provisional 97.99
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 97.99
KOG3414142 consensus Component of the U4/U6.U5 snRNP/mitosis 97.98
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.98
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 97.97
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.97
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 97.97
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.95
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 97.95
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 97.94
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 97.93
COG2081408 Predicted flavoproteins [General function predicti 97.93
PLN02268435 probable polyamine oxidase 97.93
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.93
PLN02576496 protoporphyrinogen oxidase 97.92
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 97.92
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 97.91
KOG3425128 consensus Uncharacterized conserved protein [Funct 97.91
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.91
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.9
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 97.88
PRK07233434 hypothetical protein; Provisional 97.88
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.88
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.86
PRK15000200 peroxidase; Provisional 97.86
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.83
PRK12416463 protoporphyrinogen oxidase; Provisional 97.82
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.82
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.82
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 97.81
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 97.8
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.79
PTZ00137261 2-Cys peroxiredoxin; Provisional 97.77
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 97.77
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.76
PLN02529 738 lysine-specific histone demethylase 1 97.76
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.76
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 97.75
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.75
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.75
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 97.74
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.73
PLN02568539 polyamine oxidase 97.72
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 97.72
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.71
PRK1032981 glutaredoxin-like protein; Provisional 97.71
PRK13599215 putative peroxiredoxin; Provisional 97.71
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.68
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 97.68
KOG2853509 consensus Possible oxidoreductase [General functio 97.67
PLN02172461 flavin-containing monooxygenase FMO GS-OX 97.66
PRK13189222 peroxiredoxin; Provisional 97.65
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.65
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.64
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.64
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 97.64
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.63
KOG1298509 consensus Squalene monooxygenase [Lipid transport 97.62
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information 
Probab=100.00  E-value=1.9e-48  Score=410.70  Aligned_cols=436  Identities=32%  Similarity=0.526  Sum_probs=339.8

Q ss_pred             CcccEEEECCCHHHHHHHHHHHHcCCceEEEcCCCCCCCCcceeeccCccccCCCCCCCCChHHHHHHHHHHHHHhCCEE
Q 009224           93 SVENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAEL  172 (540)
Q Consensus        93 ~~~~vvVIGgG~aGl~aA~~l~~~g~~v~lie~~~~~~~~gg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~  172 (540)
                      ..+||+|||||||||+||..|+++|++|+|||+..    .||.+.......++|++. ...+.++.+++.+.++++++++
T Consensus         3 ~~yDVvIIGgGpAGL~AA~~lar~g~~V~liE~~~----~GG~~~~~~~i~~~pg~~-~~~~~~l~~~l~~~~~~~gv~~   77 (555)
T TIGR03143         3 EIYDLIIIGGGPAGLSAGIYAGRAKLDTLIIEKDD----FGGQITITSEVVNYPGIL-NTTGPELMQEMRQQAQDFGVKF   77 (555)
T ss_pred             CcCcEEEECCCHHHHHHHHHHHHCCCCEEEEecCC----CCceEEeccccccCCCCc-CCCHHHHHHHHHHHHHHcCCEE
Confidence            45899999999999999999999999999999854    677777655555666653 3456788899999999999999


Q ss_pred             EEeeEEEEEeeCCcEEEEECCeEEEecEEEEccCCCCCCCCCCCcccccCCCeeeeeecCCCCCCCCCCEEEEEeCCccH
Q 009224          173 HQEDVEFIDVKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTA  252 (540)
Q Consensus       173 ~~~~v~~i~~~~~~~~v~~~~~~~~~d~lviAtG~~~~~~~ipg~~~~~~~~~~~~~~~~~~~~~~~~k~v~VvG~G~~a  252 (540)
                      +.++|+.++.+++.+.+......+.+++||+|||++|+.|++||.+.+...++.++..++..  ...+++|+|||+|++|
T Consensus        78 ~~~~V~~i~~~~~~~~V~~~~g~~~a~~lVlATGa~p~~~~ipG~~~~~~~~v~~~~~~~~~--~~~g~~VvVIGgG~~g  155 (555)
T TIGR03143        78 LQAEVLDVDFDGDIKTIKTARGDYKTLAVLIATGASPRKLGFPGEEEFTGRGVAYCATCDGE--FFTGMDVFVIGGGFAA  155 (555)
T ss_pred             eccEEEEEEecCCEEEEEecCCEEEEeEEEECCCCccCCCCCCCHHHhCCceEEEEeecChh--hcCCCEEEEECCCHHH
Confidence            88899999987766777765567899999999999999999999876666667666555442  3578999999999999


Q ss_pred             HHHHHHHHhcCCeEEEEEecccccccHHHHHHHhcCCCeEEEeCceEEEEeeCCCCceeeEEEEEccCCceEEE--EccE
Q 009224          253 TEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVL--EAKG  330 (540)
Q Consensus       253 ~e~a~~l~~~g~~v~li~~~~~~~~~~~~~~~~l~~~gv~~~~~~~v~~i~~~~~g~~~~v~~~~~~~g~~~~i--~~D~  330 (540)
                      +|+|..|++.|.+|+++.+.+.+.......+++++..||++++++.+.++..++  .+..+.+.+..+|+...+  ++|.
T Consensus       156 ~E~A~~L~~~g~~Vtli~~~~~~~~~~~~~~~~~~~~gV~i~~~~~V~~i~~~~--~v~~v~~~~~~~G~~~~~~~~~D~  233 (555)
T TIGR03143       156 AEEAVFLTRYASKVTVIVREPDFTCAKLIAEKVKNHPKIEVKFNTELKEATGDD--GLRYAKFVNNVTGEITEYKAPKDA  233 (555)
T ss_pred             HHHHHHHHccCCEEEEEEeCCccccCHHHHHHHHhCCCcEEEeCCEEEEEEcCC--cEEEEEEEECCCCCEEEEeccccc
Confidence            999999999999999999988765555666666667899999999999998643  344455555445554444  3776


Q ss_pred             ----EEEecccccCccccccceeccCCCCEEeCCCccccCCCceEEccccCCCcchhhhhhhchHHHHHHHHHHHHhcCc
Q 009224          331 ----LFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVNNN  406 (540)
Q Consensus       331 ----vi~a~G~~p~~~~~~~~~~~~~~g~i~vd~~~~~t~~~~iya~GD~~~~~~~~~~~A~~~g~~aa~~i~~~l~~~~  406 (540)
                          |++++|++|++.++..+++++++|+|.||+++ +|++|||||+|||+...++.+..|+.+|+.||.+|.++|.+..
T Consensus       234 ~~~~Vi~a~G~~Pn~~l~~~~l~l~~~G~I~vd~~~-~Ts~p~IyAaGDv~~~~~~~v~~A~~~G~~Aa~~i~~~l~~~~  312 (555)
T TIGR03143       234 GTFGVFVFVGYAPSSELFKGVVELDKRGYIPTNEDM-ETNVPGVYAAGDLRPKELRQVVTAVADGAIAATSAERYVKELK  312 (555)
T ss_pred             cceEEEEEeCCCCChhHHhhhcccCCCCeEEeCCcc-ccCCCCEEEceeccCCCcchheeHHhhHHHHHHHHHHHHHhhh
Confidence                99999999999998877888889999999998 8999999999999865457788999999999999999997654


Q ss_pred             ceeeecCCCccCCC-CcCCCCCCCCcc------eeeeeecCcHHHHHHHHHhCCCe-EEEEEECCCChhhhhhhHHHHHH
Q 009224          407 LLIEFHQPQAEEPK-KDLTDRDVQEGF------DITCTKHKGQYALRKLYHESPRL-ICVLYTSPTCGPCRTLKPILGKV  478 (540)
Q Consensus       407 ~~~~~~~~~~~~~~-v~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~-~~v~f~~~~C~~C~~~~~~~~~~  478 (540)
                      ...... |..+... -+..+.+..+.-      .-.+.+.+...+++..+.+-.++ .+..|+.+.|..|..+...++++
T Consensus       313 ~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~l~~~v~l~~~~~~~~~~~~e~~~~l~e~  391 (555)
T TIGR03143       313 EKLGIA-EEYEEEEAKEASEASAAETTPAATTKKGSLLDDSLRQQLVGIFGRLENPVTLLLFLDGSNEKSAELQSFLGEF  391 (555)
T ss_pred             hhcCCC-ccccccccccccccccccccccccccchhccCHHHHHHHHHHHHhcCCCEEEEEEECCCchhhHHHHHHHHHH
Confidence            422111 1111100 011111111100      01234444567777777776666 56678888999999999999999


Q ss_pred             HHHhCCCeEEEEEECcCCHHHHHHcCCCcccEEEEEe-CCeEE-EEeeCCCCHHHHHHHHHhhC
Q 009224          479 IDEFDENVHFVEIDIEEDPEIAEAAGIMGTPCVQFFK-NKEMI-RTVPGVKMKKEYREFIEANK  540 (540)
Q Consensus       479 ~~~~~~~~~~~~vd~~~~~~~~~~~~i~~~Pt~~~~~-~g~~~-~~~~g~~~~~~~~~~i~~~l  540 (540)
                      +... +++.+...|..++++++++|++...|++.+++ +|+.. .++.|...-.||..||..++
T Consensus       392 ~~~s-~~i~~~~~~~~~~~~~~~~~~v~~~P~~~i~~~~~~~~~i~f~g~P~G~Ef~s~i~~i~  454 (555)
T TIGR03143       392 ASLS-EKLNSEAVNRGEEPESETLPKITKLPTVALLDDDGNYTGLKFHGVPSGHELNSFILALY  454 (555)
T ss_pred             HhcC-CcEEEEEeccccchhhHhhcCCCcCCEEEEEeCCCcccceEEEecCccHhHHHHHHHHH
Confidence            8544 58999899999999999999999999999994 66544 68899999999999998653

This family of thioredoxin reductase homologs is found adjacent to alkylhydroperoxide reductase C subunit predominantly in cases where there is only one C subunit in the genome and that genome is lacking the F subunit partner (also a thioredcxin reductase homolog) that is usually found (TIGR03140).
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG3414 consensus Component of the U4/U6 Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>KOG3425 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query540
4a5l_A314 Crystal Structure Of The Thioredoxin Reductase From 7e-85
3d8x_A326 Crystal Structure Of Saccharomyces Cerevisiae Nadph 4e-84
3itj_A338 Crystal Structure Of Saccharomyces Cerevisiae Thior 6e-84
1vdc_A333 Structure Of Nadph Dependent Thioredoxin Reductase 1e-83
2whd_A351 Barley Nadph-Dependent Thioredoxin Reductase 2 Leng 1e-81
2a87_A335 Crystal Structure Of M. Tuberculosis Thioredoxin Re 3e-73
1cl0_A320 Crystal Structure Of Reduced Thioredoxin Reductase 8e-68
1tde_A316 Crystal Structure Of Escherichia Coli Thioredoxin R 9e-68
1trb_A320 Convergent Evolution Of Similar Function In Two Str 1e-66
1f6m_A320 Crystal Structure Of A Complex Between Thioredoxin 1e-66
1tdf_A316 Crystal Structure Of Escherichia Coli Thioredoxin R 1e-66
2q7v_A325 Crystal Structure Of Deinococcus Radiodurans Thiore 5e-60
4gcm_A312 Crystal Structure Of A Thioredoxine Reductase (Trxb 3e-52
2q0k_A311 Oxidized Thioredoxin Reductase From Helicobacter Py 3e-41
3f8p_A323 Structure Of Sulfolobus Solfataricus Trxr-B3 Length 6e-39
3f8d_A323 Structure Of Sulfolobus Solfataricus Thioredoxin Re 1e-37
3r9u_A315 Thioredoxin-Disulfide Reductase From Campylobacter 6e-37
1fl2_A310 Catalytic Core Component Of The Alkylhydroperoxide 3e-36
1hyu_A521 Crystal Structure Of Intact Ahpf Length = 521 1e-35
3cty_A319 Crystal Structure Of T. Acidophilum Thioredoxin Red 4e-29
3ab1_A360 Crystal Structure Of Ferredoxin Nadp+ Oxidoreductas 1e-11
3lzw_A332 Crystal Structure Of Ferredoxin-Nadp+ Oxidoreductas 1e-09
1mo9_A523 Nadph Dependent 2-Ketopropyl Coenzyme M Oxidoreduct 1e-07
3dyr_A111 Crystal Structure Of E. Coli Thioredoxin Mutant I76 3e-07
2zbw_A335 Crystal Structure Of Thioredoxin Reductase-Like Pro 4e-07
3dxb_A 222 Structure Of The Uhm Domain Of Puf60 Fused To Thior 5e-07
1m7t_A107 Solution Structure And Dynamics Of The Human-Escher 1e-06
1zzy_A108 Crystal Structure Of Thioredoxin Mutant L7v Length 1e-06
1xob_A108 Thioredoxin (Reduced Dithio Form), Nmr, 20 Structur 1e-06
2h76_A108 Crystal Structure Of Thioredoxin Mutant D10e In Hex 1e-06
2h75_A108 Crystal Structure Of Thioredoxin Mutant D13e In Hex 1e-06
2h70_A108 Crystal Structure Of Thioredoxin Mutant D9e In Hexa 1e-06
2h74_A108 Crystal Structure Of Thioredoxin Mutant D2e In Hexa 1e-06
2trx_A108 Crystal Structure Of Thioredoxin From Escherichia C 1e-06
2h73_A108 Crystal Structure Of Thioredoxin Mutant D43e In Hex 2e-06
2h6z_A108 Crystal Structure Of Thioredoxin Mutant E44d In Hex 2e-06
1ger_A450 The Structure Of Glutathione Reductase From Escheri 2e-06
2tir_A108 Crystal Structure Analysis Of A Mutant Escherichia 2e-06
2h72_A108 Crystal Structure Of Thioredoxin Mutant E85d In Hex 3e-06
2h6y_A108 Crystal Structure Of Thioredoxin Mutant E48d In Hex 3e-06
2h71_A108 Crystal Structure Of Thioredoxin Mutant D47e In Hex 4e-06
2eiq_A108 Design Of Disulfide-linked Thioredoxin Dimers And M 6e-06
2fch_A108 Crystal Structure Of Thioredoxin Mutant G74s Length 7e-06
1zk7_A467 Crystal Structure Of Tn501 Mera Length = 467 7e-06
2eio_A108 Design Of Disulfide-Linked Thioredoxin Dimers And M 1e-05
1keb_A108 Crystal Structure Of Double Mutant M37l,P40s E.Coli 2e-05
2o8v_B128 Paps Reductase In A Covalent Complex With Thioredox 2e-05
1f6m_C108 Crystal Structure Of A Complex Between Thioredoxin 2e-05
2fd3_A108 Crystal Structure Of Thioredoxin Mutant P34h Length 2e-05
1oaz_A123 Ige Fv Spe7 Complexed With A Recombinant Thioredoxi 2e-05
1tho_A109 Crystal Structure Of A Mutant Escherichia Coli Thio 3e-05
2eir_A108 Design Of Disulfide-Linked Thioredoxin Dimers And M 5e-05
2cvj_A180 Crystal Structure Of Thioredoxin Reductase-Related 1e-04
4fk1_A304 Crystal Structure Of Putative Thioredoxin Reductase 1e-04
1srx_A108 Three-Dimensional Structure Of Escherichia Coli Thi 2e-04
2gzy_A104 Solution Structures Of The Reduced Form Of Thioredo 3e-04
1txx_A108 Active-Site Variant Of E.Coli Thioredoxin Length = 4e-04
2yj7_A106 Crystal Structure Of A Hyperstable Protein From The 8e-04
>pdb|4A5L|A Chain A, Crystal Structure Of The Thioredoxin Reductase From Entamoeba Histolytica Length = 314 Back     alignment and structure 
Iteration: 1

 Score =  311 bits (796), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 155/312 (49%), Positives = 217/312 (69%), Gaps = 5/312 (1%)
Query: 93  SVENVVIIGSGPXXXXXXXXXXXXNLKPVVFEGYQAGGVP-GGQLMTTTEVENFPGFPDG 151
           ++ +VVIIGSGP            +LKPV++EG+ AGGV  GGQL TTT +ENFPGFP+G
Sbjct: 3   NIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNG 62
Query: 152 ITGPDLMDRMRRQAERWGAELHQEDVEFIDVKSNPFTVKSGE-RKVKCHSIVFATGATAK 210
           I G +LM  MR Q+E++G  +  E ++ +D  + PF + + E ++V   S++ ATGATAK
Sbjct: 63  IDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAK 122
Query: 211 RLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLV 270
           R+++P ED++W  G+SACAICDGA P+F+ +VL VVGGGD A EEA++LTK+   V +L 
Sbjct: 123 RMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILH 182
Query: 271 RREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKG 330
           RR+  RAS+ MQ+RV N+P I V +N+E V++  +    ++G  +  + +GE  V+   G
Sbjct: 183 RRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGD-LLNGAKIHNLVSGEYKVVPVAG 241
Query: 331 LFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGS 390
           LFY IGHSPNS+ L GQV+    GY++ E    KTSV+GVFA GDV D  +RQA+ AAGS
Sbjct: 242 LFYAIGHSPNSKFLGGQVKTADDGYILTE--GPKTSVDGVFACGDVCDRVYRQAIVAAGS 299
Query: 391 GCIAALSVERYL 402
           GC+AALS E++L
Sbjct: 300 GCMAALSCEKWL 311
>pdb|3D8X|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Nadph Dependent Thioredoxin Reductase 1 Length = 326 Back     alignment and structure
>pdb|3ITJ|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Thioredoxin Reductase 1 (trr1) Length = 338 Back     alignment and structure
>pdb|1VDC|A Chain A, Structure Of Nadph Dependent Thioredoxin Reductase Length = 333 Back     alignment and structure
>pdb|2WHD|A Chain A, Barley Nadph-Dependent Thioredoxin Reductase 2 Length = 351 Back     alignment and structure
>pdb|2A87|A Chain A, Crystal Structure Of M. Tuberculosis Thioredoxin Reductase Length = 335 Back     alignment and structure
>pdb|1CL0|A Chain A, Crystal Structure Of Reduced Thioredoxin Reductase From Escherichia Coli Length = 320 Back     alignment and structure
>pdb|1TDE|A Chain A, Crystal Structure Of Escherichia Coli Thioredoxin Reductase Refined At 2 Angstrom Resolution: Implications For A Large Conformational Change During Catalysis Length = 316 Back     alignment and structure
>pdb|1TRB|A Chain A, Convergent Evolution Of Similar Function In Two Structurally Divergent Enzymes Length = 320 Back     alignment and structure
>pdb|1F6M|A Chain A, Crystal Structure Of A Complex Between Thioredoxin Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+ Length = 320 Back     alignment and structure
>pdb|1TDF|A Chain A, Crystal Structure Of Escherichia Coli Thioredoxin Reductase Refined At 2 Angstrom Resolution: Implications For A Large Conformational Change During Catalysis Length = 316 Back     alignment and structure
>pdb|2Q7V|A Chain A, Crystal Structure Of Deinococcus Radiodurans Thioredoxin Reductase Length = 325 Back     alignment and structure
>pdb|4GCM|A Chain A, Crystal Structure Of A Thioredoxine Reductase (Trxb) From Staphylococcus Aureus Subsp. Aureus Mu50 At 1.80 A Resolution Length = 312 Back     alignment and structure
>pdb|2Q0K|A Chain A, Oxidized Thioredoxin Reductase From Helicobacter Pylori In Complex With Nadp+ Length = 311 Back     alignment and structure
>pdb|3F8P|A Chain A, Structure Of Sulfolobus Solfataricus Trxr-B3 Length = 323 Back     alignment and structure
>pdb|3F8D|A Chain A, Structure Of Sulfolobus Solfataricus Thioredoxin Reductase Mutant C147a Length = 323 Back     alignment and structure
>pdb|3R9U|A Chain A, Thioredoxin-Disulfide Reductase From Campylobacter Jejuni. Length = 315 Back     alignment and structure
>pdb|1FL2|A Chain A, Catalytic Core Component Of The Alkylhydroperoxide Reductase Ahpf From E.Coli Length = 310 Back     alignment and structure
>pdb|1HYU|A Chain A, Crystal Structure Of Intact Ahpf Length = 521 Back     alignment and structure
>pdb|3CTY|A Chain A, Crystal Structure Of T. Acidophilum Thioredoxin Reductase Length = 319 Back     alignment and structure
>pdb|3AB1|A Chain A, Crystal Structure Of Ferredoxin Nadp+ Oxidoreductase Length = 360 Back     alignment and structure
>pdb|3LZW|A Chain A, Crystal Structure Of Ferredoxin-Nadp+ Oxidoreductase From Bacillus Subtilis (Form I) Length = 332 Back     alignment and structure
>pdb|1MO9|A Chain A, Nadph Dependent 2-Ketopropyl Coenzyme M OxidoreductaseCARBOXYLASE Complexed With 2-Ketopropyl Coenzyme M Length = 523 Back     alignment and structure
>pdb|3DYR|A Chain A, Crystal Structure Of E. Coli Thioredoxin Mutant I76t In Its Oxidized Form Length = 111 Back     alignment and structure
>pdb|2ZBW|A Chain A, Crystal Structure Of Thioredoxin Reductase-Like Protein From Thermus Thermophilus Hb8 Length = 335 Back     alignment and structure
>pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin Length = 222 Back     alignment and structure
>pdb|1M7T|A Chain A, Solution Structure And Dynamics Of The Human-Escherichia Coli Thioredoxin Chimera: Insights Into Thermodynamic Stability Length = 107 Back     alignment and structure
>pdb|1ZZY|A Chain A, Crystal Structure Of Thioredoxin Mutant L7v Length = 108 Back     alignment and structure
>pdb|1XOB|A Chain A, Thioredoxin (Reduced Dithio Form), Nmr, 20 Structures Length = 108 Back     alignment and structure
>pdb|2H76|A Chain A, Crystal Structure Of Thioredoxin Mutant D10e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H75|A Chain A, Crystal Structure Of Thioredoxin Mutant D13e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H70|A Chain A, Crystal Structure Of Thioredoxin Mutant D9e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H74|A Chain A, Crystal Structure Of Thioredoxin Mutant D2e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2TRX|A Chain A, Crystal Structure Of Thioredoxin From Escherichia Coli At 1.68 Angstroms Resolution Length = 108 Back     alignment and structure
>pdb|2H73|A Chain A, Crystal Structure Of Thioredoxin Mutant D43e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H6Z|A Chain A, Crystal Structure Of Thioredoxin Mutant E44d In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|1GER|A Chain A, The Structure Of Glutathione Reductase From Escherichia Coli At 1.86 Angstroms Resolution: Comparison With The Enzyme From Human Erythrocytes Length = 450 Back     alignment and structure
>pdb|2TIR|A Chain A, Crystal Structure Analysis Of A Mutant Escherichia Coli Thioredoxin In Which Lysine 36 Is Replaced By Glutamic Acid Length = 108 Back     alignment and structure
>pdb|2H72|A Chain A, Crystal Structure Of Thioredoxin Mutant E85d In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H6Y|A Chain A, Crystal Structure Of Thioredoxin Mutant E48d In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H71|A Chain A, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2EIQ|A Chain A, Design Of Disulfide-linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 Back     alignment and structure
>pdb|2FCH|A Chain A, Crystal Structure Of Thioredoxin Mutant G74s Length = 108 Back     alignment and structure
>pdb|1ZK7|A Chain A, Crystal Structure Of Tn501 Mera Length = 467 Back     alignment and structure
>pdb|2EIO|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 Back     alignment and structure
>pdb|1KEB|A Chain A, Crystal Structure Of Double Mutant M37l,P40s E.Coli Thioredoxin Length = 108 Back     alignment and structure
>pdb|2O8V|B Chain B, Paps Reductase In A Covalent Complex With Thioredoxin C35a Length = 128 Back     alignment and structure
>pdb|1F6M|C Chain C, Crystal Structure Of A Complex Between Thioredoxin Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+ Length = 108 Back     alignment and structure
>pdb|2FD3|A Chain A, Crystal Structure Of Thioredoxin Mutant P34h Length = 108 Back     alignment and structure
>pdb|1OAZ|A Chain A, Ige Fv Spe7 Complexed With A Recombinant Thioredoxin Length = 123 Back     alignment and structure
>pdb|1THO|A Chain A, Crystal Structure Of A Mutant Escherichia Coli Thioredoxin With An Arginine Insertion In The Active Site Length = 109 Back     alignment and structure
>pdb|2EIR|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 Back     alignment and structure
>pdb|2CVJ|A Chain A, Crystal Structure Of Thioredoxin Reductase-Related Protein Ttha0370 From Thermus Thermophilus Hb8 Length = 180 Back     alignment and structure
>pdb|4FK1|A Chain A, Crystal Structure Of Putative Thioredoxin Reductase Trxb From Bacillus Anthracis Length = 304 Back     alignment and structure
>pdb|1SRX|A Chain A, Three-Dimensional Structure Of Escherichia Coli Thioredoxin-S2 To 2.8 Angstroms Resolution Length = 108 Back     alignment and structure
>pdb|2GZY|A Chain A, Solution Structures Of The Reduced Form Of Thioredoxin From Bacillus Subtilis Length = 104 Back     alignment and structure
>pdb|1TXX|A Chain A, Active-Site Variant Of E.Coli Thioredoxin Length = 108 Back     alignment and structure
>pdb|2YJ7|A Chain A, Crystal Structure Of A Hyperstable Protein From The Precambrian Period Length = 106 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query540
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 0.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 0.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 0.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 0.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 1e-178
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 1e-170
3r9u_A315 Thioredoxin reductase; structural genomics, center 1e-165
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 1e-163
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 1e-152
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 1e-148
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 1e-142
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 1e-102
4fk1_A304 Putative thioredoxin reductase; structural genomic 6e-91
2ywl_A180 Thioredoxin reductase related protein; uncharacter 1e-87
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 2e-67
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 5e-62
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 5e-56
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 2e-21
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 5e-20
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 3e-19
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 6e-19
4euy_A105 Uncharacterized protein; structural genomics, PSI- 8e-19
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 5e-18
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 1e-17
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 2e-17
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 2e-17
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 4e-17
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 8e-17
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 9e-17
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 9e-17
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 9e-17
4dna_A463 Probable glutathione reductase; structural genomic 1e-16
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2e-16
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 2e-16
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 2e-16
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 2e-16
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 2e-16
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 3e-16
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 3e-16
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 3e-16
2l5l_A136 Thioredoxin; structural genomics, electron transpo 4e-16
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 5e-16
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 7e-16
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 7e-16
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 9e-16
2yzu_A109 Thioredoxin; redox protein, electron transport, st 9e-16
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 1e-15
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 1e-15
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 1e-15
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 1e-15
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 1e-15
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 2e-15
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 2e-15
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 2e-15
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 2e-15
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 2e-15
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 2e-15
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 2e-15
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 2e-15
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 3e-15
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 3e-15
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 4e-15
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 4e-15
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 4e-15
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 5e-15
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 6e-15
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 6e-15
1wmj_A130 Thioredoxin H-type; structural genomics, program f 7e-15
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 9e-15
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 1e-14
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 1e-14
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 1e-14
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 1e-14
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 1e-14
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 1e-14
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 1e-14
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 1e-14
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 2e-14
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 2e-14
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 2e-14
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 2e-14
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 2e-14
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 2e-14
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 3e-14
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 3e-14
2l57_A126 Uncharacterized protein; structural genomics, unkn 5e-14
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 7e-14
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 8e-14
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 1e-13
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 1e-13
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 2e-13
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 3e-13
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 4e-13
1fec_A490 Trypanothione reductase; redox-active center, oxid 5e-13
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-12
2kuc_A130 Putative disulphide-isomerase; structural genomics 1e-12
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 3e-12
3dxb_A 222 Thioredoxin N-terminally fused to PUF60(UHM); spli 3e-12
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 5e-12
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 9e-12
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 1e-11
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 1e-11
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 1e-11
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 2e-11
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 2e-11
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 5e-11
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 6e-11
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 6e-11
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 7e-11
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 1e-10
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 2e-10
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 2e-10
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-10
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 7e-10
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-08
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-07
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 4e-10
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 4e-10
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 5e-10
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 5e-10
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 9e-08
1zma_A118 Bacterocin transport accessory protein; alpha-beta 1e-09
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 2e-09
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 2e-09
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 3e-09
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 3e-09
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 4e-09
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 7e-09
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 7e-09
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 8e-09
2qsi_A137 Putative hydrogenase expression/formation protein; 2e-08
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 6e-08
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 6e-08
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 6e-08
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 9e-08
3idv_A 241 Protein disulfide-isomerase A4; thioredoxin-like f 1e-07
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 2e-07
2ywm_A 229 Glutaredoxin-like protein; redox protein, structur 1e-07
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 2e-07
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 2e-07
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 3e-07
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 4e-07
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 5e-07
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 8e-05
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 6e-07
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 8e-07
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 8e-07
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 8e-07
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-06
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 1e-06
3atr_A453 Conserved archaeal protein; saturating double bond 1e-06
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 1e-06
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 1e-06
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 1e-06
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 1e-06
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 1e-06
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 3e-06
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 3e-06
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 3e-06
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 4e-06
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 6e-06
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 6e-06
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 7e-06
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 8e-06
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 3e-04
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 8e-06
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 8e-06
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 4e-05
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 1e-05
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 1e-05
1ojt_A482 Surface protein; redox-active center, glycolysis, 1e-05
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 1e-05
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 1e-05
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 1e-05
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 1e-05
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 1e-05
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 2e-05
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 2e-05
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 2e-05
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 2e-05
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 2e-05
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 3e-05
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 3e-05
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 3e-05
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 4e-05
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 5e-05
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 5e-05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 6e-05
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 6e-05
1mek_A120 Protein disulfide isomerase; electron transport, r 7e-05
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 7e-05
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 8e-05
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 8e-05
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 8e-05
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 8e-05
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 8e-05
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 8e-05
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 8e-05
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 1e-04
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 1e-04
2gqf_A401 Hypothetical protein HI0933; structural genomics, 1e-04
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 1e-04
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 1e-04
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 2e-04
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 2e-04
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 3e-04
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 3e-04
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 3e-04
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 3e-04
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 4e-04
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 5e-04
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 5e-04
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 6e-04
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 7e-04
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 7e-04
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 8e-04
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 8e-04
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Length = 333 Back     alignment and structure
 Score =  557 bits (1438), Expect = 0.0
 Identities = 161/337 (47%), Positives = 229/337 (67%), Gaps = 10/337 (2%)

Query: 87  LSSAEKSVENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGGV-PGGQLMTTTEVENF 145
           ++  E     + I+GSGPA +TAAIYAARA LKP++FEG+ A  + PGGQL TTT+VENF
Sbjct: 1   MNGLETHNTRLCIVGSGPAAHTAAIYAARAELKPLLFEGWMANDIAPGGQLTTTTDVENF 60

Query: 146 PGFPDGITGPDLMDRMRRQAERWGAELHQEDVEFIDVKSNPFTVKSGERKVKCHSIVFAT 205
           PGFP+GI G +L D+ R+Q+ER+G  +  E V  +D  S PF + +  + +   +++ A 
Sbjct: 61  PGFPEGILGVELTDKFRKQSERFGTTIFTETVTKVDFSSKPFKLFTDSKAILADAVILAI 120

Query: 206 GATAKRLNLPREDE----FWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTK 261
           GA AKRL+     E    FW+RGISACA+CDGA+P+F+ + LAV+GGGD+A EEA +LTK
Sbjct: 121 GAVAKRLSFVGSGEVLGGFWNRGISACAVCDGAAPIFRNKPLAVIGGGDSAMEEANFLTK 180

Query: 262 FARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQ-MSGILLRKVDT 320
           +   V+++ RR+  RAS+ MQ R  +NP I V +N+  V+   + +   + G+ ++ V T
Sbjct: 181 YGSKVYIIHRRDAFRASKIMQQRALSNPKIDVIWNSSVVEAYGDGERDVLGGLKVKNVVT 240

Query: 321 GEESVLEAKGLFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHE 380
           G+ S L+  GLF+ IGH P ++ L G VELDS GYV+ + GT +TSV GVFAAGDVQD +
Sbjct: 241 GDVSDLKVSGLFFAIGHEPATKFLDGGVELDSDGYVVTKPGTTQTSVPGVFAAGDVQDKK 300

Query: 381 WRQAVTAAGSGCIAALSVERYLVNNNLLIEFHQPQAE 417
           +RQA+TAAG+GC+AAL  E YL      I   + +++
Sbjct: 301 YRQAITAAGTGCMAALDAEHYLQE----IGSQEGKSD 333
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Length = 338 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Length = 335 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Length = 320 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Length = 325 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Length = 311 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Length = 315 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Length = 323 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Length = 310 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Length = 180 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Length = 105 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Length = 110 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Length = 106 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Length = 85 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Length = 140 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Length = 112 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Length = 128 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Length = 119 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} Length = 109 Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} Length = 111 Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Length = 109 Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Length = 112 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Length = 136 Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Length = 141 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Length = 104 Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Length = 106 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Length = 114 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Length = 109 Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Length = 104 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Length = 85 Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Length = 112 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Length = 108 Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Length = 105 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Length = 106 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Length = 107 Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Length = 105 Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Length = 128 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Length = 125 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Length = 112 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Length = 121 Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Length = 107 Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Length = 115 Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Length = 118 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Length = 121 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Length = 148 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Length = 122 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Length = 130 Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Length = 112 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Length = 135 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Length = 105 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Length = 113 Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Length = 140 Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Length = 153 Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Length = 142 Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Length = 116 Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Length = 139 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Length = 155 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Length = 118 Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Length = 107 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Length = 117 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Length = 226 Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Length = 123 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Length = 122 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Length = 133 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Length = 118 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Length = 137 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Length = 118 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Length = 75 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Length = 81 Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 135 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Length = 245 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 133 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A Length = 111 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 493 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Length = 130 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Length = 164 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Length = 243 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Length = 116 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Length = 123 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Length = 217 Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Length = 120 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Length = 103 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 140 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Length = 92 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134 Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Length = 100 Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} Length = 99 Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Length = 107 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Length = 85 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Length = 89 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query540
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
4fk1_A304 Putative thioredoxin reductase; structural genomic 100.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 100.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 100.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 100.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 100.0
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 100.0
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 100.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 100.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 100.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 100.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 100.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 100.0
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 100.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 100.0
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 100.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 100.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 100.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 100.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 100.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 100.0
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 100.0
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 100.0
4dna_A463 Probable glutathione reductase; structural genomic 100.0
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 100.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 100.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 100.0
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 100.0
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 100.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 100.0
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 100.0
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 100.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 100.0
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 100.0
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 100.0
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 100.0
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 100.0
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 100.0
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.98
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.98
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.98
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.97
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 99.97
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.97
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.97
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.97
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.97
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.97
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.96
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.96
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.95
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.94
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.94
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.87
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 99.87
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 99.87
2qsi_A137 Putative hydrogenase expression/formation protein; 99.86
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 99.84
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 99.8
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.8
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 99.8
4euy_A105 Uncharacterized protein; structural genomics, PSI- 99.8
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.79
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 99.79
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 99.79
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 99.78
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 99.78
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 99.78
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 99.78
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 99.78
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 99.78
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 99.78
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 99.78
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 99.78
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 99.78
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 99.77
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 99.77
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 99.77
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 99.77
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 99.77
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 99.77
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 99.77
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 99.77
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 99.76
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 99.76
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 99.76
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 99.76
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 99.76
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 99.76
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 99.76
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 99.75
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 99.75
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 99.75
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 99.75
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 99.75
2yzu_A109 Thioredoxin; redox protein, electron transport, st 99.75
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 99.74
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 99.74
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 99.74
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 99.74
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 99.74
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 99.74
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 99.73
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 99.73
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 99.73
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 99.73
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 99.73
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 99.73
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 99.72
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 99.72
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 99.72
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 99.72
2l5l_A136 Thioredoxin; structural genomics, electron transpo 99.72
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 99.72
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 99.72
3dxb_A 222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.71
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.71
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 99.71
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 99.71
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 99.71
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 99.71
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.71
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 99.69
2l57_A126 Uncharacterized protein; structural genomics, unkn 99.69
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 99.68
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 99.68
1zma_A118 Bacterocin transport accessory protein; alpha-beta 99.68
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.67
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 99.67
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 99.67
1mek_A120 Protein disulfide isomerase; electron transport, r 99.67
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.67
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 99.65
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 99.46
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 99.65
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 99.64
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 99.64
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 99.64
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 99.63
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 99.63
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 99.63
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 99.63
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 99.62
2cul_A232 Glucose-inhibited division protein A-related PROT 99.62
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 99.61
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.61
1wmj_A130 Thioredoxin H-type; structural genomics, program f 99.61
2kuc_A130 Putative disulphide-isomerase; structural genomics 99.6
3idv_A 241 Protein disulfide-isomerase A4; thioredoxin-like f 99.59
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.59
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 99.58
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 99.57
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 99.56
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 99.56
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 99.33
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 99.55
3f9u_A172 Putative exported cytochrome C biogenesis-related; 99.55
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 99.54
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 99.53
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 99.51
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 99.51
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 99.51
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 99.51
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.5
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.5
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 99.49
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 99.49
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 99.49
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 99.49
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 99.49
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 99.49
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 99.48
1ttz_A87 Conserved hypothetical protein; structural genomic 99.48
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 99.48
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 99.47
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 99.47
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 99.46
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 99.46
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 99.46
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 99.45
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.44
2c0g_A 248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 99.44
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.44
3ira_A173 Conserved protein; methanosarcina mazei,structural 99.44
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 99.43
2ywm_A 229 Glutaredoxin-like protein; redox protein, structur 99.43
3raz_A151 Thioredoxin-related protein; structural genomics, 99.42
1a8l_A 226 Protein disulfide oxidoreductase; PDI, thioredoxin 99.42
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.42
2qc7_A 240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 99.41
4evm_A138 Thioredoxin family protein; structural genomics, n 99.4
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 99.4
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 99.4
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 99.39
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 99.38
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 99.38
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 99.38
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 99.37
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 99.37
2lrn_A152 Thiol:disulfide interchange protein; structural ge 99.36
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 99.36
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 99.36
2l5o_A153 Putative thioredoxin; structural genomics, unknown 99.36
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 99.35
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 99.34
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 99.34
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 99.33
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 99.32
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 99.32
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 99.29
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 99.29
2lrt_A152 Uncharacterized protein; structural genomics, thio 99.29
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 99.28
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.27
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 99.27
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 99.25
2hls_A 243 Protein disulfide oxidoreductase; thioredoxin fold 99.25
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 99.24
2ywi_A196 Hypothetical conserved protein; uncharacterized co 99.23
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 99.22
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 99.22
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 99.22
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 99.21
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 99.21
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.21
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 99.19
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 99.19
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 99.18
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 99.17
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 99.15
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 99.14
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 99.14
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 99.13
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 99.13
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 99.13
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 99.11
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.1
2ls5_A159 Uncharacterized protein; structural genomics, unkn 98.69
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.09
3uem_A 361 Protein disulfide-isomerase; thioredoxin-like doma 99.09
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 99.07
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 98.64
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.05
2bry_A497 NEDD9 interacting protein with calponin homology a 99.04
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 99.04
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 99.04
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 99.03
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 99.02
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 99.02
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 99.02
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.02
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 99.01
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.01
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.01
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.01
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 99.0
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.0
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 98.99
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 98.99
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.98
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.98
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.97
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.97
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 98.97
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.95
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 98.95
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 98.94
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.93
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.93
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.92
3dme_A369 Conserved exported protein; structural genomics, P 98.92
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 98.9
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.9
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.9
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.9
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.89
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.89
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.88
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.87
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.87
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.86
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 98.86
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.85
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.85
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.85
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.84
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.84
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 98.84
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 98.84
2jsy_A167 Probable thiol peroxidase; solution structure, ant 98.83
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.83
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.82
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.82
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.82
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.82
3atr_A453 Conserved archaeal protein; saturating double bond 98.81
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 98.81
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 98.81
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 98.81
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 98.81
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 98.8
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.8
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.8
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.78
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 98.77
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.77
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.76
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 98.76
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 98.76
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.75
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.74
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 98.73
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.73
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 98.73
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.72
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.7
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 98.7
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.7
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 98.7
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.69
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 98.68
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.68
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 98.68
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.67
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.67
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.64
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.64
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.64
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.64
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.64
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.63
1kte_A105 Thioltransferase; redox-active center, electron tr 98.63
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.62
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 98.62
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.61
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 98.61
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.6
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.59
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.59
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.58
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.58
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.58
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 98.58
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.58
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.57
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 98.56
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.56
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.56
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.56
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.56
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.54
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.54
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 98.53
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.53
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.53
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.53
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.53
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.53
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.52
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 98.52
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.52
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.52
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 98.51
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 98.51
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.51
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 98.51
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.5
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 98.5
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.49
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.49
1psq_A163 Probable thiol peroxidase; structural genomics, NY 98.48
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 98.48
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.48
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.48
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.48
2bry_A497 NEDD9 interacting protein with calponin homology a 98.47
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 98.47
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.47
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.46
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.46
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.45
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 98.45
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 98.45
3me7_A170 Putative uncharacterized protein; electron transfe 98.45
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 98.44
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.44
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.44
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 98.44
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 98.43
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.43
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.43
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.43
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 98.42
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.41
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 98.41
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.4
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 98.4
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.39
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 98.38
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.37
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 98.37
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.37
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.37
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 98.36
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 98.35
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 98.35
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 98.35
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.34
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.34
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.34
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.34
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 98.34
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 98.34
4dna_A463 Probable glutathione reductase; structural genomic 98.33
1z6m_A175 Conserved hypothetical protein; structural genomic 98.31
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.3
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 98.3
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 98.29
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 98.28
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 98.28
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 98.28
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 98.27
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 98.27
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.27
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.26
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 98.24
2cul_A232 Glucose-inhibited division protein A-related PROT 98.24
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 98.24
4dvc_A184 Thiol:disulfide interchange protein DSBA; pilus as 98.23
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.21
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.2
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.2
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.2
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 98.2
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.19
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.19
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.19
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.19
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 98.18
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.17
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.17
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.16
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 98.16
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 98.15
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 98.15
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 98.15
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 98.15
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.14
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.13
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 98.11
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.11
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.11
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.1
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.1
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.1
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; 98.08
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 98.08
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.06
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.05
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.04
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.04
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-45  Score=364.60  Aligned_cols=310  Identities=52%  Similarity=0.923  Sum_probs=270.4

Q ss_pred             CCcccEEEECCCHHHHHHHHHHHHcCCceEEEcCCCCCC-CCcceeeccCccccCCCCCCCCChHHHHHHHHHHHHHhCC
Q 009224           92 KSVENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGG-VPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGA  170 (540)
Q Consensus        92 ~~~~~vvVIGgG~aGl~aA~~l~~~g~~v~lie~~~~~~-~~gg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v  170 (540)
                      +++|||+||||||||++||.+|+++|++|+|||+...++ .++|.+......+++|+++....+.++..++...++++++
T Consensus         2 ~~~yDvvIIG~GpAGl~AA~~la~~g~~v~liE~~~~gg~~~~G~~~~~~~i~~~~g~~~~i~~~~l~~~~~~~~~~~~~   81 (314)
T 4a5l_A            2 SNIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGT   81 (314)
T ss_dssp             CCCEEEEEECCSHHHHHHHHHHHHTTCCCEEECCSSGGGCCTTCGGGGSSEECCSTTCTTCEEHHHHHHHHHHHHHHTTC
T ss_pred             CCCCcEEEECCCHHHHHHHHHHHHCCCCEEEEecCCCCCcccCCCcCChHHhhhccCCcccCCHHHHHHHHHHHHhhcCc
Confidence            356999999999999999999999999999999976543 3566766666778889999888999999999999999999


Q ss_pred             EEEEeeEEEEEeeCCcEEEEE-CCeEEEecEEEEccCCCCCCCCCCCcccccCCCeeeeeecCCCCCCCCCCEEEEEeCC
Q 009224          171 ELHQEDVEFIDVKSNPFTVKS-GERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGG  249 (540)
Q Consensus       171 ~~~~~~v~~i~~~~~~~~v~~-~~~~~~~d~lviAtG~~~~~~~ipg~~~~~~~~~~~~~~~~~~~~~~~~k~v~VvG~G  249 (540)
                      ++...++.......+.+.+.. ++..+.||+||||||+.|+.|++||.+.++...+..+..+........+++++|||+|
T Consensus        82 ~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~liiATG~~~~~~~ipG~~~~~~~~~~~~~~~~~~~~~~~~~~vvViGgG  161 (314)
T 4a5l_A           82 TIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGG  161 (314)
T ss_dssp             EEECCCEEEEECSSSSEEEEETTCCEEEEEEEEECCCEEECCCCCTTHHHHBTTTEESCHHHHTTSGGGTTSEEEEECSS
T ss_pred             EEEEeEEEEeecCCCceEEEECCCeEEEEeEEEEcccccccccCCCccccccccceeeehhhhhhhhhcCCCeEEEECCC
Confidence            999988888888777776655 6678999999999999999999999988777777777776666666789999999999


Q ss_pred             ccHHHHHHHHHhcCCeEEEEEecccccccHHHHHHHhcCCCeEEEeCceEEEEeeCCCCceeeEEEEEccCCceEEEEcc
Q 009224          250 DTATEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAK  329 (540)
Q Consensus       250 ~~a~e~a~~l~~~g~~v~li~~~~~~~~~~~~~~~~l~~~gv~~~~~~~v~~i~~~~~g~~~~v~~~~~~~g~~~~i~~D  329 (540)
                      ++|+|+|..|+++|.+|++++|.+..........+.....++..+....+.++.... ....++.+.+...++++++++|
T Consensus       162 ~ig~e~A~~l~~~G~~Vt~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~-~~~~~~~~~~~~~~~~~~i~~d  240 (314)
T 4a5l_A          162 DAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDG-DLLNGAKIHNLVSGEYKVVPVA  240 (314)
T ss_dssp             HHHHHHHHHHTTTSSEEEEECSSSSCCSCHHHHHHHHTCTTEEEECSEEEEEEEESS-SSEEEEEEEETTTCCEEEEECS
T ss_pred             hHHHHHHHHHHHhCCeeeeecccccccccchhhhhhhcccceeeEeeeeeEEEEeee-eccceeEEeecccccceeeccc
Confidence            999999999999999999999988877777777777788899999999998887764 3456778887777888999999


Q ss_pred             EEEEecccccCccccccceeccCCCCEEeCCCccccCCCceEEccccCCCcchhhhhhhchHHHHHHHHHHHHhc
Q 009224          330 GLFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVN  404 (540)
Q Consensus       330 ~vi~a~G~~p~~~~~~~~~~~~~~g~i~vd~~~~~t~~~~iya~GD~~~~~~~~~~~A~~~g~~aa~~i~~~l~~  404 (540)
                      .|++++|++||+++++..+.++++|++ +|+++ +|+.|||||+|||++.+.+++..|+.+|+.||.++.+||+.
T Consensus       241 ~vi~a~G~~pn~~~l~~~~~~~~~G~i-v~~~~-~Ts~pgIyA~GDv~~~~~~~~~~A~~~G~~AA~~~~~yL~~  313 (314)
T 4a5l_A          241 GLFYAIGHSPNSKFLGGQVKTADDGYI-LTEGP-KTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQT  313 (314)
T ss_dssp             EEEECSCEEESCGGGTTSSCBCTTSCB-CCBTT-BCSSTTEEECSTTTCSSCCCHHHHHHHHHHHHHHHHHHHHT
T ss_pred             cceEecccccChhHhcccceEcCCeeE-eCCCC-ccCCCCEEEEEeccCCcchHHHHHHHHHHHHHHHHHHHHhc
Confidence            999999999999999888888888876 78777 99999999999999987788999999999999999999963
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 540
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 2e-33
d1vdca2130 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-e 2e-32
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 3e-32
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 9e-28
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 3e-30
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 5e-28
d1trba2126 c.3.1.5 (A:119-244) Thioredoxin reductase {Escheri 8e-29
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 4e-24
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 1e-16
d1fl2a2126 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase 8e-24
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 1e-18
d1djqa3233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 3e-16
d2es7a1119 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein H 1e-14
d1ps9a3179 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu 3e-13
d2hfda1132 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H 3e-12
d1nhoa_85 c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-lik 6e-12
d2trxa_108 c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId 1e-11
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 1e-11
d1nw2a_105 c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidoc 2e-11
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 5e-11
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 3e-08
d1qgva_137 c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human 1e-10
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 2e-10
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 3e-10
d1gtea3153 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenas 5e-10
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 2e-09
d1thxa_108 c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 3e-09
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 4e-09
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 6e-09
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 1e-08
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 2e-08
d2gv8a2107 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase 2e-08
d1gh2a_107 c.47.1.1 (A:) Thioredoxin-like protein, N-terminal 2e-08
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 3e-08
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 4e-08
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 4e-08
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 1e-05
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 4e-08
d1f9ma_112 c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera 4e-08
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 7e-08
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 8e-08
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 8e-08
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 8e-08
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 8e-08
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 1e-07
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 1e-07
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 2e-07
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 2e-07
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 0.001
d1fo5a_85 c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-lik 3e-07
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 3e-07
d1a8la2107 c.47.1.2 (A:120-226) Protein disulfide isomerase, 4e-07
d1zmaa1115 c.47.1.1 (A:1-115) Bacterocin transport accessory 4e-07
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 4e-07
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 5e-04
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 4e-07
d1hyua496 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase 7e-07
d1woua_119 c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxi 7e-07
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 8e-07
d1wjka_100 c.47.1.1 (A:) Thioredoxin-like structure containin 8e-07
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 8e-07
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 1e-06
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 1e-06
d2trcp_217 c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [ 2e-06
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 3e-06
d1egoa_85 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 4e-06
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 7e-06
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 7e-06
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 8e-06
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 2e-05
d1ti3a_113 c.47.1.1 (A:) Thioredoxin {European aspen (Populus 2e-05
d1xfla_114 c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsi 2e-05
d2djja1116 c.47.1.2 (A:6-121) Protein disulfide isomerase, PD 2e-05
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 3e-05
d1z6na1166 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Ps 3e-05
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 6e-05
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 0.002
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 6e-05
d1meka_120 c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu 8e-05
d1onfa2117 c.3.1.5 (A:154-270) Glutathione reductase {Plasmod 1e-04
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 1e-04
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 1e-04
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 3e-04
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 3e-04
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 3e-04
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 4e-04
d1nm3a174 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb 5e-04
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 6e-04
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 6e-04
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 7e-04
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 8e-04
d1t1va_93 c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [Tax 9e-04
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 0.001
d1ttza_75 c.47.1.1 (A:) Hypothetical protein XCC2852 {Xantho 0.002
d1ps9a2162 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-t 0.002
d1h75a_76 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Esch 0.002
d2c0ga2122 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal doma 0.003
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 0.004
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: Thi4-like
domain: Thiazole biosynthetic enzyme Thi4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  126 bits (318), Expect = 2e-33
 Identities = 44/318 (13%), Positives = 87/318 (27%), Gaps = 61/318 (19%)

Query: 91  EKSVENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGGVPGGQLMTTTEVENFPGFPD 150
           + +V +V+I+G+G +G +AA   A+      V    ++   PGG      ++ +      
Sbjct: 47  KFAVSDVIIVGAGSSGLSAAYVIAKNRPDLKVC-IIESSVAPGGGSWLGGQLFS------ 99

Query: 151 GITGPDLMDRMRRQAERWGAELHQEDVEFIDVKSNPFTVKSGERKVKCHSIVFATGATAK 210
                 +        +        E                    V  H+ +F +   +K
Sbjct: 100 ---AMVMRKPAHLFLQELEIPYEDEGDYV----------------VVKHAALFISTVLSK 140

Query: 211 RLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKFARHVHLLV 270
            L LP    F +  +                 +A V    T   +A           + +
Sbjct: 141 VLQLPNVKLFNATCVEDLVTRPP--TEKGEVTVAGVVTNWTLVTQAHGTQCCMDPNVIEL 198

Query: 271 RREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKG 330
              +                      ++   V+ +T G                      
Sbjct: 199 AGYKN---------------DGTRDLSQKHGVILSTTG-----------HDGPFGAFCAK 232

Query: 331 LFYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQ---DHEWRQAVT- 386
               I  +     ++G     +   V++  G     V+ ++ AG      D   R   T 
Sbjct: 233 RIVDIDQNQKLGGMKGLDMNHAEHDVVIHSGA-YAGVDNMYFAGMEVAELDGLNRMGPTF 291

Query: 387 --AAGSGCIAALSVERYL 402
              A SG  AA  + ++ 
Sbjct: 292 GAMALSGVHAAEQILKHF 309
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 130 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 126 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 126 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Length = 119 Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 85 Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Length = 105 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Length = 153 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Length = 108 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 107 Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Length = 112 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 85 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 107 Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 96 Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 217 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Length = 113 Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 114 Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 117 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Length = 75 Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query540
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.9
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.88
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.88
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.87
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.86
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.86
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.86
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.85
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.85
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 99.84
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.84
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.84
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.83
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.83
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 99.83
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.82
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.82
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.81
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.81
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.8
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.8
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.8
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 99.78
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.78
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.77
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 99.75
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 99.75
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 99.75
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.74
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 99.74
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.73
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.73
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 99.72
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.72
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.71
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 99.7
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.7
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 99.69
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.69
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 99.69
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 99.68
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 99.68
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.68
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.68
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.67
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.66
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.64
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 99.64
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.62
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 99.62
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.6
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 99.59
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 99.56
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.55
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.55
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.54
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.53
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.51
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.5
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.5
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.5
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.49
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.49
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.48
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.48
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.47
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.47
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.46
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.46
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.46
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.46
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.44
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.43
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.43
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.42
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 99.42
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.41
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 99.4
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.39
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.39
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.38
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.38
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.37
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.37
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 99.36
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.36
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.36
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.35
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.35
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 99.33
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.32
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.32
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.31
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.3
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.28
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.27
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 99.27
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.27
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.27
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.26
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.25
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.25
d1wjka_100 Thioredoxin-like structure containing protein C330 99.25
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.25
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.24
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.23
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.23
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.22
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 99.21
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 99.2
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.19
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.19
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.18
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.17
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.15
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 99.15
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.15
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.14
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.14
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.13
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 99.13
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.13
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.13
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.13
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 99.12
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.11
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.11
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.1
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.1
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 99.1
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.09
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.09
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 99.09
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 99.08
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.04
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.03
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.0
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.99
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.98
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.95
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 98.94
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.94
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.93
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 98.9
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.89
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 98.86
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.85
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.82
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.8
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 98.79
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.75
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.75
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.75
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.74
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.74
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.7
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.66
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.63
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.62
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.62
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.57
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.54
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 98.54
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.52
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.5
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.49
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 98.41
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.37
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.34
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 98.29
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 98.24
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.22
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 98.19
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 98.19
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 98.17
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 98.17
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.17
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.13
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.01
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 98.01
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 98.01
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.99
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 97.96
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 97.93
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.92
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.92
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 97.9
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.9
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.9
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 97.85
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 97.81
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 97.79
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.79
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.76
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 97.73
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 97.73
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 97.71
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 97.69
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 97.66
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.64
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 97.6
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.6
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.59
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 97.58
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.55
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.54
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 97.54
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.51
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.51
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 97.5
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.5
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.47
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.46
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.41
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 97.4
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 97.39
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 97.39
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.39
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.38
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.35
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 97.29
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 97.24
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 97.23
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.22
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.19
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 97.14
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.12
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 97.12
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 97.12
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 97.11
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 97.1
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 97.07
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 97.06
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.04
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.02
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 96.98
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 96.98
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 96.97
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.95
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 96.89
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.76
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 96.68
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.62
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 96.55
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.54
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.52
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 96.51
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.51
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.46
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.45
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.4
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.38
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 96.3
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 96.3
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.29
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 96.21
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 96.21
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.15
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.82
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.82
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.78
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.77
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 95.74
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 95.7
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 95.69
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.69
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.66
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.63
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.61
d1hyua3102 Alkyl hydroperoxide reductase subunit F (AhpF), N- 95.6
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.59
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.52
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 95.36
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.21
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.11
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.11
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.92
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 94.78
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.7
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.63
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.63
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.6
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.54
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 94.5
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 94.18
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 93.93
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 93.92
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 93.77
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.66
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.47
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 93.47
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 93.4
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.38
d1t4za_105 Adaptive-response sensory-kinase SasA, N-terminal 93.28
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.26
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.14
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 92.98
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 92.79
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 92.74
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.71
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 92.69
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.65
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.53
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 92.49
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.43
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 92.41
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 92.41
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 92.23
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.13
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.12
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 91.81
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 91.72
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 91.71
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 91.65
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 91.52
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 91.42
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 91.37
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 91.33
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 91.12
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 91.0
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 90.99
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 90.93
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.85
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.76
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 90.73
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 90.72
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 90.42
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 90.32
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 90.28
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 90.22
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 90.09
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 89.94
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 89.82
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 89.77
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 89.68
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 89.58
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 89.43
d2axoa1 225 Hypothetical protein Atu2684 {Agrobacterium tumefa 89.35
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 89.18
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 89.16
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 88.81
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 88.8
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 88.6
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 88.6
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 88.57
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 88.5
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 88.36
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 88.32
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 88.32
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 88.29
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 88.26
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 88.17
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 88.07
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 88.02
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 87.97
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 87.92
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 87.87
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 87.84
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 87.79
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 87.78
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 87.61
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 87.55
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 87.31
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 87.05
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 87.0
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 86.8
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 86.73
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 86.38
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 86.37
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 86.13
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 86.08
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 85.91
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 85.85
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 85.72
d1id1a_153 Rck domain from putative potassium channel Kch {Es 85.27
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 84.53
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 84.47
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 83.96
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 83.93
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 83.92
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 83.88
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 83.88
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 83.61
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 83.44
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 83.2
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 83.17
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 82.95
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 82.77
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 82.61
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 82.51
d1r5pa_90 Circadian oscillation regulator KaiB {Cyanobacteri 82.42
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 82.23
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 82.17
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 82.06
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 82.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 81.83
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 81.75
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 81.54
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 81.35
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 81.03
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 80.87
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 80.82
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 80.8
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 80.39
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 80.28
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 80.2
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 80.06
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Thioredoxin reductase
species: Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.90  E-value=3.2e-23  Score=186.28  Aligned_cols=187  Identities=53%  Similarity=0.931  Sum_probs=161.7

Q ss_pred             CcccEEEECCCHHHHHHHHHHHHcCCceEEEcCCCCCC-CCcceeeccCccccCCCCCCCCChHHHHHHHHHHHHHhCCE
Q 009224           93 SVENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQAGG-VPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAE  171 (540)
Q Consensus        93 ~~~~vvVIGgG~aGl~aA~~l~~~g~~v~lie~~~~~~-~~gg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~  171 (540)
                      ..+||+||||||+|++||..|++.|++++|+|+..... .+++.+.......++++++......++...+.++.++++++
T Consensus         4 ~~~~VvIIGgGpaGl~aA~~~ar~g~~v~vie~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~el~~~~~~q~~~~g~~   83 (192)
T d1vdca1           4 HNTRLCIVGSGPAAHTAAIYAARAELKPLLFEGWMANDIAPGGQLTTTTDVENFPGFPEGILGVELTDKFRKQSERFGTT   83 (192)
T ss_dssp             EEEEEEEECCSHHHHHHHHHHHHTTCCCEEECCSSBTTBCTTCGGGGCSEECCSTTCTTCEEHHHHHHHHHHHHHHTTCE
T ss_pred             ccceEEEECCCHHHHHHHHHHHHcCCcEEEEEeecccccccccccccchhhhccccccccccchHHHHHHHHHHHhhcce
Confidence            45899999999999999999999999999999865422 24666666666777888888888999999999999999999


Q ss_pred             EEEeeEEEEEeeCCcEEEEECCeEEEecEEEEccCCCCCCCCCCCcccccCCCeeeeeecCCCCCCCCCCEEEEEeCCcc
Q 009224          172 LHQEDVEFIDVKSNPFTVKSGERKVKCHSIVFATGATAKRLNLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDT  251 (540)
Q Consensus       172 ~~~~~v~~i~~~~~~~~v~~~~~~~~~d~lviAtG~~~~~~~ipg~~~~~~~~~~~~~~~~~~~~~~~~k~v~VvG~G~~  251 (540)
                      +..++|..++..++.+.+........+|.+++++|..                                           
T Consensus        84 i~~~~V~~~~~~~~~~~v~~~~~~~~~~~~~~a~g~~-------------------------------------------  120 (192)
T d1vdca1          84 IFTETVTKVDFSSKPFKLFTDSKAILADAVILAIGAV-------------------------------------------  120 (192)
T ss_dssp             EECCCCCEEECSSSSEEEECSSEEEEEEEEEECCCEE-------------------------------------------
T ss_pred             eeeeeEEecccccCcEEecccceeeeeeeEEEEeeee-------------------------------------------
Confidence            9988999999988989998888889999999999951                                           


Q ss_pred             HHHHHHHHHhcCCeEEEEEecccccccHHHHHHHhcCCCeEEEeCceEEEEeeCCCCceeeEEEEEccCCceEEEEccEE
Q 009224          252 ATEEAIYLTKFARHVHLLVRREQLRASRAMQDRVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEESVLEAKGL  331 (540)
Q Consensus       252 a~e~a~~l~~~g~~v~li~~~~~~~~~~~~~~~~l~~~gv~~~~~~~v~~i~~~~~g~~~~v~~~~~~~g~~~~i~~D~v  331 (540)
                                                                                                      
T Consensus       121 --------------------------------------------------------------------------------  120 (192)
T d1vdca1         121 --------------------------------------------------------------------------------  120 (192)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             EEecccccCccccccceeccCCCCEEeCCCccccCCCceEEccccCCCcchhhhhhhchHHHHHHHHHHHHhc
Q 009224          332 FYGIGHSPNSQLLQGQVELDSSGYVIVEEGTAKTSVEGVFAAGDVQDHEWRQAVTAAGSGCIAALSVERYLVN  404 (540)
Q Consensus       332 i~a~G~~p~~~~~~~~~~~~~~g~i~vd~~~~~t~~~~iya~GD~~~~~~~~~~~A~~~g~~aa~~i~~~l~~  404 (540)
                        ..|..|++.++..++++|++|+|.+|+...+|+.|||||+|||.+.+++++..|+.+|..||..+.+||..
T Consensus       121 --~~g~~p~~~~~~~~veld~~G~i~~~~~~~~Ts~~GV~a~GDv~~~~~r~~v~A~g~G~~aA~~~~~yl~~  191 (192)
T d1vdca1         121 --AKGHEPATKFLDGGVELDSDGYVVTKPGTTQTSVPGVFAAGDVQDKKYRQAITAAGTGCMAALDAEHYLQE  191 (192)
T ss_dssp             --ECCEEESCGGGTTSSCBCTTSCBCCCTTSCBCSSTTEEECGGGGCSSCCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             --ecccCchHHHhcCceeecCCCeEEeCCCceEecCCCEEEeeecCCcccceEEEEEechHHHHHHHHHHHhh
Confidence              12456677777778889999999999866699999999999999987789999999999999999999864
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyua3 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t4za_ c.47.1.15 (A:) Adaptive-response sensory-kinase SasA, N-terminal domain {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1r5pa_ c.47.1.15 (A:) Circadian oscillation regulator KaiB {Cyanobacterium (Nostoc sp.) pcc 7120 [TaxId: 1180]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure