Citrus Sinensis ID: 009315

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------
MSGKKQGALDDQSTTLDQLSFRDISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLETPIEENYMAPEDQVKTIFDQLELMNMIEVVKRKPDGKPKTCRVPSSLSDNLFPKAESGGVFCIHGVSRSNATSGSSDLCVRRLAELLVNRNNSYASGKHLERLHSYLSFDNRKGDKPAAEVGNLLNRTISKRGYRLLRVLDLERVYKPVLPETIGKLRLLRHVGLRWTFLDSIPKSLGDLPSLETLDVKRTNIATLPKSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLLIGKKSRPLNWLRNSKDLRKLGLTFHFESLQDQEITKWIKDLEHLESLMLRSVNDFLEPSDLDFGNLSKHKKLTELYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYIGEQMTCQKGWFPQLLVLKLWVLKELKRWSIEKETMPKLRELEIRRCQKLKNPFESTNLTGLKELTLTDMEKSFEDEVKQSLAGTVNVVIIPPVRVSFN
ccccccccHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHcccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccEEEEEccccccccEEEccHHHHHHHHHHHHccccEEEEcccccccccccccccEEEEEEEccccccccccccccccEEEEEEEcccccccccHHHccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHccccccEEEcccccccccccccccccccccccccccEEEccccccHHHHHccccccEEEEEEEEEcccHHHHHHHHHccccccccEEEEEcccccccccccccccccccccEEEEEEEcccccccccccccccEEEEEEccccccccHHHHHHcccccEEEEEEEEEEccEEEEcccccccccEEEEEcccccccEEEcccccccccEEEEEccccccccccccccccccEEEEEcccHHHHHHHHHcccccccEEEEcEEEEEEc
cccccHHHHHHHccHccccccccHHHHHHccHHHcccHHHHHEEEEEcccccccccHHHHHHHHHHHccEcccccccccHHHHHHHHHHHHHHccEEEEEEccccccEEEEEHHHHHHHHHHHHHHHccEEEEEcccccccccccccccEEEEEEEEcccccccccccccccEEEEEEEccccccccccccccccccHHHHHHcccEEEEEccccccccccHHHHHHHHHHHEcccccccccccHHHHHHHHccEEEccccccccccHHHHHHHHHHEEEccccccccccccccccccHHHHcEccEEEccccccHHHHHHHHHHHHHcEEEEccccccHHHHHHHHHHcccccEEEEEEcccccccccHcHHccccccHHcEEEEEcccccccccccccccccEEEEEEccccccccHHHHHHcccccEEEEEcccccccEEEcccccccccEEEEEcccccccEEEEccccccccEEEEEcccccccccccccccHHHcEEEEcccHHHHHHHHccccccccEEEEccEEEEEEc
msgkkqgalddqsttldqlsfrDISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERletpieenymapedqVKTIFDQLELMNMIEVvkrkpdgkpktcrvpsslsdnlfpkaesggvfcihgvsrsnatsgssDLCVRRLAELLVNrnnsyasgkhLERLHSYLsfdnrkgdkpaaeVGNLLNRTISKRGYRLLRVLDLErvykpvlpetigKLRLLRHVGLRWTFldsipkslgdlpsletldvkrtniatlpksiwKSSTLRHLYMSDIRFqlsaqkpfvnssLTKLQTLWGLligkksrplnwlrnskDLRKLGLTfhfeslqdQEITKWIKDLEHLESLMLRSvndflepsdldfgnlskhkklTELYLIGklpraidindqlpeKLTVFTLSLshlskdpmpvlgqlkELKILRLFAHSYIgeqmtcqkgwfpqLLVLKLWVLKELKRWSIEKETMPKLRELEIRRCQKlknpfestnltglkeltltDMEKSFEDEVKQSLAgtvnvviippvrvsfn
msgkkqgalddqsttldqlsFRDISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLEtpieenymapeDQVKTIFDQLELMNMIEvvkrkpdgkpktcRVPSSLSDNLFPKAESGGVFCIHGVSrsnatsgssdLCVRRLAELLVNRnnsyasgkhLERLHSYLSFDnrkgdkpaaevgnllnrtiskrgyrllrvldlervykpvlpetigklrllrHVGLRWTFLDsipkslgdlpsletldvkrtniatlpksiwkssTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLligkksrplnwlrNSKDLRKLGLTfhfeslqdqeITKWIKDLEHLESLMLRSVNDFLEPSDLDFGNLSKHKKLTELYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYIGEQMTCQKGWFPQLLVLKLWVLKELKrwsieketmpklreLEIRRcqklknpfestnltglkelTLTDMEKSFEDEVKqslagtvnvviippvrvsfn
MSGKKQGALDDQSTTLDQLSFRDISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLETPIEENYMAPEDQVKTIFDQLELMNMIEVVKRKPDGKPKTCRVPSSLSDNLFPKAESGGVFCIHGVSRSNATSGSSDLCVRRLAELLVNRNNSYASGKHLERLHSYLSFDNRKGDKPAAEVGNLLNRTISKRGYRLLRVLDLERVYKPVLPETIGKLRLLRHVGLRWTFLDSIPKSLGDLPSLETLDVKRTNIATLPKSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLLIGKKSRPLNWLRNSKDLRKLGLTFHFESLQDQEITKWIKDLEHLESLMLRSVNDFLEPSDLDFGNLSKHKKLTELYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYIGEQMTCQKGWFPQllvlklwvlkelkRWSIEKETMPKLRELEIRRCQKLKNPFESTNLTGLKELTLTDMEKSFEDEVKQSLAGTVNVVIIPPVRVSFN
*****************QLSFRDISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLETPIEENYMAPEDQVKTIFDQLELMNMIEVV**************************SGGVFCIHGVSR*******SDLCVRRLAELLVNRNNSYASGKHLERLHSYLSFD********AEVGNLLNRTISKRGYRLLRVLDLERVYKPVLPETIGKLRLLRHVGLRWTFLDSIPKSLGDLPSLETLDVKRTNIATLPKSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLLIGKKSRPLNWLRNSKDLRKLGLTFHFESLQDQEITKWIKDLEHLESLMLRSVNDFLEPSDLDFGNLSKHKKLTELYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYIGEQMTCQKGWFPQLLVLKLWVLKELKRWSIEKETMPKLRELEIRRCQKLKNPFESTNLTGLKELTL***********KQSLAGTVNVVIIPPV*****
****************DQLSFRDISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLETPIEE**MAPEDQVKTIFDQLELMNMIEVVKRKPDGKPKTCRVPSSLSDNLFPKAESGGVFCIHGV*************VRRLAELLVNRNNSY*SGKHLERLHSYLSFDNRKGDKPAAEVGNLLNRTISKRGYRLLRVLDLERVYKPVLPETIGKLRLLRHVGLRWTFLDSIPKSLGDLPSLETLDVKRTNIATLPKSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLLIGKKSRPLNWLRNSKDLRKLGLTFHFESLQDQEITKWIKDLEHLESLMLRSVNDFLEPSDLDFGNLSKHKKLTELYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYIGEQMTCQKGWFPQLLVLKLWVLKELKRWSIEKETMPKLRELEIRRCQKLKNPFESTNLTGLKELTLTDMEKS************VNVVIIPPVRVSFN
*************TTLDQLSFRDISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLETPIEENYMAPEDQVKTIFDQLELMNMIEVVKRKPDGKPKTCRVPSSLSDNLFPKAESGGVFCIHGVSR********DLCVRRLAELLVNRNNSYASGKHLERLHSYLSFDNRKGDKPAAEVGNLLNRTISKRGYRLLRVLDLERVYKPVLPETIGKLRLLRHVGLRWTFLDSIPKSLGDLPSLETLDVKRTNIATLPKSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLLIGKKSRPLNWLRNSKDLRKLGLTFHFESLQDQEITKWIKDLEHLESLMLRSVNDFLEPSDLDFGNLSKHKKLTELYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYIGEQMTCQKGWFPQLLVLKLWVLKELKRWSIEKETMPKLRELEIRRCQKLKNPFESTNLTGLKELTLTDMEKSFEDEVKQSLAGTVNVVIIPPVRVSFN
****KQGALDDQSTTLDQLSFRDISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLETPIEENYMAPEDQVKTIFDQLELMNMIEVVKRKPDGKPKTCRVPSSLSDNLFPKAESGGVFCIHGVSRS*******DLCVRRLAELLVNRNNSYASGKHLERLHSYLSFDNRKGDKPAAEVGNLLNRTISKRGYRLLRVLDLERVYKPVLPETIGKLRLLRHVGLRWTFLDSIPKSLGDLPSLETLDVKRTNIATLPKSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLLIGKKSRPLNWLRNSKDLRKLGLTFHFESLQDQEITKWIKDLEHLESLMLRSVNDFLEPSDLDFGNLSKHKKLTELYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYIGEQMTCQKGWFPQLLVLKLWVLKELKRWSIEKETMPKLRELEIRRCQKLKNPFESTNLTGLKELTLTDMEKSFEDEVKQSLAGTVNVVIIPPVRVSFN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGKKQGALDDQSTTLDQLSFRDISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLETPIEENYMAPEDQVKTIFDQLELMNMIEVVKRKPDGKPKTCRVPSSLSDNLFPKAESGGVFCIHGVSRSNATSGSSDLCVRRLAELLVNRNNSYASGKHLERLHSYLSFDNRKGDKPAAEVGNLLNRTISKRGYRLLRVLDLERVYKPVLPETIGKLRLLRHVGLRWTFLDSIPKSLGDLPSLETLDVKRTNIATLPKSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLLIGKKSRPLNWLRNSKDLRKLGLTFHFESLQDQEITKWIKDLEHLESLMLRSVNDFLEPSDLDFGNLSKHKKLTELYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYIGEQMTCQKGWFPQLLVLKLWVLKELKRWSIEKETMPKLRELEIRRCQKLKNPFESTNLTGLKELTLTDMEKSFEDEVKQSLAGTVNVVIIPPVRVSFN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query537 2.2.26 [Sep-21-2011]
Q9XIF0906 Putative disease resistan yes no 0.869 0.515 0.258 1e-26
P0C8S1906 Probable disease resistan no no 0.925 0.548 0.273 3e-26
Q9FJB5901 Disease resistance RPP8-l no no 0.916 0.546 0.265 2e-25
Q8W3K3910 Putative disease resistan no no 0.878 0.518 0.267 4e-25
P0DI18 1049 Probable disease resistan no no 0.817 0.418 0.276 5e-24
P0DI17 1049 Probable disease resistan no no 0.817 0.418 0.276 5e-24
Q9STE5847 Putative disease resistan no no 0.778 0.493 0.282 7e-23
Q8W474907 Probable disease resistan no no 0.785 0.465 0.285 3e-22
P0DI16 1017 Probable disease resistan no no 0.800 0.422 0.273 2e-21
F4IBE4 1017 Probable disease resistan no no 0.800 0.422 0.273 2e-21
>sp|Q9XIF0|DRL13_ARATH Putative disease resistance protein At1g59780 OS=Arabidopsis thaliana GN=At1g59780 PE=2 SV=1 Back     alignment and function desciption
 Score =  121 bits (303), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 138/534 (25%), Positives = 233/534 (43%), Gaps = 67/534 (12%)

Query: 24  ISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLETPIEENYMAPEDQ 83
           ++ +   + + L  +LK CL Y   +P+ +E+ + RL  +W AE +  P         D 
Sbjct: 401 VNHVLSLSFEGLPGYLKHCLLYLASYPEDHEIEIERLSYVWAAEGITYPGNYEGATIRDV 460

Query: 84  VKTIFDQLELMNMIEVVKRKPDGKPKTCRVPSSLSDNLFPKAESGGVFCIHGVSRSNATS 143
                ++L   NM+   +     + + C++   + +    KA+      I  V+   ++S
Sbjct: 461 ADLYIEELVKRNMVISERDALTSRFEKCQLHDLMREICLLKAKEENFLQI--VTDPTSSS 518

Query: 144 GSSDLCVRRLAELLVNRNNSYASGKHLERLHSYLSFDNRKGDKPAAEVGNLLNRTISKRG 203
               L   R   L+V  N S  SG++               D   +++ +LL   +    
Sbjct: 519 SVHSLASSRSRRLVV-YNTSIFSGEN---------------DMKNSKLRSLLFIPVGYSR 562

Query: 204 YR---------LLRVLDLE--RVYKPVLPETIGKLRLLRHVGLRWTFLDSIPKSLGDLPS 252
           +          LLRVLDL+  +     LP +IGKL  L+++ L    +  +P SL +L S
Sbjct: 563 FSMGSNFIELPLLRVLDLDGAKFKGGKLPSSIGKLIHLKYLSLYQASVTYLPSSLRNLKS 622

Query: 253 LETLD--VKRTNIATLPKSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLL- 309
           L  L+  +    +  +P    +   LR+L +           P+  SSLTKL+ L  LL 
Sbjct: 623 LLYLNLRINSGQLINVPNVFKEMLELRYLSL-----------PWERSSLTKLE-LGNLLK 670

Query: 310 ------IGKKSRPLNWLRNSKDLRKLGLTFHFESLQDQEITKWIKDLEHLESLMLRSVND 363
                    K   +  L     LR L +    E L  + ++  +  L HLE L +    +
Sbjct: 671 LETLINFSTKDSSVTDLHRMTKLRTLQILISGEGLHMETLSSALSMLGHLEDLTVTPSEN 730

Query: 364 FLEPSDLDFGNLSKHKKLTELYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLG 423
            ++          KH KL  +Y     P   D+    P  LT  +L    L +DPMP L 
Sbjct: 731 SVQ---------FKHPKL--IYR----PMLPDVQ-HFPSHLTTISLVYCFLEEDPMPTLE 774

Query: 424 QLKELKILRLFAHSYIGEQMTCQKGWFPQLLVLKLWVLKELKRWSIEKETMPKLRELEIR 483
           +L +LK++ L+ ++Y+G +M C  G FP L  L++W L  L+ W +E+ +MP L  L I 
Sbjct: 775 KLLQLKVVSLWYNAYVGRRMVCTGGGFPPLHRLEIWGLDALEEWIVEEGSMPLLHTLHIV 834

Query: 484 RCQKLKN-PFESTNLTGLKELTLTDMEKSFEDEVKQSLAGTVNVVIIPPVRVSF 536
            C+KLK  P     ++ LKEL +   EK F+ +V +       +  +P +R ++
Sbjct: 835 DCKKLKEIPDGLRFISSLKELAIRTNEKVFQKKVSKGGEDYYKMQHVPLIRYNW 888
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|P0DI18|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1 Back     alignment and function description
>sp|P0DI17|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1 Back     alignment and function description
>sp|Q9STE5|R13L2_ARATH Putative disease resistance RPP13-like protein 2 OS=Arabidopsis thaliana GN=RPP13L2 PE=3 SV=1 Back     alignment and function description
>sp|Q8W474|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4 Back     alignment and function description
>sp|P0DI16|DRL44_ARATH Probable disease resistance protein RDL5 OS=Arabidopsis thaliana GN=RDL5 PE=1 SV=1 Back     alignment and function description
>sp|F4IBE4|DRL10_ARATH Probable disease resistance protein RF45 OS=Arabidopsis thaliana GN=RF45 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query537
255544065 936 Disease resistance protein RPM1, putativ 0.940 0.539 0.501 1e-119
255544075 884 Disease resistance protein RPM1, putativ 0.944 0.573 0.485 1e-118
225433948 1045 PREDICTED: putative disease resistance p 0.934 0.480 0.400 5e-87
297743835 1020 unnamed protein product [Vitis vinifera] 0.867 0.456 0.406 6e-86
147781606 1183 hypothetical protein VITISV_025760 [Viti 0.936 0.425 0.403 1e-85
225433944 1086 PREDICTED: disease resistance RPP8-like 0.938 0.464 0.400 1e-85
297743817 1083 unnamed protein product [Vitis vinifera] 0.914 0.453 0.398 5e-85
147781605 829 hypothetical protein VITISV_025759 [Viti 0.914 0.592 0.398 5e-85
359478101 2189 PREDICTED: uncharacterized protein LOC10 0.955 0.234 0.385 2e-82
147856113 2540 hypothetical protein VITISV_006121 [Viti 0.936 0.198 0.381 4e-82
>gi|255544065|ref|XP_002513095.1| Disease resistance protein RPM1, putative [Ricinus communis] gi|223548106|gb|EEF49598.1| Disease resistance protein RPM1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  436 bits (1120), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 259/516 (50%), Positives = 347/516 (67%), Gaps = 11/516 (2%)

Query: 13  STTLDQLSFRDIS-SIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLET 71
           S  ++  +F+  S +I   + + L   +K+CL Y  LFPKS+E+ +RRLL LWLAE L  
Sbjct: 385 SMVIESDTFKSSSLNILAMSYQDLPSPVKSCLLYSGLFPKSHEIPIRRLLLLWLAEGLAI 444

Query: 72  PIEENYMAPEDQVKTIFDQLELMNMIEVVKRKPDGKPKTCRVPSSLSDNLFPKAESGGVF 131
                 + PED V+T F++L + NMI V K + DG PKTC+V ++L D + P A   G F
Sbjct: 445 SSHGGSIVPEDLVETHFEELVIRNMIVVEKWRLDGSPKTCKVQAALYDTILPTATDMGFF 504

Query: 132 CIHGVSRSNATSGSSDLCVRRLAELLVNRNNSYASGKHLERLHSYLSFDNRKGDKPAAEV 191
            +H   R+          VRR+AE L + N   +   H+  L SY+SF+ RKGD PA +V
Sbjct: 505 HVH---RNYDYKDKPPFNVRRIAEYL-DINCYPSDTSHIGYLRSYISFNTRKGDTPADQV 560

Query: 192 GNLLNRTISKRGYRLLRVLDLERVYKPVLPETIGKLRLLRHVGLRWTFLDSIPKSLGDLP 251
            NLL + ISKRG+ LL VLDLE VYKPVL E +GKL  LR++GLRWTFLD IP+S+G LP
Sbjct: 561 DNLLKK-ISKRGFGLLTVLDLEYVYKPVLSEALGKLLHLRYLGLRWTFLDWIPESIGKLP 619

Query: 252 SLETLDVKRTNIATLPKSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLLIG 311
            LETLDVK TNI  LP SIWK+  LRHLYM+DI F +S QK  +  SLT LQTLWGLL+G
Sbjct: 620 CLETLDVKHTNIPALPISIWKAKKLRHLYMNDIHFGMSFQKQGIKVSLTNLQTLWGLLVG 679

Query: 312 KKSRPLNWLRNSKDLRKLGLTFHFESLQDQEITKWIKDL-EHLESLMLRSVNDFLEPSDL 370
           K    +NWL+   +LRKLGLT    S+  Q+I  WI +L E+LESL LRS+N+F EPSDL
Sbjct: 680 KSCSVINWLQQLTNLRKLGLTCLDSSV--QKIINWIPELKENLESLRLRSINEFNEPSDL 737

Query: 371 DFGNLSKHKKLTELYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKI 430
           D G + +HKKL+EL+L G+L    D+++ LP  LT+ TLS+S L +DPMP+LG+L  L I
Sbjct: 738 DLGTMKQHKKLSELHLFGRLV-TFDMHE-LPPNLTMLTLSVSQLEQDPMPILGKLPRLSI 795

Query: 431 LRLFAHSYIGEQMTCQKGWFPQLLVLKLWVLKELKRWSIEKETMPKLRELEIRRCQKLKN 490
           LRLFA+SY+G+QM+  +  FP+L VLKLW+L+EL+ W++E+ +M +L++LEIR C  LK 
Sbjct: 796 LRLFANSYLGKQMSSPRNGFPELRVLKLWMLEELEEWTVEEGSMRELQKLEIRCCTNLKL 855

Query: 491 PFESTNLTGLKELTLTDMEKSFEDEVKQSLAGTVNV 526
           P    NL  L ELTLT+M   F  +++ +   +V +
Sbjct: 856 PGGLYNLAALDELTLTNMPGKFVADIRTNTKRSVKI 891

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255544075|ref|XP_002513100.1| Disease resistance protein RPM1, putative [Ricinus communis] gi|223548111|gb|EEF49603.1| Disease resistance protein RPM1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225433948|ref|XP_002267553.1| PREDICTED: putative disease resistance protein At1g59780-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743835|emb|CBI36718.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147781606|emb|CAN64832.1| hypothetical protein VITISV_025760 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225433944|ref|XP_002267359.1| PREDICTED: disease resistance RPP8-like protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743817|emb|CBI36700.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147781605|emb|CAN64831.1| hypothetical protein VITISV_025759 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359478101|ref|XP_003632069.1| PREDICTED: uncharacterized protein LOC100852873 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147856113|emb|CAN82439.1| hypothetical protein VITISV_006121 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query537
TAIR|locus:2037623899 AT1G58410 [Arabidopsis thalian 0.888 0.530 0.289 5.5e-25
TAIR|locus:504956182 1049 AT1G58848 [Arabidopsis thalian 0.523 0.267 0.319 1e-23
TAIR|locus:2826978 1049 AT1G59218 [Arabidopsis thalian 0.523 0.267 0.319 1e-23
TAIR|locus:504956186 1138 AT1G58602 [Arabidopsis thalian 0.828 0.391 0.275 1.8e-23
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.925 0.547 0.25 2.8e-21
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.912 0.539 0.241 4.6e-21
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.795 0.470 0.277 7.7e-20
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.793 0.472 0.263 1.6e-19
TAIR|locus:2197409727 LOV1 "LOCUS ORCHESTRATING VICT 0.810 0.598 0.261 1.8e-18
TAIR|locus:504956184 1017 AT1G58807 "AT1G58807" [Arabido 0.549 0.290 0.302 6.9e-18
TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 314 (115.6 bits), Expect = 5.5e-25, P = 5.5e-25
 Identities = 148/512 (28%), Positives = 220/512 (42%)

Query:    33 KSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLETPIEENYMAPEDQVKTIFDQLE 92
             + L  +LK C  Y   FP+ +E+ V +L   W AE +      +     D   +  ++L 
Sbjct:   413 EELPNYLKHCFLYLAHFPEDHEIDVEKLHYYWAAEGISERRRYDGETIRDTGDSYIEELV 472

Query:    93 LMNMIEVVKRKPDGKPKTCRVPSSLSDNLFPKAESGGVFCIHGVSRSNATSGSSDLCVRR 152
               NM+   +     + +TCR+   + +    KA+      I  VS  + TS    L   R
Sbjct:   473 RRNMVISERDVMTSRFETCRLHDMMREICLFKAKEENFLQI--VSNHSPTSNPQTLGASR 530

Query:   153 LAELLVNRNNSYASG-KHLERLHSYLSFDNRKGDKPAAEVGNLLNRTISKRGYRLLRVLD 211
                +L N    +    K+  +L S +   +  G++     G++  R       +LLRVLD
Sbjct:   531 RF-VLHNPTTLHVERYKNNPKLRSLVVVYDDIGNRRWMLSGSIFTRV------KLLRVLD 583

Query:   212 LERV-YKP-VLPETIGKLRLLRHVGLRWTFLDSIPKSLGDLPSLETLDVKRTNIATL--P 267
             L +  +K   LP  IGKL  LR++ L+   +  +P SL +L  L  LD+ RT+   +  P
Sbjct:   584 LVQAKFKGGKLPSDIGKLIHLRYLSLKDAKVSHLPSSLRNLVLLIYLDI-RTDFTDIFVP 642

Query:   268 KSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLLIGKKSRPLNWLRNSKDLR 327
                     LR+L +   RF     K  + S+L KL+ L       KS  L  LR    LR
Sbjct:   643 NVFMGMRELRYLELP--RFMHEKTKLEL-SNLEKLEALENF--STKSSSLEDLRGMVRLR 697

Query:   328 KLGLTFHFESLQDQEITKWIKDLEHLESLMLRS---VNDFLEPSD-LDFGNLSKHKKLTE 383
              L +    E    Q ++  +  L HLE+  +     VN   E    LDF  L   KKLT 
Sbjct:   698 TLVIILS-EGTSLQTLSASVCGLRHLENFKIMENAGVNRMGEERMVLDFTYL---KKLT- 752

Query:   384 LYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYIGEQM 443
               L  ++PR   I   LP  LTV  LS   L +DPMP+L +L ELK L L   S+ G +M
Sbjct:   753 --LSIEMPRLPKIQ-HLPSHLTVLDLSYCCLEEDPMPILEKLLELKDLSLDYLSFSGRKM 809

Query:   444 TCQKGWFPQXXXXXXXXXXXXXRWSIEKETMPKLRELEIRRCQKLKNPFESTNLTGLKEL 503
              C  G FPQ              W +E+ +M +L  L I      + P     +  LK L
Sbjct:   810 VCSAGGFPQLRKLALDEQEEWEEWIVEEGSMSRLHTLSIWSSTLKELPDGLRFIYSLKNL 869

Query:   504 TLTDMEKSFEDEVKQSLAGTVNVVIIPPVRVS 535
                 M KS+ + + +       V  IP ++ S
Sbjct:   870 I---MGKSWMERLSERGEEFYKVQNIPFIKFS 898
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197409 LOV1 "LOCUS ORCHESTRATING VICTORIN EFFECTS1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00001981001
SubName- Full=Chromosome chr5 scaffold_124, whole genome shotgun sequence; (1028 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query537
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 4e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score = 42.3 bits (100), Expect = 4e-04
 Identities = 18/54 (33%), Positives = 29/54 (53%)

Query: 22  RDISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLETPIEE 75
            ++ SI   +  +L  HLK C  Y  LFP+ Y +   +L++LW+AE    P + 
Sbjct: 232 NEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPSDI 285

Length = 285
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 537
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.87
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.63
KOG4237498 consensus Extracellular matrix protein slit, conta 99.58
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.56
KOG4237498 consensus Extracellular matrix protein slit, conta 99.53
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.48
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.04
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.99
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
KOG4341483 consensus F-box protein containing LRR [General fu 98.89
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.84
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.83
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.83
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.82
PLN03150623 hypothetical protein; Provisional 98.63
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.61
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.57
PLN03150623 hypothetical protein; Provisional 98.53
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.49
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.48
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.42
KOG4341483 consensus F-box protein containing LRR [General fu 98.29
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.29
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.17
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.11
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.09
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.02
PRK15386426 type III secretion protein GogB; Provisional 97.94
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.94
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.9
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.76
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.76
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.72
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.67
PRK15386 426 type III secretion protein GogB; Provisional 97.51
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.39
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.3
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.89
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.71
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.42
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.41
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.27
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.24
KOG1947 482 consensus Leucine rich repeat proteins, some prote 95.74
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.57
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.15
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.09
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.7
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.33
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.16
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.41
smart0037026 LRR Leucine-rich repeats, outliers. 91.92
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.92
smart0037026 LRR Leucine-rich repeats, outliers. 91.22
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.22
KOG4308478 consensus LRR-containing protein [Function unknown 82.47
KOG4308478 consensus LRR-containing protein [Function unknown 82.19
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.3e-51  Score=434.78  Aligned_cols=459  Identities=25%  Similarity=0.321  Sum_probs=332.4

Q ss_pred             CCCCCCCChhhHHHHHhhcCh----------hhhhhHHHHhcCCCcHhHHHHhhhhccCCCCcccchhhHHHHHHHhccc
Q 009315            1 MSGKKQGALDDQSTTLDQLSF----------RDISSIWVFANKSLSPHLKACLHYFRLFPKSYEVSVRRLLQLWLAERLE   70 (537)
Q Consensus         1 m~~~~~~~~~~W~~~l~~~~~----------~~i~~~L~lSY~~L~~~lk~cFl~~a~Fp~~~~i~~~~Li~~Wia~g~i   70 (537)
                      ||+|+  +.+||+++.+.+.+          +.|+++|++|||.||+++|.||+|||+|||||+|++++||.+||||||+
T Consensus       366 ma~K~--t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi  443 (889)
T KOG4658|consen  366 LACKK--TVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFI  443 (889)
T ss_pred             hcCCC--cHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCc
Confidence            67777  78899999998865          3599999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCChHHHHHHHHHHHhhccceEeeecCCCCCeeEEEcChhHHHHHhhhhh-----cCCcEEEeCCCCCccccCC
Q 009315           71 TPIEENYMAPEDQVKTIFDQLELMNMIEVVKRKPDGKPKTCRVPSSLSDNLFPKAE-----SGGVFCIHGVSRSNATSGS  145 (537)
Q Consensus        71 ~~~~~~~~~~~~~g~~~~~~L~~~~ll~~~~~~~~~~~~~~~mhdl~~d~~~~~~~-----~~~~~~~~~~~~~~~~~~~  145 (537)
                      .+..+.. +++|+|.+|+.+||++++++..+..  ++..+|+|||+|||||.++|+     +|+++...+......+...
T Consensus       444 ~~~~~~~-~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~  520 (889)
T KOG4658|consen  444 DPLDGGE-TAEDVGYDYIEELVRASLLIEERDE--GRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVK  520 (889)
T ss_pred             Ccccccc-chhcchHHHHHHHHHHHHHhhcccc--cceeEEEeeHHHHHHHHHHhccccccccceEEECCcCcccccccc
Confidence            9966555 9999999999999999999887643  566799999999999999999     6775555443444444555


Q ss_pred             CCCceeEEEEeecccCCccCCCCCcCceeEEEeccCC--CCCCChhhhhhhhhhhccccCCceeeEEEcCCC-CCCCCch
Q 009315          146 SDLCVRRLAELLVNRNNSYASGKHLERLHSYLSFDNR--KGDKPAAEVGNLLNRTISKRGYRLLRVLDLERV-YKPVLPE  222 (537)
Q Consensus       146 ~~~~~~~ls~~~~~~~~~~~~~~~~~~Lr~l~~~~~~--~~~~p~~~~~~~~~~~~~~~~~~~L~~L~L~~~-~~~~lp~  222 (537)
                      .+..+||++. +.......+.....++|+||++..+.  ...++.++|..          ++.||||||++| .+..+|.
T Consensus       521 ~~~~~rr~s~-~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~----------m~~LrVLDLs~~~~l~~LP~  589 (889)
T KOG4658|consen  521 SWNSVRRMSL-MNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRS----------LPLLRVLDLSGNSSLSKLPS  589 (889)
T ss_pred             chhheeEEEE-eccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhh----------CcceEEEECCCCCccCcCCh
Confidence            6788999986 44444455556677789999888775  56667665554          899999999965 6789999


Q ss_pred             hhccccccceeecCCCCCCccCcccCCCCCCcEEeecCCc-cccCCccccccccccEEeccccccccccCCCccCCcccc
Q 009315          223 TIGKLRLLRHVGLRWTFLDSIPKSLGDLPSLETLDVKRTN-IATLPKSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTK  301 (537)
Q Consensus       223 ~~~~l~~L~~L~l~~~~i~~lp~~l~~l~~L~~L~L~~~~-l~~lp~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~~l~~  301 (537)
                      ++++|.+||||+++++.+..+|.++++|..|.+|++..+. +..+|..+..|++|++|.+.......   -...++.+.+
T Consensus       590 ~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~---~~~~l~el~~  666 (889)
T KOG4658|consen  590 SIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSALSN---DKLLLKELEN  666 (889)
T ss_pred             HHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeecccccc---chhhHHhhhc
Confidence            9999999999999999999999999999999999999994 44666666669999999998765322   1223344444


Q ss_pred             ccccceEEecCCC-CchHHhhcCccCcE----EeEEEecccccHHHHHHHhccCCCcceEEEEeeCCCCCCCccccCCCC
Q 009315          302 LQTLWGLLIGKKS-RPLNWLRNSKDLRK----LGLTFHFESLQDQEITKWIKDLEHLESLMLRSVNDFLEPSDLDFGNLS  376 (537)
Q Consensus       302 L~~L~~~~~~~~~-~~~~~l~~l~~L~~----L~l~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~  376 (537)
                      |++|....+.... .+...+..++.|..    +.+.++...    ..+..+..+.+|+.|.+.+|......... .....
T Consensus       667 Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~~~~----~~~~~~~~l~~L~~L~i~~~~~~e~~~~~-~~~~~  741 (889)
T KOG4658|consen  667 LEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSIEGCSKR----TLISSLGSLGNLEELSILDCGISEIVIEW-EESLI  741 (889)
T ss_pred             ccchhhheeecchhHhHhhhhhhHHHHHHhHhhhhcccccc----eeecccccccCcceEEEEcCCCchhhccc-ccccc
Confidence            4444443333322 12223444444443    332222222    55667888999999999997765322111 11111


Q ss_pred             ---CCCCcceEEEee-ecCCcCCccccCCCCeeEEEEecccCCCCchhhhhcCCCccEEEeccccccCceeeecCCCCcc
Q 009315          377 ---KHKKLTELYLIG-KLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYIGEQMTCQKGWFPQ  452 (537)
Q Consensus       377 ---~~~~L~~l~l~~-~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~  452 (537)
                         .++++..+.+.. ..+..+.| ..+|++|+.|++..|.....+++....+..+..+.+..+.+.+.......++|++
T Consensus       742 ~~~~f~~l~~~~~~~~~~~r~l~~-~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~l~~~~~l~~l~~  820 (889)
T KOG4658|consen  742 VLLCFPNLSKVSILNCHMLRDLTW-LLFAPHLTSLSLVSCRLLEDIIPKLKALLELKELILPFNKLEGLRMLCSLGGLPQ  820 (889)
T ss_pred             hhhhHHHHHHHHhhccccccccch-hhccCcccEEEEecccccccCCCHHHHhhhcccEEecccccccceeeecCCCCce
Confidence               123444444433 34556665 4567999999999999888888888888888877676666665533334667777


Q ss_pred             ccEEEeccCCCCceeEeCC----Cccccccccccccc
Q 009315          453 LLVLKLWVLKELKRWSIEK----ETMPKLRELEIRRC  485 (537)
Q Consensus       453 L~~L~l~~~~~l~~~~~~~----~~~~~L~~L~l~~c  485 (537)
                      +..+.+.+- .++.|....    +.+|.+.++.+.+|
T Consensus       821 i~~~~l~~~-~l~~~~ve~~p~l~~~P~~~~~~i~~~  856 (889)
T KOG4658|consen  821 LYWLPLSFL-KLEELIVEECPKLGKLPLLSTLTIVGC  856 (889)
T ss_pred             eEecccCcc-chhheehhcCcccccCccccccceecc
Confidence            766666553 255444443    45566666666664

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query537
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-07
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 4e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 72.6 bits (177), Expect = 2e-13
 Identities = 90/611 (14%), Positives = 182/611 (29%), Gaps = 200/611 (32%)

Query: 11  DQSTTLDQLSFRDISSIW-------------------VFANKSL-----SPHLKACLHYF 46
           D  T   Q  ++DI S++                   + + + +     S    +     
Sbjct: 8   DFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGT--L 65

Query: 47  RLF------PKS-YEVSVRRLLQL---WLAERLETPIEENYMAPEDQVKTIFDQLE-LMN 95
           RLF       +   +  V  +L++   +L       I+     P    +   +Q + L N
Sbjct: 66  RLFWTLLSKQEEMVQKFVEEVLRINYKFLMSP----IKTEQRQPSMMTRMYIEQRDRLYN 121

Query: 96  MIEV-----VKR--------------KPD---------GKPKTCRVPSSLSDNLFPKAES 127
             +V     V R              +P          G  KT                 
Sbjct: 122 DNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMD 181

Query: 128 GGVFCIHGVSRSNATSGSSDLCVRRLAELLVNRNNSYAS-GKHLERLHSYLSFDNRKGDK 186
             +F ++ +   N    S +  +  L +LL   + ++ S   H   +   L   + +   
Sbjct: 182 FKIFWLN-LKNCN----SPETVLEMLQKLLYQIDPNWTSRSDHSSNI--KLRIHSIQ--- 231

Query: 187 PAAEVGNLLNRTISKRGYR--LLRVLDLERVYKPVLPETIGKLRLLRHVGLRWTFLDSIP 244
                   L R +  + Y   LL VL                     +V           
Sbjct: 232 ------AELRRLLKSKPYENCLL-VLL--------------------NV---Q------- 254

Query: 245 KSLGDLPSLETLDVK-RTNIATLPKSI---WKSSTLRHLYMSDIRFQLSAQKPFVNSSLT 300
               +  +    ++  +  + T  K +     ++T  H+ +              + +LT
Sbjct: 255 ----NAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDH-----------HSMTLT 299

Query: 301 KLQTLWGLLIGKKSRPLNWLRNS-KDLRKLGLTFH-------FESLQDQEIT--KWIK-D 349
             +    LL       L +L    +DL +  LT +        ES++D   T   W   +
Sbjct: 300 PDEVK-SLL-------LKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVN 351

Query: 350 LEHLESLMLRSVNDFLEPSDL-----DFGNLSKHKKLTELYLIGKLPRAI---DINDQLP 401
            + L +++  S+N  LEP++                +  + L      ++   D+     
Sbjct: 352 CDKLTTIIESSLNV-LEPAEYRKMFDRLSVFPPSAHIPTILL------SLIWFDVIKSDV 404

Query: 402 EKLTVFTLSLSHLSKDP------MPVLGQLKELKILRLFA-HSYIGEQMTCQKGWFPQLL 454
             +       S + K P      +P +    ++K+   +A H  I +     K +    L
Sbjct: 405 MVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDL 464

Query: 455 VLKLWV-----------LKELKRWSIEKETMPK----LRELEIRRCQKLKNPFESTNLTG 499
            +  ++           LK ++                R LE    QK+++   + N +G
Sbjct: 465 -IPPYLDQYFYSHIGHHLKNIEH-PERMTLFRMVFLDFRFLE----QKIRHDSTAWNASG 518

Query: 500 LKELTLTDMEK 510
               TL  ++ 
Sbjct: 519 SILNTLQQLKF 529
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query537
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.95
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.91
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.87
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.86
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.76
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.75
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.74
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.72
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.72
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.7
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.7
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.68
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.68
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.67
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.67
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.63
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.63
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.6
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.58
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.57
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.57
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.57
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.56
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.53
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.53
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.45
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.43
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.4
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.38
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.37
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.36
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.33
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.19
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.15
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.12
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.03
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.91
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.88
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.88
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.86
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.84
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.75
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.53
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.42
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.23
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.23
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.19
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.01
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.97
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.91
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.6
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.27
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.0
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.66
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.83
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.97  E-value=2e-32  Score=297.37  Aligned_cols=249  Identities=24%  Similarity=0.250  Sum_probs=121.2

Q ss_pred             cCceeEEEeccCCCC-CCChhhhhhhhhhhccccCCceeeEEEcCCCCCC-CCchh-hccccccceeecCCCCCC-ccCc
Q 009315          170 LERLHSYLSFDNRKG-DKPAAEVGNLLNRTISKRGYRLLRVLDLERVYKP-VLPET-IGKLRLLRHVGLRWTFLD-SIPK  245 (537)
Q Consensus       170 ~~~Lr~l~~~~~~~~-~~p~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~-~lp~~-~~~l~~L~~L~l~~~~i~-~lp~  245 (537)
                      +++|+.|.+.++... .+|.. +.+          +++|++|++++|.+. .+|.. ++++++|++|++++|.+. .+|.
T Consensus       293 ~~~L~~L~Ls~n~l~~~~p~~-~~~----------l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~  361 (768)
T 3rgz_A          293 CDTLTGLDLSGNHFYGAVPPF-FGS----------CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE  361 (768)
T ss_dssp             CTTCSEEECCSSEEEECCCGG-GGG----------CTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCT
T ss_pred             cCcCCEEECcCCcCCCccchH-Hhc----------CCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccH
Confidence            467777766655433 33322 332          556666666655543 55543 556666666666666553 5555


Q ss_pred             ccCCCC-CCcEEeecCCccc-cCCccccc--cccccEEeccccccccccCCCccCCccccccccceEEecCCCCchHHhh
Q 009315          246 SLGDLP-SLETLDVKRTNIA-TLPKSIWK--SSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLLIGKKSRPLNWLR  321 (537)
Q Consensus       246 ~l~~l~-~L~~L~L~~~~l~-~lp~~i~~--l~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~~~~~~~~~~~~~~l~  321 (537)
                      .+.++. +|++|++++|.++ .+|..+..  +++|++|++++|.+.+  .+|..++.+++|+.|++..|...+..|..++
T Consensus       362 ~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~--~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~  439 (768)
T 3rgz_A          362 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG--KIPPTLSNCSELVSLHLSFNYLSGTIPSSLG  439 (768)
T ss_dssp             THHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEE--ECCGGGGGCTTCCEEECCSSEEESCCCGGGG
T ss_pred             HHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCcccc--ccCHHHhcCCCCCEEECcCCcccCcccHHHh
Confidence            555554 5555555555544 34444443  4455555555555544  3444455555555555555544444444555


Q ss_pred             cCccCcEEeEEEecccccHHHHHHHhccCCCcceEEEEeeCCCCCCCccccCCCCCCCCcceEEEeeecC--CcCCcccc
Q 009315          322 NSKDLRKLGLTFHFESLQDQEITKWIKDLEHLESLMLRSVNDFLEPSDLDFGNLSKHKKLTELYLIGKLP--RAIDINDQ  399 (537)
Q Consensus       322 ~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~~~~L~~l~l~~~~~--~~~~~~~~  399 (537)
                      .+++|+.|++++|.+.+   .+|..+..+++|+.|++++ +.+.+..+.   .+..+++|+.+++.++.-  ..+.++..
T Consensus       440 ~l~~L~~L~L~~n~l~~---~~p~~~~~l~~L~~L~L~~-N~l~~~~p~---~l~~l~~L~~L~L~~N~l~~~~p~~~~~  512 (768)
T 3rgz_A          440 SLSKLRDLKLWLNMLEG---EIPQELMYVKTLETLILDF-NDLTGEIPS---GLSNCTNLNWISLSNNRLTGEIPKWIGR  512 (768)
T ss_dssp             GCTTCCEEECCSSCCCS---CCCGGGGGCTTCCEEECCS-SCCCSCCCG---GGGGCTTCCEEECCSSCCCSCCCGGGGG
T ss_pred             cCCCCCEEECCCCcccC---cCCHHHcCCCCceEEEecC-CcccCcCCH---HHhcCCCCCEEEccCCccCCcCChHHhc
Confidence            55555555555555443   3344444555555555554 233322221   122334445554443210  11112222


Q ss_pred             CCCCeeEEEEecccCCCCchhhhhcCCCccEEEecccccc
Q 009315          400 LPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYI  439 (537)
Q Consensus       400 ~~~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~  439 (537)
                      + ++|+.|++++|.+.+.+|..++.+++|+.|++++|.+.
T Consensus       513 l-~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~  551 (768)
T 3rgz_A          513 L-ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFN  551 (768)
T ss_dssp             C-TTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEE
T ss_pred             C-CCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccC
Confidence            2 45555555555554444555555555555555555444
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 537
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 46.2 bits (108), Expect = 5e-06
 Identities = 46/281 (16%), Positives = 88/281 (31%), Gaps = 20/281 (7%)

Query: 207 LRVLDLERVY-KPVLPETIGKLRLLRHVGLRWTFLDSI-PKSLGDLPSLETLDVKRTNIA 264
             +LDL+      +       L+ L  + L    +  I P +   L  LE L + +  + 
Sbjct: 33  TALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLK 92

Query: 265 TLPKSIWKSSTLRHLYMSDIRFQLSAQKPFVNSSLTKLQTLWGLLIGKKSRPLNWLRNSK 324
            LP+ + K+     L + +       +  F   +   +  L    +          +  K
Sbjct: 93  ELPEKMPKTLQ--ELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMK 150

Query: 325 DLRKLGLTFHFESLQDQEITKWIKD-LEHLESLMLRSVNDFLEPSDLDFGNLSKHKKLTE 383
            L        +  + D  IT   +     L  L L   N   +        L+   KL  
Sbjct: 151 KLS-------YIRIADTNITTIPQGLPPSLTELHLDG-NKITKVDAASLKGLNNLAKLGL 202

Query: 384 LYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAH--SYIGE 441
            +         + +      L    L+ + L K P  +    K ++++ L  +  S IG 
Sbjct: 203 SFNSI--SAVDNGSLANTPHLRELHLNNNKLVKVPGGL-ADHKYIQVVYLHNNNISAIGS 259

Query: 442 QMTCQKGWFPQLLVLKLWVLKE--LKRWSIEKETMPKLREL 480
              C  G+  +        L    ++ W I+  T   +   
Sbjct: 260 NDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVR 300
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query537
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.76
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.73
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.56
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.52
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.38
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.3
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.21
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.09
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.04
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.94
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.94
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.9
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.97
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.93
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.92
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.24
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.36
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.90  E-value=3.9e-23  Score=203.84  Aligned_cols=302  Identities=20%  Similarity=0.131  Sum_probs=147.5

Q ss_pred             CcCceeEEEeccCCCCCCChhhhhhhhhhhccccCCceeeEEEcCCCCCCCCchhhccccccceeecCCCCCCccCcccC
Q 009315          169 HLERLHSYLSFDNRKGDKPAAEVGNLLNRTISKRGYRLLRVLDLERVYKPVLPETIGKLRLLRHVGLRWTFLDSIPKSLG  248 (537)
Q Consensus       169 ~~~~Lr~l~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~lp~~~~~l~~L~~L~l~~~~i~~lp~~l~  248 (537)
                      ++.++++|.+.++....+..  ++          .+++|++|++++|.++.+|+ ++++++|++|++++|.+..++. ++
T Consensus        42 ~l~~l~~L~l~~~~I~~l~g--l~----------~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~i~~i~~-l~  107 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSIDG--VE----------YLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQIADITP-LA  107 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCTT--GG----------GCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCCCCGG-GT
T ss_pred             HhCCCCEEECCCCCCCCccc--cc----------cCCCCCEEeCcCCcCCCCcc-ccCCcccccccccccccccccc-cc
Confidence            45566666666655544421  22          25667777777777766653 6677777777777777766654 66


Q ss_pred             CCCCCcEEeecCCccccCCccccccccccEEeccccccccc---------------------------------------
Q 009315          249 DLPSLETLDVKRTNIATLPKSIWKSSTLRHLYMSDIRFQLS---------------------------------------  289 (537)
Q Consensus       249 ~l~~L~~L~L~~~~l~~lp~~i~~l~~L~~L~l~~~~~~~~---------------------------------------  289 (537)
                      ++++|+.|+++++.++.++.. .....+..+....+.+...                                       
T Consensus       108 ~l~~L~~L~~~~~~~~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (384)
T d2omza2         108 NLTNLTGLTLFNNQITDIDPL-KNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNK  186 (384)
T ss_dssp             TCTTCCEEECCSSCCCCCGGG-TTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSC
T ss_pred             ccccccccccccccccccccc-cccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccc
Confidence            677777777776665544322 2222333333222221110                                       


Q ss_pred             cCCCccCCccccccccceEEecCCCCchHHhhcCccCcEEeEEEecccccHHHHHHHhccCCCcceEEEEeeCCCCCCCc
Q 009315          290 AQKPFVNSSLTKLQTLWGLLIGKKSRPLNWLRNSKDLRKLGLTFHFESLQDQEITKWIKDLEHLESLMLRSVNDFLEPSD  369 (537)
Q Consensus       290 ~~~~~~~~~l~~L~~L~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~  369 (537)
                      .........+++++.+.+..+......+  ...+++|+.|++++|.+..    + ..+..+++|+.|++++ +.+++.  
T Consensus       187 ~~~~~~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~----~-~~l~~l~~L~~L~l~~-n~l~~~--  256 (384)
T d2omza2         187 VSDISVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKD----I-GTLASLTNLTDLDLAN-NQISNL--  256 (384)
T ss_dssp             CCCCGGGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCC----C-GGGGGCTTCSEEECCS-SCCCCC--
T ss_pred             cccccccccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCC----c-chhhcccccchhcccc-CccCCC--
Confidence            0011122333444444444433332211  3344555555555555442    1 1244555555555554 222221  


Q ss_pred             cccCCCCCCCCcceEEEeeecCCcCCccccCCCCeeEEEEecccCCCCchhhhhcCCCccEEEeccccccCceeeecCCC
Q 009315          370 LDFGNLSKHKKLTELYLIGKLPRAIDINDQLPEKLTVFTLSLSHLSKDPMPVLGQLKELKILRLFAHSYIGEQMTCQKGW  449 (537)
Q Consensus       370 ~~~~~l~~~~~L~~l~l~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~  449 (537)
                         ..+..+++|+.+++.+..-..+..+..+ +.++.+++..|.+.+  +..+..+++++.|++++|.+.+..+   +..
T Consensus       257 ---~~~~~~~~L~~L~l~~~~l~~~~~~~~~-~~l~~l~~~~n~l~~--~~~~~~~~~l~~L~ls~n~l~~l~~---l~~  327 (384)
T d2omza2         257 ---APLSGLTKLTELKLGANQISNISPLAGL-TALTNLELNENQLED--ISPISNLKNLTYLTLYFNNISDISP---VSS  327 (384)
T ss_dssp             ---GGGTTCTTCSEEECCSSCCCCCGGGTTC-TTCSEEECCSSCCSC--CGGGGGCTTCSEEECCSSCCSCCGG---GGG
T ss_pred             ---CcccccccCCEeeccCcccCCCCccccc-ccccccccccccccc--ccccchhcccCeEECCCCCCCCCcc---ccc
Confidence               1233345555555544322222222222 455555555555542  2245555666666666665544211   445


Q ss_pred             CccccEEEeccCCCCceeEeCCCcccccccccccccccCCCccccCCCCCCCEEEEec
Q 009315          450 FPQLLVLKLWVLKELKRWSIEKETMPKLRELEIRRCQKLKNPFESTNLTGLKELTLTD  507 (537)
Q Consensus       450 ~~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~c~~l~lp~~~~~l~~L~~L~l~~  507 (537)
                      +++|++|++++| .++.++ ....+|+|++|++++|+...++. +.++++|+.|++++
T Consensus       328 l~~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~N~l~~l~~-l~~l~~L~~L~L~~  382 (384)
T d2omza2         328 LTKLQRLFFANN-KVSDVS-SLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLND  382 (384)
T ss_dssp             CTTCCEEECCSS-CCCCCG-GGGGCTTCCEEECCSSCCCBCGG-GTTCTTCSEEECCC
T ss_pred             CCCCCEEECCCC-CCCCCh-hHcCCCCCCEEECCCCcCCCChh-hccCCCCCEeeCCC
Confidence            566666666655 333333 23455566666666555444332 55556666666554
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure