Citrus Sinensis ID: 009441

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530----
MLRSVFCKHTLLISTSGWLNLPRVICSSSSLSSSDSKTSTATMMSQSKLPSPPVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEVIFFFLF
cccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEcccEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccEEEccEEEEEEEcccccEEEEEEEEcccccccccccccccccccccccEEEEEccccccccccEEEEEEEEcccccEEEEEEEccccEEEEEEEEEccccccccccccccEEEEEEEccccEEEEEEcccccccEEEEEEccccccccEEEEEEcccccEEEEEEEccccEEEEEEccccccEEEEEEcccccccEEEEccccccEEEEEEcccEEEEEEcccccccEEEEEEccccccccEEEEcccccEEEEEEEEEccEEEEEEEcccEEEEEEEEccccccccccccccEEEEEcccEEEEccccccccccEEEEEEEcccccccEEEEEcccccEEEEEEccccccccccccEEEEEEEEcccccEEcEEEEEEcccccccccccEEEEEcccccccccccc
ccHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEcccccEcccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccccccEEEEEccccccccccccccccccccccccEEEEcccHHHccccEEEEEEEEEcccccEEEEEEEccccEEEEEEEEEcccccccccccccccccEEEEcccEEEEEEEcccccccEEEEEEccccccccEEEEEcccccEEEEEEEcccccEEEEEEcccccEEEEEEEcccccccEEEEEccccEEEEEcccccEEEEEEEccccccEEEEEEccccHHHcEEEcccccccEEccHHHHHHHEEEHEHHccccEEEEEEccccccccccccccEEEEcccccEEEccccccccccEEEEEEEcccccccEEEEccccccEEEEEcccccccccHHHcEEEEEEEEcccccEEEEEEEEEcccccccccccEEEEEcccccccccccc
MLRSVFCKHTLListsgwlnlprvicsssslsssdsktstatmmsqsklpsppvakkvEHKMelfgdvrvdnyywlrddsrsdpEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGRikqedvsapfrqgsyYYYTRTLEGKEYVQHCRRlihnneappsvhdtmetgpdappehlildenvkaegrgfysvgcfqvspdnklvayaedtkgdeiYTVYVIDietgtpvgkplvGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEadqsndiclyhekddiyslglqaseskKFLFIASESKITRFVFYLdvskpeelrvltprvvgvdtaashrgnhffitrrsdelfnsellacpvdntsettvliphresvklqDIQLFIDHLAVYEregglqkittyrlpavgeplkslqggksvefidpvysidpsesvfssRILRFhysslrtppsvydydmDMGISVLKKIETVLggfdtnnyfterkwasasdgtqipiCIVYRknlvkldgsdplllygygsYEVIFFFLF
MLRSVFCKHTLListsgwlnlpRVICSSSSLSSSDSktstatmmsqsklpsppvAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGrikqedvsapfrqGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDvskpeelrvltprvvgvdtaashrgnhFFITRRSDELFNSELLACPVDNTSETTVLIphresvklqdIQLFIDHLAVYEREGGLQKITTYRLPAVgeplkslqggksvEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTErkwasasdgtqipICIVYRKNLVKLDGSDPLLLYGYGSYEVIFFFLF
MLRSVFCKHTLLISTSGWLNLPRVICsssslsssdsktstatmmsQSKLPSPPVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEVIFFFLF
****VFCKHTLLISTSGWLNLPRVIC***********************************MELFGDVRVDNYYWLRDD*****EVLAYLKQENDYF*************MFAELKGRIK*EDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIH**********************LILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEVIFFFL*
*******KHTLLISTSGWLNLPRVICSSSS************************AKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEVIFFFLF
MLRSVFCKHTLLISTSGWLNLPRVIC****************************AKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEVIFFFLF
MLRSVFCKHTLLISTSGWLNLPRVICSSSSLS****************LPSPPVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEVIFF*LF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRSVFCKHTLLISTSGWLNLPRVICSSSSLSSSDSKTSTATMMSQSKLPSPPVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEVIFFFLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query534 2.2.26 [Sep-21-2011]
P24555 686 Protease 2 OS=Escherichia N/A no 0.831 0.647 0.345 2e-61
Q59536 690 Protease 2 OS=Moraxella l N/A no 0.840 0.650 0.290 6e-57
P55627 754 Uncharacterized peptidase no no 0.831 0.588 0.274 6e-36
P55656 705 Uncharacterized peptidase no no 0.852 0.645 0.264 1e-35
Q06903 690 Prolyl endopeptidase OS=A no no 0.807 0.624 0.248 5e-25
P27028 705 Prolyl endopeptidase OS=F N/A no 0.794 0.601 0.235 5e-24
P27195 705 Prolyl endopeptidase OS=E N/A no 0.803 0.608 0.234 2e-19
Q5ZKL5 732 Prolyl endopeptidase-like yes no 0.591 0.431 0.235 3e-13
Q32N48 707 Prolyl endopeptidase-like N/A no 0.629 0.475 0.241 2e-11
Q4J6C6 727 Prolyl endopeptidase-like yes no 0.591 0.434 0.241 4e-09
>sp|P24555|PTRB_ECOLI Protease 2 OS=Escherichia coli (strain K12) GN=ptrB PE=1 SV=2 Back     alignment and function desciption
 Score =  237 bits (605), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 167/483 (34%), Positives = 242/483 (50%), Gaps = 39/483 (8%)

Query: 53  PVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMF 112
           P A ++ H M L GD R+DNYYWLRDD+RS PEVL YL+QEN Y    M+  + ++D + 
Sbjct: 3   PKAARIPHAMTLHGDTRIDNYYWLRDDTRSQPEVLDYLQQENSYGHRVMASQQALQDRIL 62

Query: 113 AELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDA 172
            E+  RI Q +VSAP+ +  Y Y      G EY  + R+   + E      D  ET    
Sbjct: 63  KEIIDRIPQREVSAPYIKNGYRYRHIYEPGCEYAIYQRQSAFSEEW-----DEWET---- 113

Query: 173 PPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGK 232
                +LD N +A    FYS+G   ++PDN ++A AED      Y +   ++ETG    +
Sbjct: 114 -----LLDANKRAAHSEFYSMGGMAITPDNTIMALAEDFLSRRQYGIRFRNLETGNWYPE 168

Query: 233 PLVGVTASVEWAGNEALVYITMDE--ILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGL 290
            L  V  S  WA +  + Y        L P + W H +    S D  +Y EKDD Y + L
Sbjct: 169 LLDNVEPSFVWANDSWIFYYVRKHPVTLLPYQVWRHAIGTPASQDKLIYEEKDDTYYVSL 228

Query: 291 QASESKKFLFIASESKITRFVFYLDVSKPE-ELRVLTPRVVGVDTAASHRGNHFFITRRS 349
             + SK ++ I   S  T  V  LD    + E  V  PR    + +  H  + F++ R +
Sbjct: 229 HKTTSKHYVVIHLASATTSEVRLLDAEMADAEPFVFLPRRKDHEYSLDHYQHRFYL-RSN 287

Query: 350 DELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPA 409
               N  L    + +  +   LIP RE++ L+   LF D L V ER+ GL       L  
Sbjct: 288 RHGKNFGLYRTRMRDEQQWEELIPPRENIMLEGFTLFTDWLVVEERQRGLTS-----LRQ 342

Query: 410 VGEPLKSLQGGKSVEFIDPVY----SIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMG 465
           +    + + G   + F DP Y    + +P     ++R LR+ YSS+ TP ++++ DMD G
Sbjct: 343 INRKTREVIG---IAFDDPAYVTWIAYNPEPE--TAR-LRYGYSSMTTPDTLFELDMDTG 396

Query: 466 -ISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVY-RKNLVKLDGSDPLLLYGY 523
              VLK+ E  + GF   NY +E  W  A DG ++P+ +VY RK+  K  G +PLL+YGY
Sbjct: 397 ERRVLKQTE--VPGFYAANYRSEHLWIVARDGVEVPVSLVYHRKHFRK--GHNPLLVYGY 452

Query: 524 GSY 526
           GSY
Sbjct: 453 GSY 455
Cleaves peptide bonds on the C-terminal side of lysyl and argininyl residues.
Escherichia coli (strain K12) (taxid: 83333)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 8EC: 3
>sp|Q59536|PTRB_MORLA Protease 2 OS=Moraxella lacunata GN=ptrB PE=3 SV=1 Back     alignment and function description
>sp|P55627|Y4QF_RHISN Uncharacterized peptidase y4qF OS=Rhizobium sp. (strain NGR234) GN=NGR_a01920 PE=3 SV=1 Back     alignment and function description
>sp|P55656|Y4SO_RHISN Uncharacterized peptidase y4sO OS=Rhizobium sp. (strain NGR234) GN=NGR_a01580 PE=3 SV=1 Back     alignment and function description
>sp|Q06903|PPCE_AERHY Prolyl endopeptidase OS=Aeromonas hydrophila PE=1 SV=2 Back     alignment and function description
>sp|P27028|PPCE_FLAME Prolyl endopeptidase OS=Flavobacterium meningosepticum GN=f1pep1 PE=1 SV=1 Back     alignment and function description
>sp|P27195|PPCF_ELIMR Prolyl endopeptidase OS=Elizabethkingia miricola PE=1 SV=1 Back     alignment and function description
>sp|Q5ZKL5|PPCEL_CHICK Prolyl endopeptidase-like OS=Gallus gallus GN=PREPL PE=2 SV=1 Back     alignment and function description
>sp|Q32N48|PPCEL_XENLA Prolyl endopeptidase-like OS=Xenopus laevis GN=prepl PE=2 SV=1 Back     alignment and function description
>sp|Q4J6C6|PPCEL_HUMAN Prolyl endopeptidase-like OS=Homo sapiens GN=PREPL PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query534
359484112 719 PREDICTED: protease 2-like isoform 2 [Vi 0.911 0.677 0.730 0.0
359484110 717 PREDICTED: protease 2-like isoform 1 [Vi 0.911 0.679 0.730 0.0
224095196 711 predicted protein [Populus trichocarpa] 0.895 0.672 0.739 0.0
449458732 757 PREDICTED: protease 2-like [Cucumis sati 0.943 0.665 0.700 0.0
297847380 710 prolyl oligopeptidase family protein [Ar 0.904 0.680 0.718 0.0
18403046 710 oligopeptidase B [Arabidopsis thaliana] 0.904 0.680 0.709 0.0
297742722 698 unnamed protein product [Vitis vinifera] 0.874 0.669 0.737 0.0
225463781 694 PREDICTED: protease 2-like [Vitis vinife 0.878 0.675 0.744 0.0
297742723 755 unnamed protein product [Vitis vinifera] 0.878 0.621 0.744 0.0
356575387 766 PREDICTED: protease 2-like [Glycine max] 0.889 0.620 0.735 0.0
>gi|359484112|ref|XP_003633066.1| PREDICTED: protease 2-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/489 (73%), Positives = 424/489 (86%), Gaps = 2/489 (0%)

Query: 41  ATMMSQSKLPSPPVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESA 100
           AT  +Q  LP PPVA KV+H+ME+FGDVR+DNYYWLRDDSRSDP+VL+YL+ EN Y +  
Sbjct: 2   ATAKAQP-LPPPPVANKVKHEMEMFGDVRIDNYYWLRDDSRSDPQVLSYLRDENAYTDLL 60

Query: 101 MSGTKKIEDNMFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPP 160
           MSGTK +E+ ++AE++GRIK++D+S P R+G YYYY RTLEGKEYVQ+CRRL+ N E PP
Sbjct: 61  MSGTKHLENQIYAEIRGRIKEDDISVPLRKGPYYYYQRTLEGKEYVQYCRRLVPNVEVPP 120

Query: 161 SVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVY 220
           SV++TM TGP APPEH+ILDEN+KA+   +YS+G F++SP++KLVAYAEDTKGDEIYTVY
Sbjct: 121 SVYETMPTGPSAPPEHVILDENIKAQEHAYYSIGAFKISPNSKLVAYAEDTKGDEIYTVY 180

Query: 221 VIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYH 280
           VID ET  PVGKP+VGVT  +EW G+EAL+YITMDE LRPDK WLHKLE DQS+D CLYH
Sbjct: 181 VIDAETRAPVGKPIVGVTPYLEWVGDEALLYITMDETLRPDKVWLHKLETDQSSDSCLYH 240

Query: 281 EKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPE-ELRVLTPRVVGVDTAASHR 339
           EKD+++S+ L+ASESKKF+F+ SESK TRF+F LDVSKPE  L VLTPR+ G+DT+ASHR
Sbjct: 241 EKDNMFSVDLEASESKKFVFVGSESKTTRFIFNLDVSKPEGGLMVLTPRLDGIDTSASHR 300

Query: 340 GNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGL 399
           GNHFFI RRSDE FNSE+LACP++N SETTVL+PHRESVK+QDIQLF  HL VYERE GL
Sbjct: 301 GNHFFIKRRSDEFFNSEVLACPLNNISETTVLLPHRESVKIQDIQLFSGHLVVYERENGL 360

Query: 400 QKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYD 459
            K+T YRLPAVGEPL SLQGG++V+F+DP+YS+DPSES FSS ILRF YSSLRTP SVYD
Sbjct: 361 PKVTFYRLPAVGEPLGSLQGGRTVDFLDPIYSVDPSESQFSSSILRFSYSSLRTPDSVYD 420

Query: 460 YDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLL 519
           YDM+ G+SVLKKI+TVLG FD + Y TERKWA+A DGTQIPI IVYRK+LVKLDGSDPLL
Sbjct: 421 YDMNTGVSVLKKIQTVLGNFDASKYITERKWANAQDGTQIPISIVYRKDLVKLDGSDPLL 480

Query: 520 LYGYGSYEV 528
           LYGYGSYE+
Sbjct: 481 LYGYGSYEI 489

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359484110|ref|XP_003633065.1| PREDICTED: protease 2-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224095196|ref|XP_002310359.1| predicted protein [Populus trichocarpa] gi|222853262|gb|EEE90809.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449458732|ref|XP_004147101.1| PREDICTED: protease 2-like [Cucumis sativus] gi|449517064|ref|XP_004165566.1| PREDICTED: protease 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297847380|ref|XP_002891571.1| prolyl oligopeptidase family protein [Arabidopsis lyrata subsp. lyrata] gi|297337413|gb|EFH67830.1| prolyl oligopeptidase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18403046|ref|NP_564567.1| oligopeptidase B [Arabidopsis thaliana] gi|5734786|gb|AAD50051.1|AC007980_16 Similar to oligopeptidases [Arabidopsis thaliana] gi|19310465|gb|AAL84967.1| At1g50380/F14I3_27 [Arabidopsis thaliana] gi|332194421|gb|AEE32542.1| oligopeptidase B [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297742722|emb|CBI35356.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225463781|ref|XP_002267891.1| PREDICTED: protease 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742723|emb|CBI35357.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356575387|ref|XP_003555823.1| PREDICTED: protease 2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query534
TAIR|locus:2011997 710 AT1G50380 [Arabidopsis thalian 0.895 0.673 0.716 3.9e-195
TIGR_CMR|CPS_3026 704 CPS_3026 "protease II" [Colwel 0.850 0.644 0.319 7.9e-62
UNIPROTKB|Q4KGJ9 684 ptrB "Protease 2" [Pseudomonas 0.822 0.641 0.317 1.5e-53
UNIPROTKB|P24555 686 ptrB "oligopeptidase B" [Esche 0.627 0.488 0.337 1.7e-44
TIGR_CMR|SO_0144 711 SO_0144 "protease II" [Shewane 0.636 0.478 0.330 7.3e-44
TIGR_CMR|CPS_4644 719 CPS_4644 "protease II" [Colwel 0.632 0.470 0.318 1.3e-43
UNIPROTKB|P71835236 ptrBa "PROBABLE PROTEASE II PT 0.374 0.847 0.425 2.6e-40
TAIR|locus:2205415 757 AT1G69020 [Arabidopsis thalian 0.361 0.254 0.325 1.1e-36
TAIR|locus:2158098 792 AT5G66960 [Arabidopsis thalian 0.754 0.508 0.265 4e-27
TIGR_CMR|CPS_0086 723 CPS_0086 "prolyl endopeptidase 0.625 0.461 0.279 5.9e-26
TAIR|locus:2011997 AT1G50380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1890 (670.4 bits), Expect = 3.9e-195, P = 3.9e-195
 Identities = 343/479 (71%), Positives = 416/479 (86%)

Query:    51 SPPVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDN 110
             SPPVAKKVEH ME+FGDVRVDNYYWLRDDSR++P++L+YL++EN Y +  MSGTK+ E+ 
Sbjct:     6 SPPVAKKVEHVMEMFGDVRVDNYYWLRDDSRTNPDMLSYLREENHYTDFVMSGTKQFENQ 65

Query:   111 MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGP 170
             +FAE++GRIK++D+SAP R+G YYYY + L+GKEY+QHCRRLI +N+A PSV+DTM TGP
Sbjct:    66 LFAEIRGRIKEDDISAPLRKGPYYYYEKNLQGKEYIQHCRRLITDNKAEPSVYDTMPTGP 125

Query:   171 DAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPV 230
             DAPPEH+ILDEN KA+   +Y +G F+ SPD+KLVAYAEDTKGDEIYTV VID E   PV
Sbjct:   126 DAPPEHVILDENTKAQEHDYYRIGAFKASPDHKLVAYAEDTKGDEIYTVNVIDSEALKPV 185

Query:   231 GKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGL 290
             G+ L G+T+ +EWAGN+AL+YITMDEILRPDK WLHKL  +QS+D+CLYHEKDD++SL L
Sbjct:   186 GQQLKGLTSYLEWAGNDALLYITMDEILRPDKVWLHKLGTEQSSDVCLYHEKDDMFSLEL 245

Query:   291 QASESKKFLFIASESKITRFVFYLDVSKPEE-LRVLTPRVVGVDTAASHRGNHFFITRRS 349
              ASES K+LF+ASESK TRFVF LDVSK ++ LRVLTPRV G+D++ SHRGNHFFI RRS
Sbjct:   246 HASESHKYLFVASESKTTRFVFSLDVSKTQDGLRVLTPRVDGIDSSVSHRGNHFFIQRRS 305

Query:   350 DELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPA 409
              E +NSEL+ACPVD+TS+TTVL+PHRESVK+Q+IQLF DHLAV+ERE GLQKIT +RLPA
Sbjct:   306 TEFYNSELIACPVDDTSKTTVLLPHRESVKIQEIQLFRDHLAVFERENGLQKITVHRLPA 365

Query:   410 VGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVL 469
              G+PL+ LQGG++V F+DPVYS+D +ES FSSR+LRF Y S++TPPSVYDYDMD G SV+
Sbjct:   366 EGQPLEGLQGGRNVSFVDPVYSVDSTESEFSSRVLRFKYCSMKTPPSVYDYDMDSGTSVV 425

Query:   470 KKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEV 528
             KKI+TVLGGFD +NY TERKW +ASDGTQIP+ IVY K L KLDGSDPLLLYGYGSYE+
Sbjct:   426 KKIDTVLGGFDASNYVTERKWVAASDGTQIPMSIVYNKKLAKLDGSDPLLLYGYGSYEI 484
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008236 "serine-type peptidase activity" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=IDA
GO:0010048 "vernalization response" evidence=RCA
TIGR_CMR|CPS_3026 CPS_3026 "protease II" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KGJ9 ptrB "Protease 2" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|P24555 ptrB "oligopeptidase B" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0144 SO_0144 "protease II" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4644 CPS_4644 "protease II" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P71835 ptrBa "PROBABLE PROTEASE II PTRBA [FIRST PART] (OLIGOPEPTIDASE B)" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TAIR|locus:2205415 AT1G69020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158098 AT5G66960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0086 CPS_0086 "prolyl endopeptidase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.21LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_VII0238
hypothetical protein (712 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.89040001
Predicted protein (206 aa)
•       0.432
gw1.21444.1.1
Phosphoribosylaminoimidazole-succinocarboxamide synthase (285 aa)
•       0.420
gw1.XIV.1527.1
hexaprenyldihydroxybenzoate methyltransferase (EC-2.1.1.114) (250 aa)
      • 0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query534
COG1770 682 COG1770, PtrB, Protease II [Amino acid transport a 1e-142
pfam02897412 pfam02897, Peptidase_S9_N, Prolyl oligopeptidase, 1e-116
PRK10115 686 PRK10115, PRK10115, protease 2; Provisional 4e-77
COG1505 648 COG1505, COG1505, Serine proteases of the peptidas 2e-15
>gnl|CDD|224684 COG1770, PtrB, Protease II [Amino acid transport and metabolism] Back     alignment and domain information 
 Score =  426 bits (1097), Expect = e-142
 Identities = 199/485 (41%), Positives = 279/485 (57%), Gaps = 32/485 (6%)

Query: 49  LPSPPVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIE 108
           LP PP+AKKV       GD RVD+Y WLRDD+ S+PEVLAYL+ EN Y E+ M+  + ++
Sbjct: 3   LPLPPIAKKVPTTRTHHGDTRVDDYAWLRDDNWSNPEVLAYLEAENAYTEAVMAHLQPLQ 62

Query: 109 DNMFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMET 168
             +F E+KGRIK++D+S P+R+G Y YY+RT EGKEY  +CR+     E           
Sbjct: 63  KKIFEEIKGRIKEDDLSVPYRKGPYEYYSRTEEGKEYPIYCRQPDEGGEG---------- 112

Query: 169 GPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGT 228
                 E ++LD N +AEG  F+S+G   +SPD+ L+AY+ D  GDE YT+   D+ TG 
Sbjct: 113 ------EEVLLDVNKEAEGHDFFSLGAASISPDHNLLAYSVDVLGDEQYTLRFKDLATGE 166

Query: 229 PVGKPLVGVTASVEWAG-NEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYS 287
            +   +   + S  WA   + L Y  +DE  RPDK W H+L    S+D  +Y EKDD + 
Sbjct: 167 ELPDEITNTSGSFAWAADGKTLFYTRLDENHRPDKVWRHRLGTPGSSDELVYEEKDDRFF 226

Query: 288 LGLQASESKKFLFIASESKITRFVFYLDVSKPE-ELRVLTPRVVGVDTAASHRGNHFFIT 346
           L +  S S+ ++ I+  S IT  V  LD   PE E +V+ PR  GV+ +  H G+ F+I 
Sbjct: 227 LSVGRSRSEAYIVISLGSHITSEVRLLDADDPEAEPKVVLPRENGVEYSVEHGGDRFYI- 285

Query: 347 RRSDELFNSELLACPVDNTSET-TVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTY 405
             + +  N +L+  PV         LIPHRE V+L+ + LF DHL + ER+ GL ++   
Sbjct: 286 LSNADGKNFKLVRAPVSADKSNWRELIPHREDVRLEGVDLFADHLVLLERQEGLPRVVVR 345

Query: 406 RLPAVGEPLKSLQGGKSVEFIDPVYS--IDPSESVFSSRILRFHYSSLRTPPSVYDYDMD 463
                 E          + F D  YS  +  +    S R LR+ YSS+ TP +++DYDM 
Sbjct: 346 DRKTGEER--------GIAFDDEAYSAGLSGNPEFDSDR-LRYSYSSMTTPATLFDYDMA 396

Query: 464 MGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGY 523
            G   L K + V GGFD  +Y + R WA+A DG Q+P+ +VYRK+  KLDGS PLLLYGY
Sbjct: 397 TGERTLLKQQEVPGGFDPEDYVSRRIWATADDGVQVPVSLVYRKD-TKLDGSAPLLLYGY 455

Query: 524 GSYEV 528
           G+Y +
Sbjct: 456 GAYGI 460

Length = 682
>gnl|CDD|217275 pfam02897, Peptidase_S9_N, Prolyl oligopeptidase, N-terminal beta-propeller domain Back     alignment and domain information
>gnl|CDD|182247 PRK10115, PRK10115, protease 2; Provisional Back     alignment and domain information
>gnl|CDD|224422 COG1505, COG1505, Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 534
COG1770 682 PtrB Protease II [Amino acid transport and metabol 100.0
PRK10115 686 protease 2; Provisional 100.0
KOG2237 712 consensus Predicted serine protease [Posttranslati 100.0
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 100.0
COG1505 648 Serine proteases of the peptidase family S9A [Amin 100.0
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.64
PRK04792448 tolB translocation protein TolB; Provisional 99.5
PRK05137435 tolB translocation protein TolB; Provisional 99.47
PRK01029428 tolB translocation protein TolB; Provisional 99.43
PRK00178430 tolB translocation protein TolB; Provisional 99.42
PRK04043419 tolB translocation protein TolB; Provisional 99.4
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 99.39
PRK03629429 tolB translocation protein TolB; Provisional 99.39
PRK04922433 tolB translocation protein TolB; Provisional 99.38
PRK02889427 tolB translocation protein TolB; Provisional 99.36
PRK04043419 tolB translocation protein TolB; Provisional 99.35
PRK01029428 tolB translocation protein TolB; Provisional 99.35
PRK05137435 tolB translocation protein TolB; Provisional 99.33
PRK04922433 tolB translocation protein TolB; Provisional 99.27
PRK00178430 tolB translocation protein TolB; Provisional 99.27
PRK04792448 tolB translocation protein TolB; Provisional 99.26
PRK03629429 tolB translocation protein TolB; Provisional 99.23
PRK02889427 tolB translocation protein TolB; Provisional 99.21
PRK01742429 tolB translocation protein TolB; Provisional 99.19
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.04
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.96
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.9
PRK01742429 tolB translocation protein TolB; Provisional 98.84
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.77
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.58
KOG2281 867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 98.5
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.18
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.12
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.11
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.0
COG4946 668 Uncharacterized protein related to the periplasmic 97.9
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.84
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.79
KOG2100 755 consensus Dipeptidyl aminopeptidase [Posttranslati 97.77
KOG2055514 consensus WD40 repeat protein [General function pr 97.77
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.76
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 97.71
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.68
PRK13616591 lipoprotein LpqB; Provisional 97.66
KOG0293519 consensus WD40 repeat-containing protein [Function 97.65
KOG0318 603 consensus WD40 repeat stress protein/actin interac 97.65
PRK11028330 6-phosphogluconolactonase; Provisional 97.62
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.46
KOG0315311 consensus G-protein beta subunit-like protein (con 97.41
KOG0318603 consensus WD40 repeat stress protein/actin interac 97.4
KOG2314698 consensus Translation initiation factor 3, subunit 97.4
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.31
PRK13616591 lipoprotein LpqB; Provisional 97.3
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 97.3
KOG4497 447 consensus Uncharacterized conserved protein WDR8, 97.29
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 97.29
KOG2237 712 consensus Predicted serine protease [Posttranslati 97.24
PRK10115 686 protease 2; Provisional 97.22
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.18
KOG2139445 consensus WD40 repeat protein [General function pr 97.17
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.15
PTZ00421493 coronin; Provisional 97.11
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.09
KOG0293519 consensus WD40 repeat-containing protein [Function 97.05
KOG1273405 consensus WD40 repeat protein [General function pr 97.03
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.02
KOG0266456 consensus WD40 repeat-containing protein [General 97.0
PRK11028330 6-phosphogluconolactonase; Provisional 96.96
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.83
COG4946668 Uncharacterized protein related to the periplasmic 96.77
PTZ00420 568 coronin; Provisional 96.71
KOG0279315 consensus G protein beta subunit-like protein [Sig 96.57
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 96.45
KOG0645312 consensus WD40 repeat protein [General function pr 96.41
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.25
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 96.23
PTZ00420 568 coronin; Provisional 96.18
KOG0973 942 consensus Histone transcription regulator HIRA, WD 96.17
KOG0275508 consensus Conserved WD40 repeat-containing protein 96.16
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.12
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 96.1
KOG1407313 consensus WD40 repeat protein [Function unknown] 96.09
KOG0279315 consensus G protein beta subunit-like protein [Sig 96.04
PTZ00421493 coronin; Provisional 96.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 95.8
KOG2048691 consensus WD40 repeat protein [General function pr 95.67
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.62
KOG1407313 consensus WD40 repeat protein [Function unknown] 95.58
KOG0296399 consensus Angio-associated migratory cell protein 95.46
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.46
KOG0283 712 consensus WD40 repeat-containing protein [Function 95.34
PLN00181793 protein SPA1-RELATED; Provisional 95.13
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 95.01
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 94.98
KOG0266456 consensus WD40 repeat-containing protein [General 94.93
KOG0275508 consensus Conserved WD40 repeat-containing protein 94.86
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 94.82
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 94.82
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 94.72
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 94.67
KOG0973 942 consensus Histone transcription regulator HIRA, WD 94.57
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 94.33
KOG0643327 consensus Translation initiation factor 3, subunit 94.25
KOG0639705 consensus Transducin-like enhancer of split protei 94.11
KOG0771398 consensus Prolactin regulatory element-binding pro 94.1
KOG0278334 consensus Serine/threonine kinase receptor-associa 94.03
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 93.98
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.94
KOG0263707 consensus Transcription initiation factor TFIID, s 93.85
KOG14451012 consensus Tumor-specific antigen (contains WD repe 93.79
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 93.64
KOG0263707 consensus Transcription initiation factor TFIID, s 93.54
KOG0289506 consensus mRNA splicing factor [General function p 93.4
KOG1273405 consensus WD40 repeat protein [General function pr 93.26
KOG1063764 consensus RNA polymerase II elongator complex, sub 93.19
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 93.11
KOG2110391 consensus Uncharacterized conserved protein, conta 92.95
KOG0295406 consensus WD40 repeat-containing protein [Function 92.83
KOG2314698 consensus Translation initiation factor 3, subunit 92.72
KOG1274 933 consensus WD40 repeat protein [General function pr 92.55
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 92.5
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 92.45
KOG2315566 consensus Predicted translation initiation factor 92.3
KOG0771398 consensus Prolactin regulatory element-binding pro 92.27
COG3386307 Gluconolactonase [Carbohydrate transport and metab 92.24
COG3386307 Gluconolactonase [Carbohydrate transport and metab 92.22
COG3391381 Uncharacterized conserved protein [Function unknow 92.21
KOG2096420 consensus WD40 repeat protein [General function pr 92.05
KOG0286343 consensus G-protein beta subunit [General function 91.81
KOG0299479 consensus U3 snoRNP-associated protein (contains W 91.75
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 91.62
KOG0772641 consensus Uncharacterized conserved protein, conta 91.57
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 91.41
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 91.21
KOG0289506 consensus mRNA splicing factor [General function p 90.7
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 90.65
PRK02888 635 nitrous-oxide reductase; Validated 90.32
KOG1539910 consensus WD repeat protein [General function pred 90.19
KOG2055514 consensus WD40 repeat protein [General function pr 90.05
COG3458 321 Acetyl esterase (deacetylase) [Secondary metabolit 89.78
KOG2110391 consensus Uncharacterized conserved protein, conta 89.33
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 89.18
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 88.87
KOG2315566 consensus Predicted translation initiation factor 88.87
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 88.72
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 88.59
KOG4227 609 consensus WD40 repeat protein [General function pr 88.26
KOG0284464 consensus Polyadenylation factor I complex, subuni 88.2
KOG2096420 consensus WD40 repeat protein [General function pr 87.68
KOG0286343 consensus G-protein beta subunit [General function 87.44
KOG0268433 consensus Sof1-like rRNA processing protein (conta 87.23
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 87.07
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 86.91
KOG0640430 consensus mRNA cleavage stimulating factor complex 86.76
KOG0296399 consensus Angio-associated migratory cell protein 86.42
KOG4497447 consensus Uncharacterized conserved protein WDR8, 86.14
KOG0647347 consensus mRNA export protein (contains WD40 repea 86.08
PF05448 320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 85.72
KOG1274 933 consensus WD40 repeat protein [General function pr 85.66
PF12715 390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 85.29
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 85.17
KOG0640430 consensus mRNA cleavage stimulating factor complex 85.12
KOG0278334 consensus Serine/threonine kinase receptor-associa 84.87
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 83.94
KOG0303472 consensus Actin-binding protein Coronin, contains 83.89
KOG0283712 consensus WD40 repeat-containing protein [Function 83.84
KOG4283397 consensus Transcription-coupled repair protein CSA 83.74
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 83.47
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 83.32
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 83.3
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 82.56
KOG14451012 consensus Tumor-specific antigen (contains WD repe 82.4
KOG0315311 consensus G-protein beta subunit-like protein (con 82.29
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 82.16
COG1770 682 PtrB Protease II [Amino acid transport and metabol 81.89
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 81.61
KOG2106626 consensus Uncharacterized conserved protein, conta 81.57
KOG0772 641 consensus Uncharacterized conserved protein, conta 81.11
PRK10162 318 acetyl esterase; Provisional 80.78
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 80.49
KOG0294362 consensus WD40 repeat-containing protein [Function 80.38
KOG0302440 consensus Ribosome Assembly protein [General funct 80.16
PRK02888635 nitrous-oxide reductase; Validated 80.1
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=9.1e-94  Score=732.64  Aligned_cols=458  Identities=44%  Similarity=0.773  Sum_probs=434.4

Q ss_pred             CCCCCCcccceEEeecCceeecCCcccccCCCCCHHHHHHHHHHHHHHHHHhcCChHhHHHHHHHHhhcccCCCCCCceE
Q 009441           50 PSPPVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGRIKQEDVSAPFR  129 (534)
Q Consensus        50 ~~~P~a~~~~~~~~~hG~~~~DpY~WLed~~~~~~~v~~~l~~en~~t~~~l~~~~~~~~~l~~e~~~~~~~~~~s~p~~  129 (534)
                      +.||+|+|+|+..+.||.+++|+|+||||++|.+|+|++||+|||+|+++.|+++++||++|++||++|+++++.|+|.+
T Consensus         4 p~pP~a~k~~~~~~~hg~~~~D~Y~WlRd~~~~~p~vl~yL~aEN~Yt~~~~a~~~~L~~~if~Ei~~Rik~dd~Svp~~   83 (682)
T COG1770           4 PLPPIAKKVPTTRTHHGDTRVDDYAWLRDDNWSNPEVLAYLEAENAYTEAVMAHLQPLQKKIFEEIKGRIKEDDLSVPYR   83 (682)
T ss_pred             CCCCCccccceeeeecCceeecchHhhhCCcccChHHHHHHHHhhHHHHHhhhhhHHHHHHHHHHHhhhccCcCCCCccc
Confidence            46999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCEEEEEEecCCceEEEEEEEecCCCCCCCCccccCCCCCCCCCceEEeecchhcCCCCcEEEEEEEECCCCCEEEEEE
Q 009441          130 QGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAE  209 (534)
Q Consensus       130 ~g~~~y~~~~~~g~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~eevllD~n~~a~~~~~~~l~~~~~SPDG~~LA~~~  209 (534)
                      .|+|+||.|...|++|+++||.+..++                .+||+|||+|+++++++|++|+.+++|||+++|||++
T Consensus        84 ~~~~~Yy~r~~~g~~y~~~~R~~~~g~----------------~~eevlLD~n~~A~g~~f~~Lg~~~~s~D~~~la~s~  147 (682)
T COG1770          84 KGPYEYYSRTEEGKEYPIYCRQPDEGG----------------EGEEVLLDVNKEAEGHDFFSLGAASISPDHNLLAYSV  147 (682)
T ss_pred             cCCeeEEEEecCCCcceeEEeccCCCC----------------CceeEeecchhccCcccceeeeeeeeCCCCceEEEEE
Confidence            999999999999999999999776542                2589999999999999999999999999999999999


Q ss_pred             cCCCCeEEEEEEEECCCCCeeccccCCccceeEEccCC-eEEEEEECCCCCCceEEEeecCCCCCCceEeeeecCCceEE
Q 009441          210 DTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNE-ALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSL  288 (534)
Q Consensus       210 d~~G~E~~~l~v~dl~tg~~~~~~i~~~~~~~~Ws~Dg-~l~Y~~~d~~~r~~~v~~~~lgt~~~~d~lv~~e~d~~~~v  288 (534)
                      |..|+|+++|+|+|+++|+.+.+.+.++.++++|++|+ +|||++.++..||.+||+|.+|+++..|++||+|+|+.|++
T Consensus       148 D~~G~e~y~lr~kdL~tg~~~~d~i~~~~~~~~Wa~d~~~lfYt~~d~~~rp~kv~~h~~gt~~~~d~lvyeE~d~~f~~  227 (682)
T COG1770         148 DVLGDEQYTLRFKDLATGEELPDEITNTSGSFAWAADGKTLFYTRLDENHRPDKVWRHRLGTPGSSDELVYEEKDDRFFL  227 (682)
T ss_pred             ecccccEEEEEEEecccccccchhhcccccceEEecCCCeEEEEEEcCCCCcceEEEEecCCCCCcceEEEEcCCCcEEE
Confidence            99999999999999999999999899887789999999 99999999999999999999999888999999999999999


Q ss_pred             EEEEcCCCcEEEEEecCcceeEEEEEeCCCCC-ceeEeeecccceeEEEeeeCCEEEEEEcCCCCCccEEEEEeCCCCCC
Q 009441          289 GLQASESKKFLFIASESKITRFVFYLDVSKPE-ELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSE  367 (534)
Q Consensus       289 ~~~~S~Dg~~l~i~~~~~~~~ev~~~d~~~~~-~~~~l~~~~~g~~~~v~~~g~~lyi~tn~~~~~~~~L~~~~~~~~~~  367 (534)
                      ++..|.+.+||+|..++..++|+++++.+.+. .++++.+|..|++|+++|.++.|||+||.+ ++|++|+++++ .+..
T Consensus       228 ~v~~s~s~~yi~i~~~~~~tsE~~ll~a~~p~~~p~vv~pr~~g~eY~~eh~~d~f~i~sN~~-gknf~l~~ap~-~~~~  305 (682)
T COG1770         228 SVGRSRSEAYIVISLGSHITSEVRLLDADDPEAEPKVVLPRENGVEYSVEHGGDRFYILSNAD-GKNFKLVRAPV-SADK  305 (682)
T ss_pred             EeeeccCCceEEEEcCCCcceeEEEEecCCCCCceEEEEEcCCCcEEeeeecCcEEEEEecCC-CcceEEEEccC-CCCh
Confidence            99999999999999999999999999999987 789999999999999999999999999984 59999999999 6666


Q ss_pred             ceE--EecCCCCceeeeEEEeCCEEEEEEeeCCeeEEEEEECCCCCCcccccCCCceeeecCceeeEe-CCCCccCccEE
Q 009441          368 TTV--LIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSID-PSESVFSSRIL  444 (534)
Q Consensus       368 ~~~--li~~~~~~~l~~~~~~~~~lv~~~~~~g~~~l~~~~l~~~g~~~~~~~~~~~i~lp~~~~~i~-~~~~~~~~~~l  444 (534)
                      .+|  +||+.++..|++|.+++++|++.++++|.++|++.+..+ |.       .+.|.|++.+++.+ ..|.+++++.+
T Consensus       306 ~~w~~~I~h~~~~~l~~~~~f~~~lVl~eR~~glp~v~v~~~~~-~~-------~~~i~f~~~ay~~~l~~~~e~~s~~l  377 (682)
T COG1770         306 SNWRELIPHREDVRLEGVDLFADHLVLLERQEGLPRVVVRDRKT-GE-------ERGIAFDDEAYSAGLSGNPEFDSDRL  377 (682)
T ss_pred             hcCeeeeccCCCceeeeeeeeccEEEEEecccCCceEEEEecCC-Cc-------eeeEEecchhhhccccCCCCCCCccE
Confidence            778  999999999999999999999999999999999999875 44       24689999887765 47888999999


Q ss_pred             EEEeccCCCCCeEEEEECCCCcEEEEEEccccCCCCCCCcEEEEEEEEcCCCceecEEEEEeCCCCCCCCCCcEEEEEcC
Q 009441          445 RFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYG  524 (534)
Q Consensus       445 ~~~~sS~~~P~~~y~~d~~~~~~~~~~~~~~~~~~d~~~~~~e~v~~~S~DG~~VP~~lv~~k~~~~~~~~~P~lL~gYG  524 (534)
                      +|+|+|+++|.++|.||+.+++.+++++++++++|++++|+++++|+++.||++||++|+|+|+. ++++++||||||||
T Consensus       378 R~~ysS~ttP~~~~~~dm~t~er~~LkqqeV~~g~dp~~Y~s~riwa~a~dgv~VPVSLvyrkd~-~~~g~~p~lLygYG  456 (682)
T COG1770         378 RYSYSSMTTPATLFDYDMATGERTLLKQQEVPGGFDPEDYVSRRIWATADDGVQVPVSLVYRKDT-KLDGSAPLLLYGYG  456 (682)
T ss_pred             EEEeecccccceeEEeeccCCcEEEEEeccCCCCCChhHeEEEEEEEEcCCCcEeeEEEEEeccc-CCCCCCcEEEEEec
Confidence            99999999999999999999999999999998889999999999999999999999999999998 89999999999999


Q ss_pred             CCCcCcccCC
Q 009441          525 SYEVIFFFLF  534 (534)
Q Consensus       525 gyg~~~~p~f  534 (534)
                      +||+++.|+|
T Consensus       457 aYG~s~~p~F  466 (682)
T COG1770         457 AYGISMDPSF  466 (682)
T ss_pred             cccccCCcCc
Confidence            9999999998

>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query534
2xe4_A 751 Structure Of Oligopeptidase B From Leishmania Major 1e-62
3iun_A 693 Appep_d622n Opened State Length = 693 2e-24
3ivm_A 693 Appep_wt+pp Closed State Length = 693 3e-24
3iuj_A 693 Appep_wt2 Opened State Length = 693 3e-24
3mun_A 693 Appep_pepclose Closed State Length = 693 3e-24
2bkl_A 695 Structural And Mechanistic Analysis Of Two Prolyl E 4e-17
1yr2_A 741 Structural And Mechanistic Analysis Of Two Prolyl E 3e-15
4hvt_A 711 Structure Of A Post-Proline Cleaving Enzyme From Ri 1e-08
1o6f_A 710 Prolyl Oligopeptidase From Porcine Brain, D641a Mut 3e-07
1o6g_A 710 Prolyl Oligopeptidase From Porcine Brain, D641n Mut 4e-07
1qfs_A 710 Prolyl Oligopeptidase From Porcine Muscle With Cova 4e-07
4ax4_A 710 Prolyl Oligopeptidase From Porcine Brain, H680a Mut 4e-07
1e8m_A 710 Prolyl Oligopeptidase From Porcine Brain, Mutant, C 4e-07
1qfm_A 710 Prolyl Oligopeptidase From Porcine Muscle Length = 4e-07
1vz3_A 710 Prolyl Oligopeptidase From Porcine Brain, T597c Mut 4e-07
3ddu_A 709 Prolyl Oligopeptidase With Gsk552 Length = 709 4e-07
1vz2_A 710 Prolyl Oligopeptidase From Porcine Brain, Y73c/v427 5e-07
1e5t_A 710 Prolyl Oligopeptidase From Porcine Brain, Mutant Le 8e-07
1h2x_A 710 Prolyl Oligopeptidase From Porcine Brain, Y473f Mut 9e-07
>pdb|2XE4|A Chain A, Structure Of Oligopeptidase B From Leishmania Major Length = 751 Back     alignment and structure 
Iteration: 1

 Score =  237 bits (604), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 162/501 (32%), Positives = 247/501 (49%), Gaps = 40/501 (7%)
Query: 52  PPVAKKVEHKMELFGDV---------------RVDNYYWLRDDSRSDPEVLAYLKQENDY 96
           PP+A K  H++ L G V               R D Y+W+RDD R DP V+ +L +E  Y
Sbjct: 33  PPIAAKKPHRVTL-GYVEGEDRGPNPMNPPRYREDPYFWMRDDDRKDPAVIEHLNKEKVY 91
Query: 97  FESAMSGTKKIEDNMFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNN 156
           F++  +   ++ D+++AE    I ++D+SAP+  G Y YYTR ++GK Y  +CR      
Sbjct: 92  FQARSADIAQLRDDIYAEHISHINEDDMSAPYVYGKYRYYTREVKGKPYKIYCR------ 145
Query: 157 EAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQ-VSPDNKLVAYAEDTKGDE 215
                V    E G D   E +I+D N  AEG+ F  V   +   P++ LVA++ D  G+E
Sbjct: 146 -----VFTDKEPG-DVAAEEVIIDVNQVAEGKAFCDVMEVKPAPPEHDLVAFSVDMSGNE 199
Query: 216 IYTVYVIDI-ETGTPVGKPLVGVTASVEWAGNE-ALVYITMDEILRPDKAWLHKLEADQS 273
           +YT+    I +    +   + G    + W  +  +L Y+T DE LR +K W H +   QS
Sbjct: 200 VYTIEFKRISDPSQTIADKVSGTNGEIVWGPDHTSLFYVTKDETLRENKVWRHVMGKLQS 259
Query: 274 NDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEE---LRVLTPRVV 330
            D+CLY E + ++S  +  +     L I S+S  T  V  LD+ K      L ++ PR  
Sbjct: 260 EDVCLYEEHNPLFSAFMYKAADTNTLCIGSQSPETAEVHLLDLRKGNAHNTLEIVRPREK 319
Query: 331 GVD-TAASHRGNHFFITRRSDELFNSELLACPVDNTSE-TTVLIPHRESVKLQDIQLFID 388
           GV      H  +H  I        N +LL  P    S+ + VL+ H E V ++ I +  +
Sbjct: 320 GVRYDVQMHGTSHLVILTNEGGAVNHKLLIAPRGQPSDWSHVLVDHSEDVFMESIAVRSN 379
Query: 389 HLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESV---FSSRILR 445
           +L V  R  GL +I T    +     K+  G + V   +P++++   ES    +     R
Sbjct: 380 YLVVAGRRAGLTRIWTMMADSQDGVFKAGTGLREVVMEEPIFTVHLVESQMLEYEEPTFR 439
Query: 446 FHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVY 505
             YSSL TP + +D           K+  V GGFD  NY  ER++A+A D T+IP+ +VY
Sbjct: 440 MEYSSLATPNTWFDVSPQDHSRTAVKVREVGGGFDAANYKVERRFATAPDQTKIPLSVVY 499
Query: 506 RKNLVKLDGSDPLLLYGYGSY 526
            K+L  +    P +LYGYGSY
Sbjct: 500 HKDL-DMSQPQPCMLYGYGSY 519
>pdb|3IUN|A Chain A, Appep_d622n Opened State Length = 693 Back     alignment and structure
>pdb|3IVM|A Chain A, Appep_wt+pp Closed State Length = 693 Back     alignment and structure
>pdb|3IUJ|A Chain A, Appep_wt2 Opened State Length = 693 Back     alignment and structure
>pdb|3MUN|A Chain A, Appep_pepclose Closed State Length = 693 Back     alignment and structure
>pdb|2BKL|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl Endopeptidases: Role Of Inter-Domain Dynamics In Catalysis And Specificity Length = 695 Back     alignment and structure
>pdb|1YR2|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl Endopeptidases: Role Of Inter-Domain Dynamics In Catalysis And Specificity Length = 741 Back     alignment and structure
>pdb|4HVT|A Chain A, Structure Of A Post-Proline Cleaving Enzyme From Rickettsia Typhi Length = 711 Back     alignment and structure
>pdb|1O6F|A Chain A, Prolyl Oligopeptidase From Porcine Brain, D641a Mutant With Bound Peptide Ligand Suc-Gly-Pro Length = 710 Back     alignment and structure
>pdb|1O6G|A Chain A, Prolyl Oligopeptidase From Porcine Brain, D641n Mutant With Bound Peptide Ligand Suc-Gly-Pro Length = 710 Back     alignment and structure
>pdb|1QFS|A Chain A, Prolyl Oligopeptidase From Porcine Muscle With Covalently Bound Inhibitor Z-Pro-Prolinal Length = 710 Back     alignment and structure
>pdb|4AX4|A Chain A, Prolyl Oligopeptidase From Porcine Brain, H680a Mutant Length = 710 Back     alignment and structure
>pdb|1E8M|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Mutant, Complexed With Inhibitor Length = 710 Back     alignment and structure
>pdb|1QFM|A Chain A, Prolyl Oligopeptidase From Porcine Muscle Length = 710 Back     alignment and structure
>pdb|1VZ3|A Chain A, Prolyl Oligopeptidase From Porcine Brain, T597c Mutant Length = 710 Back     alignment and structure
>pdb|3DDU|A Chain A, Prolyl Oligopeptidase With Gsk552 Length = 709 Back     alignment and structure
>pdb|1VZ2|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Y73c/v427c/c255t Mutant Length = 710 Back     alignment and structure
>pdb|1E5T|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Mutant Length = 710 Back     alignment and structure
>pdb|1H2X|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Y473f Mutant Length = 710 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query534
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 1e-180
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 1e-157
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 1e-150
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 1e-149
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 1e-144
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Length = 751 Back     alignment and structure
 Score =  523 bits (1350), Expect = e-180
 Identities = 160/527 (30%), Positives = 251/527 (47%), Gaps = 41/527 (7%)

Query: 27  SSSSLSSSDSKTSTATMMSQSKLPSPPVAKKVEHKMEL--------------FGDVRVDN 72
           SS  +      +S +++ +      PP+A K  H++ L                  R D 
Sbjct: 11  SSGLVPRGSHMSSDSSVAAS---AQPPIAAKKPHRVTLGYVEGEDRGPNPMNPPRYREDP 67

Query: 73  YYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGRIKQEDVSAPFRQGS 132
           Y+W+RDD R DP V+ +L +E  YF++  +   ++ D+++AE    I ++D+SAP+  G 
Sbjct: 68  YFWMRDDDRKDPAVIEHLNKEKVYFQARSADIAQLRDDIYAEHISHINEDDMSAPYVYGK 127

Query: 133 YYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYS 192
           Y YYTR ++GK Y  +CR                    D   E +I+D N  AEG+ F  
Sbjct: 128 YRYYTREVKGKPYKIYCRVFTDK------------EPGDVAAEEVIIDVNQVAEGKAFCD 175

Query: 193 VGCFQ-VSPDNKLVAYAEDTKGDEIYTVYVIDIET-GTPVGKPLVGVTASVEWAG-NEAL 249
           V   +   P++ LVA++ D  G+E+YT+    I      +   + G    + W   + +L
Sbjct: 176 VMEVKPAPPEHDLVAFSVDMSGNEVYTIEFKRISDPSQTIADKVSGTNGEIVWGPDHTSL 235

Query: 250 VYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITR 309
            Y+T DE LR +K W H +   QS D+CLY E + ++S  +  +     L I S+S  T 
Sbjct: 236 FYVTKDETLRENKVWRHVMGKLQSEDVCLYEEHNPLFSAFMYKAADTNTLCIGSQSPETA 295

Query: 310 FVFYLDVSKPE---ELRVLTPRVVGVD-TAASHRGNHFFITRRSDELFNSELLACPVDNT 365
            V  LD+ K      L ++ PR  GV      H  +H  I        N +LL  P    
Sbjct: 296 EVHLLDLRKGNAHNTLEIVRPREKGVRYDVQMHGTSHLVILTNEGGAVNHKLLIAPRGQP 355

Query: 366 SE-TTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVE 424
           S+ + VL+ H E V ++ I +  ++L V  R  GL +I T    +     K+  G + V 
Sbjct: 356 SDWSHVLVDHSEDVFMESIAVRSNYLVVAGRRAGLTRIWTMMADSQDGVFKAGTGLREVV 415

Query: 425 FIDPVYSIDPSESV---FSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDT 481
             +P++++   ES    +     R  YSSL TP + +D           K+  V GGFD 
Sbjct: 416 MEEPIFTVHLVESQMLEYEEPTFRMEYSSLATPNTWFDVSPQDHSRTAVKVREVGGGFDA 475

Query: 482 NNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEV 528
            NY  ER++A+A D T+IP+ +VY K+L  +    P +LYGYGSY +
Sbjct: 476 ANYKVERRFATAPDQTKIPLSVVYHKDL-DMSQPQPCMLYGYGSYGL 521
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Length = 693 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Length = 741 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Length = 695 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Length = 710 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Length = 582 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query534
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 100.0
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 100.0
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 100.0
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 100.0
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 100.0
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 100.0
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.9
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.79
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.78
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.78
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.76
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.75
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.73
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.62
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.34
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.33
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.31
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.29
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.23
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.23
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.21
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.21
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.13
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.13
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.1
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.07
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.07
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.01
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.96
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.91
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.9
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.89
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.89
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 98.86
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 98.85
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.85
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.84
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.83
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.8
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.75
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.7
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.67
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.57
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.53
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.51
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.5
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.49
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.43
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.4
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 98.4
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.38
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.34
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.33
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.27
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.26
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.26
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.26
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.25
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.23
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.22
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.18
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.17
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.12
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.11
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.07
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.06
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.03
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.03
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.01
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.99
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.97
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.97
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.96
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.96
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.95
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.92
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.92
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.91
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.89
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.89
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.88
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.85
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.85
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.85
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.83
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.79
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.78
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.77
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.76
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.73
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.72
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 97.72
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.7
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.7
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 97.7
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.7
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.67
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.67
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.66
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.66
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.66
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.64
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.63
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.62
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 97.61
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.61
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.59
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.55
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.55
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.52
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.49
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.49
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.45
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.45
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 97.42
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 97.38
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.37
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.34
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.33
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.28
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.27
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.26
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.25
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.24
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 97.24
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 97.23
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 97.22
3jrp_A379 Fusion protein of protein transport protein SEC13 97.21
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.13
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.13
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.12
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.11
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.11
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.11
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.08
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.06
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 97.06
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.05
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.05
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.02
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.02
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.01
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 96.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 96.95
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.94
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 96.94
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.93
2ymu_A577 WD-40 repeat protein; unknown function, two domain 96.92
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 96.92
3jrp_A379 Fusion protein of protein transport protein SEC13 96.87
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.85
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.84
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.81
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.8
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 96.79
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.78
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.76
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.75
2ece_A462 462AA long hypothetical selenium-binding protein; 96.75
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 96.74
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.74
2ymu_A577 WD-40 repeat protein; unknown function, two domain 96.67
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.64
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.61
2ece_A462 462AA long hypothetical selenium-binding protein; 96.6
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 96.57
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 96.56
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.54
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.54
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 96.49
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.48
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.46
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.4
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.38
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.25
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 96.24
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.21
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.19
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.18
3jro_A 753 Fusion protein of protein transport protein SEC13 96.12
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.12
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.08
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 95.98
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 95.96
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 95.94
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.93
2pm7_B297 Protein transport protein SEC13, protein transport 95.88
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 95.8
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 95.78
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 95.77
3v65_B386 Low-density lipoprotein receptor-related protein; 95.63
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.59
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 95.58
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 95.58
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 95.58
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.57
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.54
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 95.52
4ao6_A 259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 95.45
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 95.4
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 95.39
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.25
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.23
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 95.19
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.14
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 95.12
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.07
2fp8_A322 Strictosidine synthase; six bladed beta propeller 94.94
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 94.94
3jro_A 753 Fusion protein of protein transport protein SEC13 94.91
2p4o_A306 Hypothetical protein; putative lactonase, structur 94.77
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 94.73
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 94.62
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.45
3v65_B386 Low-density lipoprotein receptor-related protein; 94.05
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.02
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 94.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 93.86
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 93.83
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 93.78
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 93.58
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 93.33
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 93.22
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 93.2
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 93.11
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 92.85
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 92.53
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 92.49
2qe8_A343 Uncharacterized protein; structural genomics, join 92.23
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 92.2
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 92.12
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 92.02
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 91.91
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 91.78
3p5b_L400 Low density lipoprotein receptor variant; B-propel 91.73
1gkl_A 297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 91.66
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 91.55
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 91.53
3doh_A 380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 91.51
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 91.5
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 91.46
3ls2_A 280 S-formylglutathione hydrolase; psychrophilic organ 91.32
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 91.21
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 91.21
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 91.19
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 91.14
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 90.99
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 90.79
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 90.69
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 90.67
3p5b_L400 Low density lipoprotein receptor variant; B-propel 90.61
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 90.55
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 90.54
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 90.32
2qe8_A343 Uncharacterized protein; structural genomics, join 90.31
1jjf_A 268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 90.13
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 90.08
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 89.49
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 89.35
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 89.33
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 89.25
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 89.13
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 89.1
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 89.06
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 88.91
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 88.85
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 88.66
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 88.56
2pm7_B297 Protein transport protein SEC13, protein transport 88.55
3kya_A496 Putative phosphatase; structural genomics, joint c 88.21
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 88.07
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 88.02
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 88.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 87.91
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 87.88
2fp8_A322 Strictosidine synthase; six bladed beta propeller 87.77
2qm0_A 275 BES; alpha-beta structure, structural genomics, PS 87.7
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 87.27
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 86.9
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 86.48
4b6g_A 283 Putative esterase; hydrolase, formaldehyde detoxif 85.71
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 84.74
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 84.56
3e4d_A 278 Esterase D; S-formylglutathione hydrolase, hydrola 84.34
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 84.31
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 84.26
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 84.19
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 84.11
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 83.54
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 82.73
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 82.17
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 81.3
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 80.84
3kya_A496 Putative phosphatase; structural genomics, joint c 80.61
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 80.5
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
Probab=100.00  E-value=8.1e-71  Score=613.08  Aligned_cols=448  Identities=23%  Similarity=0.422  Sum_probs=395.5

Q ss_pred             CCCCCCCcccceEEeecCceeecCCcccccCCCCCHHHHHHHHHHHHHHHHHhcCChHhHHHHHHHHhhcccCCCCCCce
Q 009441           49 LPSPPVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGRIKQEDVSAPF  128 (534)
Q Consensus        49 ~~~~P~a~~~~~~~~~hG~~~~DpY~WLed~~~~~~~v~~~l~~en~~t~~~l~~~~~~~~~l~~e~~~~~~~~~~s~p~  128 (534)
                      .+.||+|+|+|+++++||+++.|||+||||.+  +|+|++||++||+||+++|+++ +++++|++||++++.+++.++|.
T Consensus         9 ~~~~p~~~~~~~~~~~~g~~~~d~y~wl~~~~--~~~~~~~~~~~n~~~~~~~~~~-~~~~~l~~~~~~~~~~~~~~~p~   85 (693)
T 3iuj_A            9 RLHYPVTRQGEQVDHYFGQAVADPYRWLEDDR--SPETEAWVKAQNAVTQDYLAQI-PYRAAIKEKLAASWNYAKEGAPF   85 (693)
T ss_dssp             -CCCCCCCCCCCEEEETTEEEECTTGGGGCTT--SHHHHHHHHHHHHHHHHHHTTC-TTHHHHHHHHHHHSCCCEECCCE
T ss_pred             CCCCCCCCCCCeEEEeCCccccCCchhhcCCC--CHHHHHHHHHHHHHHHHHHccC-hhHHHHHHHHHHhhccccCCCCE
Confidence            35699999999999999999999999999999  9999999999999999999999 79999999999999999999999


Q ss_pred             EeCCEEEEEEecCCceEEEEEEEecCCCCCCCCccccCCCCCCCCCceEEeecchhcCCCCcEEEEEEEECCCCCEEEEE
Q 009441          129 RQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYA  208 (534)
Q Consensus       129 ~~g~~~y~~~~~~g~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~eevllD~n~~a~~~~~~~l~~~~~SPDG~~LA~~  208 (534)
                      ++|+|+||.++.++++|+++||+...                  +++++|||+|+++++ +++.++++.|||||++|||+
T Consensus        86 ~~g~~~y~~~~~~~~~~~~~~r~~~~------------------~~~~vllD~n~la~~-~~~~l~~~~~SpDg~~lAy~  146 (693)
T 3iuj_A           86 REGRYHYFFKNDGLQNQNVLWRQQEG------------------KPAEVFLDPNTLSPD-GTTALDQLSFSRDGRILAYS  146 (693)
T ss_dssp             EETTEEEEEEECSSCSSCEEEEECTT------------------SCCEEEECGGGGSTT-SCCEEEEEEECTTSSEEEEE
T ss_pred             EECCEEEEEEEcCCCceeEEEEeCCC------------------CCcEEEEehhhccCC-CcEEEEEEEECCCCCEEEEE
Confidence            99999999999999999999997532                  467999999999986 77899999999999999999


Q ss_pred             EcCCCCeEEEEEEEECCCCCeeccccCCc-cceeEEccCC-eEEEEEECCC--------CCCceEEEeecCCCCCCceEe
Q 009441          209 EDTKGDEIYTVYVIDIETGTPVGKPLVGV-TASVEWAGNE-ALVYITMDEI--------LRPDKAWLHKLEADQSNDICL  278 (534)
Q Consensus       209 ~d~~G~E~~~l~v~dl~tg~~~~~~i~~~-~~~~~Ws~Dg-~l~Y~~~d~~--------~r~~~v~~~~lgt~~~~d~lv  278 (534)
                      .+.+|+|+++|+|+|+++|+.+.+.++++ .++++|+ || +|||++.+..        .++.+||+|++|+++.++++|
T Consensus       147 ~~~~G~~~~~i~v~dl~tg~~~~~~~~~~k~~~~~Ws-Dg~~l~y~~~~~~~~~~~~~~~~~~~v~~~~lgt~~~~~~~v  225 (693)
T 3iuj_A          147 LSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWL-GNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLV  225 (693)
T ss_dssp             EECSSCCEEEEEEEETTTCSEEEEEEEEEESCCCEEE-TTTEEEEEESSCCC-------CCCCEEEEEETTSCGGGCEEE
T ss_pred             EecCCCceEEEEEEECCCCCCCccccCCceeccEEEe-CCCEEEEEEecCcccccccccCCCcEEEEEECCCCcccceEE
Confidence            99999999999999999999887777776 5679999 99 9999998754        678999999999998889999


Q ss_pred             eeecC--CceEEEEEEcCCCcEEEEEecCcc-eeEEEEEeCCCCC-ceeEeeecccceeEEEeeeCCEEEEEEcCCCCCc
Q 009441          279 YHEKD--DIYSLGLQASESKKFLFIASESKI-TRFVFYLDVSKPE-ELRVLTPRVVGVDTAASHRGNHFFITRRSDELFN  354 (534)
Q Consensus       279 ~~e~d--~~~~v~~~~S~Dg~~l~i~~~~~~-~~ev~~~d~~~~~-~~~~l~~~~~g~~~~v~~~g~~lyi~tn~~~~~~  354 (534)
                      |++.+  +.+++++.+|+||++|++.+.+.. .+++|+++++++. .++.+..+.++..+.++++|++|||+||. ++++
T Consensus       226 ~~~~~~~~~~~~~~~~SpDg~~l~~~~~~~~~~~~i~~~d~~~~~~~~~~l~~~~~~~~~~~~~~g~~l~~~t~~-~~~~  304 (693)
T 3iuj_A          226 FGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNR-DAPN  304 (693)
T ss_dssp             ESCSGGGCCSEEEEEECTTSCEEEEEEESSSSCCEEEEEETTSTTCCCEEEECSSSSCEEEEEEETTEEEEEECT-TCTT
T ss_pred             EecCCCCCeEEEEEEEcCCCCEEEEEEccCCCCcEEEEEECCCCCCceEEEeCCCCceEEEEeccCCEEEEEECC-CCCC
Confidence            98765  567788999999999999876544 4699999998775 57888877666556688999999999997 6789


Q ss_pred             cEEEEEeCCCCCCceE--EecCCCCceeeeEEEeCCEEEEEEeeCCeeEEEEEECCCCCCcccccCCCceeeecCceeeE
Q 009441          355 SELLACPVDNTSETTV--LIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSI  432 (534)
Q Consensus       355 ~~L~~~~~~~~~~~~~--li~~~~~~~l~~~~~~~~~lv~~~~~~g~~~l~~~~l~~~g~~~~~~~~~~~i~lp~~~~~i  432 (534)
                      ++|++++++++...+|  ++++.++. + ++..++++|++..+++|.++|++++++  |..      .+.+.+|+.+ .+
T Consensus       305 ~~l~~~d~~~~~~~~~~~l~~~~~~~-~-~~s~~g~~lv~~~~~~g~~~l~~~d~~--g~~------~~~l~~p~~~-~~  373 (693)
T 3iuj_A          305 RRLVTVDAANPGPAHWRDLIPERQQV-L-TVHSGSGYLFAEYMVDATARVEQFDYE--GKR------VREVALPGLG-SV  373 (693)
T ss_dssp             CEEEEEETTSCCGGGCEEEECCCSSC-E-EEEEETTEEEEEEEETTEEEEEEECTT--SCE------EEEECCSSSS-EE
T ss_pred             CEEEEEeCCCCCccccEEEecCCCCE-E-EEEEECCEEEEEEEECCeeEEEEEECC--CCe------eEEeecCCCc-eE
Confidence            9999999987765567  78877664 6 899999999999999999999999988  442      2467777654 34


Q ss_pred             eCCCCccCccEEEEEeccCCCCCeEEEEECCCCcEEEEEEccccCCCCCCCcEEEEEEEEcCCCceecEEEEEeCCCCCC
Q 009441          433 DPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKL  512 (534)
Q Consensus       433 ~~~~~~~~~~~l~~~~sS~~~P~~~y~~d~~~~~~~~~~~~~~~~~~d~~~~~~e~v~~~S~DG~~VP~~lv~~k~~~~~  512 (534)
                      ..++.+++++.+++.++|+++|+++|.||+++++.++++..+.  .+++..+++++++++++||++||++|++|++. +.
T Consensus       374 ~~~~~~~d~~~l~~~~ss~~tP~~l~~~d~~~g~~~~l~~~~~--~~~~~~~~~~~~~~~~~dg~~i~~~l~~p~~~-~~  450 (693)
T 3iuj_A          374 SGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAA--PFKPEDYVSEQRFYQSKDGTRVPLIISYRKGL-KL  450 (693)
T ss_dssp             EECCCCTTCSCEEEEEECSSSCCEEEEECTTTCCEEEEECCCS--SCCGGGEEEEEEEEECTTSCEEEEEEEEESSC-CC
T ss_pred             EeeecCCCCCEEEEEecCCCCCCEEEEEECCCCeEEEEEeCCC--CcChhhCeeEEEEEecCCCcEEEEEEEecCCC-CC
Confidence            4455567889999999999999999999999999888887554  58888999999999999999999999999998 77


Q ss_pred             CCCCcEEEEEcCCCCcCcccCC
Q 009441          513 DGSDPLLLYGYGSYEVIFFFLF  534 (534)
Q Consensus       513 ~~~~P~lL~gYGgyg~~~~p~f  534 (534)
                      +++.|+|||+|||||.+..|.|
T Consensus       451 ~~~~P~ll~~hGg~~~~~~~~~  472 (693)
T 3iuj_A          451 DGSNPTILYGYGGFDVSLTPSF  472 (693)
T ss_dssp             SSCCCEEEECCCCTTCCCCCCC
T ss_pred             CCCccEEEEECCCCCcCCCCcc
Confidence            8999999999999999998876
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 534
d1qfma1430 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-termin 7e-55
d1qfma2 280 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term 2e-09
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 5e-04
d2hu7a2 260 c.69.1.33 (A:322-581) Acylamino-acid-releasing enz 0.002
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 430 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Peptidase/esterase 'gauge' domain
family: Prolyl oligopeptidase, N-terminal domain
domain: Prolyl oligopeptidase, N-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  188 bits (478), Expect = 7e-55
 Identities = 65/464 (14%), Positives = 134/464 (28%), Gaps = 64/464 (13%)

Query: 43  MMSQSKLPSPPVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMS 102
           M+S      P V +      +  G    D Y WL D      +  A+++ +N      + 
Sbjct: 1   MLS---FQYPDVYRDETAIQDYHGHKVCDPYAWLEDP--DSEQTKAFVEAQNKITVPFLE 55

Query: 103 GTKKIEDNMFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSV 162
               I       +         S  F++G  Y+Y      +       +     E     
Sbjct: 56  QC-PIRGLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGE----- 109

Query: 163 HDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVI 222
                         + LD N+ ++       G +  S D +  AY     G +  T+  +
Sbjct: 110 ------------ARVFLDPNILSDDGTVALRG-YAFSEDGEYFAYGLSASGSDWVTIKFM 156

Query: 223 DIETGTPVGKPLVGVTAS--VEWAGNEALVYITMD-----------EILRPDKAWLHKLE 269
            ++    +   L  V  S        + + Y                     K + H L 
Sbjct: 157 KVDGAKELPDVLERVKFSCMAWTHDGKGMFYNAYPQQDGKSDGTETSTNLHQKLYYHVLG 216

Query: 270 ADQSNDICLYHEKDD-IYSLGLQASESKKFLFIASESKITRF--VFYLDVSKPEEL---- 322
            DQS DI      D+  +  G + S+  +++ ++          ++Y D+ +        
Sbjct: 217 TDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESNGITGI 276

Query: 323 ---RVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLA--CPVDNTSETTVLIPHRES 377
                L     G     ++ G  F             +       + +    ++  H + 
Sbjct: 277 LKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESKWKVLVPEHEKD 336

Query: 378 VKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVE-FIDPVYSIDPSE 436
           V      +  + L +         +  +           L  G  ++ F   V S+    
Sbjct: 337 VLEWVACVRSNFLVLCYLHDVKNTLQLH----------DLATGALLKIFPLEVGSVVGYS 386

Query: 437 SVFSSRILRFHYSSLRTPPSVYDYDMDMG---ISVLKKIETVLG 477
                  + + ++S  +P  +Y  D+        V +++  V G
Sbjct: 387 GQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVT-VKG 429
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query534
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 100.0
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.21
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.12
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.12
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.09
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.06
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.79
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.76
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.65
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.61
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.56
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.53
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.38
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.33
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.2
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.13
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 98.13
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.1
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.02
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.95
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.94
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.86
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.84
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.82
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.8
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.72
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.71
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.69
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.64
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.62
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.61
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.6
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 97.57
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.47
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.28
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.21
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 97.17
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.17
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.14
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.03
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.93
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.88
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.85
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.84
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.7
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 96.51
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.21
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.16
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 96.08
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 96.04
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.03
d1lzla_ 317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 95.68
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.24
d1wb4a1 273 Feruloyl esterase domain of the cellulosomal xylan 95.16
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 95.13
d1jjfa_ 255 Feruloyl esterase domain of the cellulosomal xylan 95.1
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.02
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 94.78
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 94.41
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.35
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 93.95
d2gzsa1 265 Enterobactin and salmochelin hydrolase IroE {Esche 93.64
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 93.55
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 93.51
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 93.47
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 93.45
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 93.38
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 93.22
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 92.97
d1u4na_ 308 Carboxylesterase {Alicyclobacillus acidocaldarius 92.59
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 92.08
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 91.74
d1jjia_ 311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 90.44
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 89.63
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 88.75
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 86.46
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 85.9
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 85.69
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 84.27
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 84.12
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 83.79
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 83.3
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 82.14
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Peptidase/esterase 'gauge' domain
family: Prolyl oligopeptidase, N-terminal domain
domain: Prolyl oligopeptidase, N-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=8.4e-61  Score=500.35  Aligned_cols=394  Identities=16%  Similarity=0.222  Sum_probs=332.3

Q ss_pred             CCCCcccceEEeecCceeecCCcccccCCCCCHHHHHHHHHHHHHHHHHhcCChHhHHHHHHHHhhcccCCCCCCceEeC
Q 009441           52 PPVAKKVEHKMELFGDVRVDNYYWLRDDSRSDPEVLAYLKQENDYFESAMSGTKKIEDNMFAELKGRIKQEDVSAPFRQG  131 (534)
Q Consensus        52 ~P~a~~~~~~~~~hG~~~~DpY~WLed~~~~~~~v~~~l~~en~~t~~~l~~~~~~~~~l~~e~~~~~~~~~~s~p~~~g  131 (534)
                      ||++++.++++++||+++.|||+||||.+  +|+|++||++||+||+++|+++ ++++.|.++|++++..++.++|.+.|
T Consensus         7 P~~~~~~~~~~~~hG~~~~DpY~WLed~~--~~~v~~wl~~eN~~t~~~l~~~-~~~~~~~~~~~~~~~~~~~~~p~~~g   83 (430)
T d1qfma1           7 PDVYRDETAIQDYHGHKVCDPYAWLEDPD--SEQTKAFVEAQNKITVPFLEQC-PIRGLYKERMTELYDYPKYSCHFKKG   83 (430)
T ss_dssp             CCCCCCTTCEEEETTEEEECTTGGGGCTT--SHHHHHHHHHHHHHHHHHHHSS-THHHHHHHHHHHHTCSCEECCCEEET
T ss_pred             CCCcCCCCeeeccCCCEEeeCchhhcCCC--CHHHHHHHHHHHHHHHHHHcCC-hhHHHHHHHHHhhhcCCceeeeEEeC
Confidence            55556778999999999999999999999  9999999999999999999998 68999999999998888899999999


Q ss_pred             CEEEEEEecCCceEEEEEEEecCCCCCCCCccccCCCCCCCCCceEEeecchhcCCCCcEEEEEEEECCCCCEEEEEEcC
Q 009441          132 SYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDT  211 (534)
Q Consensus       132 ~~~y~~~~~~g~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~eevllD~n~~a~~~~~~~l~~~~~SPDG~~LA~~~d~  211 (534)
                      +++||.+..+++.+.+++|+...+                 +.+|+|||+|+++++ +++.++++.+||||++|||++|.
T Consensus        84 ~~y~~~~~~~~~~~~~~~~~~~~~-----------------~~~evllD~n~la~~-~~~~~~~~~~Spd~~~la~s~d~  145 (430)
T d1qfma1          84 KRYFYFYNTGLQNQRVLYVQDSLE-----------------GEARVFLDPNILSDD-GTVALRGYAFSEDGEYFAYGLSA  145 (430)
T ss_dssp             TEEEEEEECSSCSSCEEEEESSSS-----------------SCCEEEECGGGGCSS-SCEEEEEEEECTTSSEEEEEEEE
T ss_pred             CEEEEEEecCCCccceEEeccccC-----------------CCeeeecchhhhccc-ccceecceEecCCCCEEEEEecc
Confidence            999998888888888888765432                 578999999999975 56778889999999999999999


Q ss_pred             CCCeEEEEEEEECCCCCeeccccCCc-cceeEEccCC-eEEEEEECC-----------CCCCceEEEeecCCCCCCceEe
Q 009441          212 KGDEIYTVYVIDIETGTPVGKPLVGV-TASVEWAGNE-ALVYITMDE-----------ILRPDKAWLHKLEADQSNDICL  278 (534)
Q Consensus       212 ~G~E~~~l~v~dl~tg~~~~~~i~~~-~~~~~Ws~Dg-~l~Y~~~d~-----------~~r~~~v~~~~lgt~~~~d~lv  278 (534)
                      +|+|.++|+|+|+++|+.+++.++++ .++++|++|+ .|||++.+.           ..++.+||+|++|+++++|+++
T Consensus       146 ~G~e~~~l~v~Dl~tg~~~~~~i~~~~~~~~~W~~D~~~~~Y~~~~~~~~~~~~~~~~~~~~~~v~~h~lgt~~~~d~~v  225 (430)
T d1qfma1         146 SGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTHDGKGMFYNAYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILC  225 (430)
T ss_dssp             TTCSCEEEEEEETTTTEEEEEEEEEECSCCEEECTTSSEEEEEECCCCSSCCSSSCCCCCCCCEEEEEETTSCGGGCEEE
T ss_pred             ccCchheeEEeccCcceecccccccccccceEEcCCCCEEEEEEeccccCcccccccccCCcceEEEEECCCCccccccc
Confidence            99999999999999999998878775 4679999999 999998753           4678899999999999999999


Q ss_pred             eeecCC-ceEEEEEEcCCCcEEEEEecCcc--eeEEEEEeCCCCC-------ceeEeeecccceeEEEeeeCCEEEEEEc
Q 009441          279 YHEKDD-IYSLGLQASESKKFLFIASESKI--TRFVFYLDVSKPE-------ELRVLTPRVVGVDTAASHRGNHFFITRR  348 (534)
Q Consensus       279 ~~e~d~-~~~v~~~~S~Dg~~l~i~~~~~~--~~ev~~~d~~~~~-------~~~~l~~~~~g~~~~v~~~g~~lyi~tn  348 (534)
                      |++.+. .+++.+..|+||+|+++.+.+..  .+++|++++..+.       .+.++.++..+..+.+.++|+.||++||
T Consensus       226 ~~e~d~~~~~~~~~~s~d~~~l~i~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Tn  305 (430)
T d1qfma1         226 AEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESNGITGILKWVKLIDNFEGEYDYVTNEGTVFTFKTN  305 (430)
T ss_dssp             ECCTTCTTCEEEEEECTTSCEEEEEEECSSSSCCEEEEEEGGGSSSSSCSSCCCEEEECSSSSCEEEEEEETTEEEEEEC
T ss_pred             cccccCCceEEeeeccCCcceeeEEeeccCCccEEEEEeeCCCcccccccccceeEeecccccceEEEecCCceeecccC
Confidence            998764 57778889999999998876543  4679999976532       2455666666656668899999999999


Q ss_pred             CCCCCccEEEEEeCCCCCCceE--EecCCCC-ceeeeEEEeCCEEEEEEeeCCeeEEEEEECCCCCCcccccCCCceeee
Q 009441          349 SDELFNSELLACPVDNTSETTV--LIPHRES-VKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEF  425 (534)
Q Consensus       349 ~~~~~~~~L~~~~~~~~~~~~~--li~~~~~-~~l~~~~~~~~~lv~~~~~~g~~~l~~~~l~~~g~~~~~~~~~~~i~l  425 (534)
                      . ++++++|++++++++...+|  +||+.+. ..+..+.+++++|++.++++|.++|.++++.+ |+       ...+.+
T Consensus       306 ~-~a~~~~L~~~~~~~~~~~~w~~vi~~~~~~~~~~~~~~~~~~lvl~~~~~~~~~l~v~~~~~-~~-------~~~~~~  376 (430)
T d1qfma1         306 R-HSPNYRLINIDFTDPEESKWKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLAT-GA-------LLKIFP  376 (430)
T ss_dssp             T-TCTTCEEEEEETTBCCGGGCEEEECCCSSCEEEEEEEETTTEEEEEEEETTEEEEEEEETTT-CC-------EEEEEC
T ss_pred             c-ccccceeEEecCCCCccccceEEecccCcceeeeEEEEECCEEEEEEEcCCEeEEEEEECCC-Cc-------EEEecC
Confidence            7 79999999999998877778  8887654 44456677789999999999999999999984 33       234555


Q ss_pred             cCceeeEeCCCCccCccEEEEEeccCCCCCeEEEEECCCCcE--EEEEEcccc
Q 009441          426 IDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGIS--VLKKIETVL  476 (534)
Q Consensus       426 p~~~~~i~~~~~~~~~~~l~~~~sS~~~P~~~y~~d~~~~~~--~~~~~~~~~  476 (534)
                      |+. +++.+.+.+++++.++|.++|+++|+++|.||+++|+.  +++++.+++
T Consensus       377 ~~~-~sv~~~~~~~~~~~~~~~~ss~~tP~~~y~~Dl~t~~~~~~~~k~~~v~  428 (430)
T d1qfma1         377 LEV-GSVVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVK  428 (430)
T ss_dssp             CCS-SEEEEEECCTTCSEEEEEEECSSCCCEEEEEETTSSSCCCEEEEECCCT
T ss_pred             CCC-ceEeeccCCCCCCEEEEEEcCCCCCCeEEEEECCCCCcceeeEeccCCC
Confidence            544 35555666778889999999999999999999999865  577776664
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure