Citrus Sinensis ID: 009574
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 532 | ||||||
| 297738859 | 556 | unnamed protein product [Vitis vinifera] | 0.981 | 0.938 | 0.843 | 0.0 | |
| 225445308 | 525 | PREDICTED: protein mrp homolog [Vitis vi | 0.981 | 0.994 | 0.843 | 0.0 | |
| 356531234 | 530 | PREDICTED: protein mrp homolog [Glycine | 0.984 | 0.988 | 0.821 | 0.0 | |
| 449461963 | 529 | PREDICTED: protein mrp homolog [Cucumis | 0.984 | 0.990 | 0.814 | 0.0 | |
| 356520515 | 533 | PREDICTED: protein mrp homolog [Glycine | 0.986 | 0.984 | 0.818 | 0.0 | |
| 388500020 | 526 | unknown [Medicago truncatula] | 0.979 | 0.990 | 0.811 | 0.0 | |
| 357500509 | 516 | Mrp-like protein [Medicago truncatula] g | 0.960 | 0.990 | 0.796 | 0.0 | |
| 15230111 | 532 | ATP binding protein [Arabidopsis thalian | 0.990 | 0.990 | 0.777 | 0.0 | |
| 21592386 | 532 | mrp protein, putative [Arabidopsis thali | 0.990 | 0.990 | 0.775 | 0.0 | |
| 297835526 | 531 | high-chlorophyll-fluorescence 101 [Arabi | 0.851 | 0.853 | 0.880 | 0.0 |
| >gi|297738859|emb|CBI28104.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 904 bits (2335), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 448/531 (84%), Positives = 474/531 (89%), Gaps = 9/531 (1%)
Query: 1 MQLLHAPCWPHLPFQGCKSPSILALVPPDRFLQLSAINFSLHPSKLEKSIWVSHRPSIFG 60
MQLLHAP HL F + S ++ LS++ S HP + K W+S++ S+
Sbjct: 32 MQLLHAPSSLHLSFNNSRPQS-------EKSFLLSSVCCSSHPQRHHKPTWISYKRSVLS 84
Query: 61 CGSTNATSVEAGVSAVSTGTAENDVLKALSQIIDPDFGTDIVSCGFVKDMQINEALGEVS 120
S S A SA+S+GTAE DVLKALSQIIDPDFGTDIVSCGFVKD+QINEALGEVS
Sbjct: 85 --SITPKSASASTSAISSGTAEADVLKALSQIIDPDFGTDIVSCGFVKDLQINEALGEVS 142
Query: 121 FRLELTTPACPIKDMFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNI 180
FRLELTTPACPIKDMFEQ+ANEVV +PWV VNVTMSAQPARP+FA QLP GLQ ISNI
Sbjct: 143 FRLELTTPACPIKDMFEQKANEVVAMLPWVKNVNVTMSAQPARPVFAGQLPAGLQTISNI 202
Query: 181 VAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKR 240
+AVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKR
Sbjct: 203 IAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKR 262
Query: 241 TIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDI 300
+IIPTEYLGVKLVSFGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDI
Sbjct: 263 SIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDI 322
Query: 301 QLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYP 360
QLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADGKRYYP
Sbjct: 323 QLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYP 382
Query: 361 FGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCVVQQ 420
FGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEV ADP GE+A TFQ+LGVCVVQQ
Sbjct: 383 FGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPLGEIAQTFQNLGVCVVQQ 442
Query: 421 CAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGDQKLQY 480
CAKIRQQVSTAV YDK IKAI+VKVP S+EEF LHPATVRRNDRSAQSVDEWTG+QKLQY
Sbjct: 443 CAKIRQQVSTAVTYDKFIKAIRVKVPDSEEEFLLHPATVRRNDRSAQSVDEWTGEQKLQY 502
Query: 481 TDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTP 531
DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLVDVPQ TP
Sbjct: 503 ADVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVDVPQLTP 553
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225445308|ref|XP_002281353.1| PREDICTED: protein mrp homolog [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356531234|ref|XP_003534183.1| PREDICTED: protein mrp homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449461963|ref|XP_004148711.1| PREDICTED: protein mrp homolog [Cucumis sativus] gi|449508261|ref|XP_004163266.1| PREDICTED: protein mrp homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356520515|ref|XP_003528907.1| PREDICTED: protein mrp homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388500020|gb|AFK38076.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357500509|ref|XP_003620543.1| Mrp-like protein [Medicago truncatula] gi|355495558|gb|AES76761.1| Mrp-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|15230111|ref|NP_189086.1| ATP binding protein [Arabidopsis thaliana] gi|40950525|gb|AAR97892.1| [4Fe-4S] cluster assembly factor [Arabidopsis thaliana] gi|110740872|dbj|BAE98532.1| putative mrp protein [Arabidopsis thaliana] gi|332643376|gb|AEE76897.1| ATP binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|21592386|gb|AAM64337.1| mrp protein, putative [Arabidopsis thaliana] gi|30502918|emb|CAD90253.1| putative PSI stabilising protein precursor [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297835526|ref|XP_002885645.1| high-chlorophyll-fluorescence 101 [Arabidopsis lyrata subsp. lyrata] gi|297331485|gb|EFH61904.1| high-chlorophyll-fluorescence 101 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 532 | ||||||
| TAIR|locus:2087148 | 532 | HCF101 "HIGH-CHLOROPHYLL-FLUOR | 0.990 | 0.990 | 0.790 | 6e-222 | |
| UNIPROTKB|Q4K759 | 364 | PFL_4843 "Uncharacterized prot | 0.627 | 0.917 | 0.420 | 2.4e-60 | |
| UNIPROTKB|Q87XN1 | 364 | PSPTO_4146 "ParA family protei | 0.625 | 0.914 | 0.416 | 2.5e-58 | |
| UNIPROTKB|Q48LT6 | 364 | PSPPH_1379 "ATP-binding protei | 0.627 | 0.917 | 0.408 | 4e-58 | |
| UNIPROTKB|Q8EDX3 | 371 | apbC "Scaffold protein for [4F | 0.639 | 0.916 | 0.394 | 2.8e-57 | |
| TIGR_CMR|SO_2618 | 371 | SO_2618 "ATP-binding protein, | 0.639 | 0.916 | 0.394 | 2.8e-57 | |
| UNIPROTKB|Q60CU7 | 361 | MCA0052 "MrP protein" [Methylo | 0.620 | 0.914 | 0.393 | 2e-56 | |
| UNIPROTKB|Q5LSG5 | 353 | SPO1803 "Mrp/NBP35 family prot | 0.605 | 0.912 | 0.385 | 1.3e-54 | |
| TIGR_CMR|SPO_1803 | 353 | SPO_1803 "Mrp/NBP35 family pro | 0.605 | 0.912 | 0.385 | 1.3e-54 | |
| UNIPROTKB|Q480H6 | 391 | CPS_2838 "Putative mrp protein | 0.646 | 0.879 | 0.372 | 8.9e-54 |
| TAIR|locus:2087148 HCF101 "HIGH-CHLOROPHYLL-FLUORESCENCE 101" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2143 (759.4 bits), Expect = 6.0e-222, P = 6.0e-222
Identities = 423/535 (79%), Positives = 461/535 (86%)
Query: 1 MQLLHAPCWPHLPFQ---GCKSPSILALVPPDRFLQLSAINFSLHPSKLEKSIWVSHRPS 57
M LLH H F+ +S S L+ +FL A S+ +++ K VS S
Sbjct: 1 MPLLHPQSLRHPSFEIQTQRRSNSTTRLLLSHKFLHSQASIISISRTRILKR--VSQNLS 58
Query: 58 IFGCGSTNATSVEAGVSAVSTGTAENDVLKALSQIIDPDFGTDIVSCGFVKDMQINEALG 117
+ S A+S G S T +E DVLKALSQIIDPDFGTDIVSCGFVKD+ INEALG
Sbjct: 59 VAKAASAQASS-SVGESVAQT--SEKDVLKALSQIIDPDFGTDIVSCGFVKDLGINEALG 115
Query: 118 EVSFRLELTTPACPIKDMFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKI 177
EVSFRLELTTPACP+KDMFE +ANEVV A+PWV KVNVTMSAQPA+PIFA QLP GL +I
Sbjct: 116 EVSFRLELTTPACPVKDMFENKANEVVAALPWVKKVNVTMSAQPAKPIFAGQLPFGLSRI 175
Query: 178 SNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNP 237
SNI+AVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMV+PE+R+LEMNP
Sbjct: 176 SNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEMNP 235
Query: 238 EKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGT 297
EK+TIIPTEY+GVKLVSFGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGT
Sbjct: 236 EKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGT 295
Query: 298 GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKR 357
GDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADGKR
Sbjct: 296 GDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKR 355
Query: 358 YYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCV 417
YYPFG+GSGS+VV+QFGIPHLFDLPIRPTLSASGDSG PEV +DP +VA TFQDLGVCV
Sbjct: 356 YYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGVCV 415
Query: 418 VQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGDQK 477
VQQCAKIRQQVSTAV YDK +KAI+VKVP SDEEF LHPATVRRNDRSAQSVDEWTG+QK
Sbjct: 416 VQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGEQK 475
Query: 478 LQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTPV 532
+ Y DV EDIEPE+IRPMGNYAVSITWPDGFSQIAPYDQL+ +ERLVDVP +PV
Sbjct: 476 VLYGDVAEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQLEEIERLVDVPPLSPV 530
|
|
| UNIPROTKB|Q4K759 PFL_4843 "Uncharacterized protein" [Pseudomonas protegens Pf-5 (taxid:220664)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q87XN1 PSPTO_4146 "ParA family protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q48LT6 PSPPH_1379 "ATP-binding protein, Mrp/Nbp35 family" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8EDX3 apbC "Scaffold protein for [4Fe-4S] cluster assembly ApbC" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_2618 SO_2618 "ATP-binding protein, Mrp/Nbp35 family" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60CU7 MCA0052 "MrP protein" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5LSG5 SPO1803 "Mrp/NBP35 family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1803 SPO_1803 "Mrp/NBP35 family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q480H6 CPS_2838 "Putative mrp protein" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| HCF101 | HCF101 (HIGH-CHLOROPHYLL-FLUORESCENCE 101); ATP binding; encodes a MRP-like protein with a nucleotide-binding domain. (532 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| SBPASE | • | • | 0.929 | ||||||||
| AT3G48420 | • | 0.917 | |||||||||
| AT5G08650 | • | 0.917 | |||||||||
| AT5G07020 | • | 0.909 | |||||||||
| CYP38 | • | 0.909 | |||||||||
| AT1G14150 | • | 0.903 | |||||||||
| ATPRX_Q | • | 0.903 | |||||||||
| AT1G32080 | • | 0.903 | |||||||||
| AT5G47190 | • | 0.901 | |||||||||
| AT2G43560 | • | 0.901 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 532 | |||
| cd02037 | 169 | cd02037, MRP-like, MRP (Multiple Resistance and pH | 4e-84 | |
| PRK11670 | 369 | PRK11670, PRK11670, antiporter inner membrane prot | 2e-77 | |
| COG0489 | 265 | COG0489, Mrp, ATPases involved in chromosome parti | 3e-60 | |
| pfam10609 | 81 | pfam10609, ParA, ParA/MinD ATPase like | 4e-39 | |
| COG0455 | 262 | COG0455, flhG, Antiactivator of flagellar biosynth | 2e-18 | |
| pfam01883 | 72 | pfam01883, DUF59, Domain of unknown function DUF59 | 2e-15 | |
| pfam01656 | 217 | pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide bi | 8e-15 | |
| cd03110 | 179 | cd03110, Fer4_NifH_child, This protein family's fu | 5e-14 | |
| COG2151 | 111 | COG2151, PaaD, Predicted metal-sulfur cluster bios | 5e-14 | |
| COG1192 | 259 | COG1192, Soj, ATPases involved in chromosome parti | 1e-13 | |
| cd02038 | 139 | cd02038, FleN-like, FleN is a member of the Fer4_N | 2e-12 | |
| COG1149 | 284 | COG1149, COG1149, MinD superfamily P-loop ATPase c | 1e-11 | |
| cd02042 | 104 | cd02042, ParA, ParA and ParB of Caulobacter cresce | 5e-11 | |
| TIGR01969 | 251 | TIGR01969, minD_arch, cell division ATPase MinD, a | 3e-10 | |
| cd02035 | 217 | cd02035, ArsA, ArsA ATPase functionas as an efflux | 2e-09 | |
| CHL00175 | 281 | CHL00175, minD, septum-site determining protein; V | 2e-09 | |
| TIGR01968 | 261 | TIGR01968, minD_bact, septum site-determining prot | 4e-09 | |
| cd02036 | 179 | cd02036, MinD, Bacterial cell division requires th | 6e-09 | |
| TIGR02945 | 99 | TIGR02945, SUF_assoc, FeS assembly SUF system prot | 3e-08 | |
| cd01983 | 99 | cd01983, Fer4_NifH, The Fer4_NifH superfamily cont | 4e-08 | |
| pfam13614 | 145 | pfam13614, AAA_31, AAA domain | 1e-07 | |
| cd02034 | 116 | cd02034, CooC, The accessory protein CooC, which c | 3e-07 | |
| cd03111 | 106 | cd03111, CpaE_like, This protein family consists o | 4e-07 | |
| TIGR03018 | 207 | TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEP- | 2e-06 | |
| pfam06155 | 87 | pfam06155, DUF971, Protein of unknown function (DU | 9e-06 | |
| PHA02518 | 211 | PHA02518, PHA02518, ParA-like protein; Provisional | 2e-05 | |
| COG2894 | 272 | COG2894, MinD, Septum formation inhibitor-activati | 3e-05 | |
| cd01983 | 99 | cd01983, Fer4_NifH, The Fer4_NifH superfamily cont | 5e-05 | |
| pfam09140 | 262 | pfam09140, MipZ, ATPase MipZ | 1e-04 | |
| COG0003 | 322 | COG0003, ArsA, Predicted ATPase involved in chromo | 3e-04 | |
| TIGR01005 | 754 | TIGR01005, eps_transp_fam, exopolysaccharide trans | 4e-04 | |
| TIGR01007 | 204 | TIGR01007, eps_fam, capsular exopolysaccharide fam | 4e-04 | |
| PRK13705 | 388 | PRK13705, PRK13705, plasmid-partitioning protein S | 7e-04 | |
| cd02038 | 139 | cd02038, FleN-like, FleN is a member of the Fer4_N | 0.001 | |
| COG1348 | 278 | COG1348, NifH, Nitrogenase subunit NifH (ATPase) [ | 0.001 | |
| TIGR03406 | 174 | TIGR03406, FeS_long_SufT, probable FeS assembly SU | 0.001 | |
| cd02040 | 270 | cd02040, NifH, NifH gene encodes component II (iro | 0.001 | |
| TIGR03453 | 387 | TIGR03453, partition_RepA, plasmid partitioning pr | 0.002 | |
| cd02117 | 212 | cd02117, NifH_like, This family contains the NifH | 0.002 | |
| PRK13869 | 405 | PRK13869, PRK13869, plasmid-partitioning protein R | 0.003 | |
| pfam07015 | 231 | pfam07015, VirC1, VirC1 protein | 0.004 | |
| PRK13849 | 231 | PRK13849, PRK13849, putative crown gall tumor prot | 0.004 |
| >gnl|CDD|238994 cd02037, MRP-like, MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
Score = 257 bits (660), Expect = 4e-84
Identities = 96/208 (46%), Positives = 122/208 (58%), Gaps = 41/208 (19%)
Query: 180 IVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEK 239
++AV S KGGVGKSTVAVNLA LA +G +VG+ DAD+YGPS+P M
Sbjct: 1 VIAVMSGKGGVGKSTVAVNLALALAKLGYKVGLLDADIYGPSIPKMW------------- 47
Query: 240 RTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD 299
RGPM G I Q LT +WGELDYLVIDMPPGTGD
Sbjct: 48 --------------------------RGPMKMGAIKQFLTDVDWGELDYLVIDMPPGTGD 81
Query: 300 IQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHF--DADGKR 357
LTL Q +P+ AVIVTTPQ++A DV K + MF K+ +P + VVENM +F GK+
Sbjct: 82 EHLTLAQSLPIDGAVIVTTPQEVALDDVRKAIDMFKKVNIPILGVVENMSYFVCPHCGKK 141
Query: 358 YYPFGRGSGSQVVQQFGIPHLFDLPIRP 385
Y FG+G G ++ ++ G+P L +P+ P
Sbjct: 142 IYIFGKGGGEKLAEELGVPLLGKIPLDP 169
|
Like the other members of the superfamily, MRP contains a ATP-binding domain at the N-termini. It is found in bacteria as a membrane-spanning protein and functions as a Na+/H+ antiporter. Length = 169 |
| >gnl|CDD|183270 PRK11670, PRK11670, antiporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223563 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|204531 pfam10609, ParA, ParA/MinD ATPase like | Back alignment and domain information |
|---|
| >gnl|CDD|223531 COG0455, flhG, Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] | Back alignment and domain information |
|---|
| >gnl|CDD|216762 pfam01883, DUF59, Domain of unknown function DUF59 | Back alignment and domain information |
|---|
| >gnl|CDD|216631 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239384 cd03110, Fer4_NifH_child, This protein family's function is unkown | Back alignment and domain information |
|---|
| >gnl|CDD|225062 COG2151, PaaD, Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224113 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|238995 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|238997 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >gnl|CDD|131024 TIGR01969, minD_arch, cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >gnl|CDD|238992 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >gnl|CDD|214385 CHL00175, minD, septum-site determining protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|131023 TIGR01968, minD_bact, septum site-determining protein MinD | Back alignment and domain information |
|---|
| >gnl|CDD|238993 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >gnl|CDD|131990 TIGR02945, SUF_assoc, FeS assembly SUF system protein | Back alignment and domain information |
|---|
| >gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|222264 pfam13614, AAA_31, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|238991 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >gnl|CDD|239385 cd03111, CpaE_like, This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >gnl|CDD|132063 TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEP-CTERM locus tyrosine autokinase | Back alignment and domain information |
|---|
| >gnl|CDD|218914 pfam06155, DUF971, Protein of unknown function (DUF971) | Back alignment and domain information |
|---|
| >gnl|CDD|222854 PHA02518, PHA02518, ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225447 COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|220125 pfam09140, MipZ, ATPase MipZ | Back alignment and domain information |
|---|
| >gnl|CDD|223082 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|130078 TIGR01005, eps_transp_fam, exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >gnl|CDD|130080 TIGR01007, eps_fam, capsular exopolysaccharide family | Back alignment and domain information |
|---|
| >gnl|CDD|184261 PRK13705, PRK13705, plasmid-partitioning protein SopA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238995 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224267 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213809 TIGR03406, FeS_long_SufT, probable FeS assembly SUF system protein SufT | Back alignment and domain information |
|---|
| >gnl|CDD|238996 cd02040, NifH, NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|234215 TIGR03453, partition_RepA, plasmid partitioning protein RepA | Back alignment and domain information |
|---|
| >gnl|CDD|239034 cd02117, NifH_like, This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >gnl|CDD|139929 PRK13869, PRK13869, plasmid-partitioning protein RepA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148565 pfam07015, VirC1, VirC1 protein | Back alignment and domain information |
|---|
| >gnl|CDD|139909 PRK13849, PRK13849, putative crown gall tumor protein VirC1; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 532 | |||
| PRK11670 | 369 | antiporter inner membrane protein; Provisional | 100.0 | |
| KOG3022 | 300 | consensus Predicted ATPase, nucleotide-binding [Ce | 100.0 | |
| CHL00175 | 281 | minD septum-site determining protein; Validated | 100.0 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 100.0 | |
| TIGR01969 | 251 | minD_arch cell division ATPase MinD, archaeal. Thi | 100.0 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 99.97 | |
| PRK13236 | 296 | nitrogenase reductase; Reviewed | 99.97 | |
| COG2894 | 272 | MinD Septum formation inhibitor-activating ATPase | 99.97 | |
| TIGR03371 | 246 | cellulose_yhjQ cellulose synthase operon protein Y | 99.97 | |
| PRK13233 | 275 | nifH nitrogenase reductase; Reviewed | 99.97 | |
| PRK10818 | 270 | cell division inhibitor MinD; Provisional | 99.97 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 99.97 | |
| CHL00072 | 290 | chlL photochlorophyllide reductase subunit L | 99.97 | |
| TIGR01968 | 261 | minD_bact septum site-determining protein MinD. Th | 99.97 | |
| COG0455 | 262 | flhG Antiactivator of flagellar biosynthesis FleN, | 99.97 | |
| PRK13234 | 295 | nifH nitrogenase reductase; Reviewed | 99.97 | |
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 99.97 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 99.97 | |
| COG0489 | 265 | Mrp ATPases involved in chromosome partitioning [C | 99.97 | |
| PRK13231 | 264 | nitrogenase reductase-like protein; Reviewed | 99.96 | |
| PRK10037 | 250 | cell division protein; Provisional | 99.96 | |
| PRK13869 | 405 | plasmid-partitioning protein RepA; Provisional | 99.96 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 99.96 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 99.96 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 99.96 | |
| PF06564 | 243 | YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p | 99.96 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 99.96 | |
| TIGR03453 | 387 | partition_RepA plasmid partitioning protein RepA. | 99.96 | |
| COG1192 | 259 | Soj ATPases involved in chromosome partitioning [C | 99.95 | |
| PHA02518 | 211 | ParA-like protein; Provisional | 99.95 | |
| PRK13705 | 388 | plasmid-partitioning protein SopA; Provisional | 99.95 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 99.95 | |
| PHA02519 | 387 | plasmid partition protein SopA; Reviewed | 99.95 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 99.94 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 99.94 | |
| cd02033 | 329 | BchX Chlorophyllide reductase converts chlorophyll | 99.94 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 99.93 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 99.92 | |
| PF06155 | 89 | DUF971: Protein of unknown function (DUF971); Inte | 99.92 | |
| TIGR01007 | 204 | eps_fam capsular exopolysaccharide family. This mo | 99.91 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 99.91 | |
| PRK13849 | 231 | putative crown gall tumor protein VirC1; Provision | 99.91 | |
| cd03110 | 179 | Fer4_NifH_child This protein family's function is | 99.91 | |
| TIGR03018 | 207 | pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t | 99.91 | |
| TIGR03029 | 274 | EpsG chain length determinant protein tyrosine kin | 99.9 | |
| COG1348 | 278 | NifH Nitrogenase subunit NifH (ATPase) [Inorganic | 99.89 | |
| PF00142 | 273 | Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot | 99.88 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 99.87 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 99.86 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 99.84 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 99.84 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 99.83 | |
| COG3536 | 120 | Uncharacterized protein conserved in bacteria [Fun | 99.83 | |
| cd03111 | 106 | CpaE_like This protein family consists of proteins | 99.82 | |
| COG4963 | 366 | CpaE Flp pilus assembly protein, ATPase CpaE [Intr | 99.81 | |
| cd02038 | 139 | FleN-like FleN is a member of the Fer4_NifH superf | 99.81 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 99.78 | |
| PF07015 | 231 | VirC1: VirC1 protein; InterPro: IPR009744 This fam | 99.77 | |
| PF09140 | 261 | MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi | 99.76 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 99.76 | |
| COG2151 | 111 | PaaD Predicted metal-sulfur cluster biosynthetic e | 99.75 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 99.74 | |
| PF13614 | 157 | AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ | 99.68 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 99.65 | |
| TIGR02409 | 366 | carnitine_bodg gamma-butyrobetaine hydroxylase. Me | 99.61 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 99.59 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 99.57 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 99.53 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 99.51 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 99.5 | |
| PF01883 | 72 | DUF59: Domain of unknown function DUF59; InterPro: | 99.48 | |
| TIGR02410 | 362 | carnitine_TMLD trimethyllysine dioxygenase. Member | 99.47 | |
| PF10609 | 81 | ParA: ParA/MinD ATPase like; InterPro: IPR019591 T | 99.45 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 99.45 | |
| KOG2825 | 323 | consensus Putative arsenite-translocating ATPase [ | 99.45 | |
| TIGR03406 | 174 | FeS_long_SufT probable FeS assembly SUF system pro | 99.44 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 99.44 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 99.38 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 99.33 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 99.31 | |
| PRK13886 | 241 | conjugal transfer protein TraL; Provisional | 99.28 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 99.28 | |
| TIGR00347 | 166 | bioD dethiobiotin synthase. Dethiobiotin synthase | 99.21 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 99.2 | |
| PRK00090 | 222 | bioD dithiobiotin synthetase; Reviewed | 99.19 | |
| KOG3889 | 371 | consensus Predicted gamma-butyrobetaine,2-oxogluta | 99.19 | |
| KOG3888 | 407 | consensus Gamma-butyrobetaine,2-oxoglutarate dioxy | 99.19 | |
| PRK13768 | 253 | GTPase; Provisional | 99.16 | |
| TIGR02945 | 99 | SUF_assoc FeS assembly SUF system protein. Members | 99.16 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 99.09 | |
| TIGR00345 | 284 | arsA arsenite-activated ATPase (arsA). The N-termi | 99.06 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 99.05 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 99.05 | |
| TIGR02159 | 146 | PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subu | 99.04 | |
| PRK01077 | 451 | cobyrinic acid a,c-diamide synthase; Validated | 99.0 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.99 | |
| cd03109 | 134 | DTBS Dethiobiotin synthetase (DTBS) is the penulti | 98.99 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 98.97 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 98.97 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 98.86 | |
| PRK12374 | 231 | putative dithiobiotin synthetase; Provisional | 98.83 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 98.83 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 98.82 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 98.81 | |
| PRK13505 | 557 | formate--tetrahydrofolate ligase; Provisional | 98.79 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 98.79 | |
| PF13500 | 199 | AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R | 98.78 | |
| PRK05632 | 684 | phosphate acetyltransferase; Reviewed | 98.75 | |
| TIGR00313 | 475 | cobQ cobyric acid synthase CobQ. | 98.73 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.69 | |
| COG0132 | 223 | BioD Dethiobiotin synthetase [Coenzyme metabolism] | 98.66 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.65 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 98.64 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 98.64 | |
| PRK00784 | 488 | cobyric acid synthase; Provisional | 98.62 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.61 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 98.51 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.5 | |
| TIGR00379 | 449 | cobB cobyrinic acid a,c-diamide synthase. This mod | 98.5 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 98.42 | |
| COG1797 | 451 | CobB Cobyrinic acid a,c-diamide synthase [Coenzyme | 98.35 | |
| KOG0781 | 587 | consensus Signal recognition particle receptor, al | 98.19 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 98.09 | |
| PRK06278 | 476 | cobyrinic acid a,c-diamide synthase; Validated | 97.97 | |
| PRK13896 | 433 | cobyrinic acid a,c-diamide synthase; Provisional | 97.96 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 97.77 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.76 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 97.64 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 97.58 | |
| cd00477 | 524 | FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca | 97.52 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 97.44 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 97.41 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 97.41 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 97.38 | |
| PRK13506 | 578 | formate--tetrahydrofolate ligase; Provisional | 97.38 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 97.38 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 97.34 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 97.32 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 97.21 | |
| PRK14495 | 452 | putative molybdopterin-guanine dinucleotide biosyn | 97.19 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 97.12 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.11 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 97.07 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 97.03 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 96.99 | |
| COG1492 | 486 | CobQ Cobyric acid synthase [Coenzyme metabolism] | 96.98 | |
| COG0857 | 354 | Pta BioD-like N-terminal domain of phosphotransace | 96.92 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 96.9 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 96.87 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.84 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 96.83 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 96.82 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 96.79 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 96.78 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 96.78 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 96.73 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 96.73 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 96.7 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 96.68 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 96.66 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 96.66 | |
| PRK07667 | 193 | uridine kinase; Provisional | 96.63 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 96.6 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 96.59 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 96.51 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 96.5 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 96.49 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 96.48 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 96.47 | |
| PLN02974 | 817 | adenosylmethionine-8-amino-7-oxononanoate transami | 96.43 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 96.42 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 96.42 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 96.38 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 96.36 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 96.35 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 96.35 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 96.34 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 96.32 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 96.31 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 96.27 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 96.22 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.2 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 96.19 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.18 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 96.18 | |
| PF13479 | 213 | AAA_24: AAA domain | 96.17 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 96.16 | |
| cd03113 | 255 | CTGs CTP synthetase (CTPs) is a two-domain protein | 96.15 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 96.15 | |
| COG3367 | 339 | Uncharacterized conserved protein [Function unknow | 96.13 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.12 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 96.09 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.08 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 96.07 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 96.07 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 96.06 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.06 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 96.02 | |
| PRK00652 | 325 | lpxK tetraacyldisaccharide 4'-kinase; Reviewed | 96.01 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 96.01 | |
| PRK14491 | 597 | putative bifunctional molybdopterin-guanine dinucl | 95.99 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 95.99 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 95.97 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 95.94 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 95.93 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 95.93 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 95.93 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 95.92 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 95.9 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 95.89 | |
| KOG1534 | 273 | consensus Putative transcription factor FET5 [Tran | 95.85 | |
| TIGR00682 | 311 | lpxK tetraacyldisaccharide 4'-kinase. Also called | 95.82 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 95.81 | |
| PF07755 | 301 | DUF1611: Protein of unknown function (DUF1611); In | 95.8 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 95.79 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 95.77 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 95.74 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.73 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 95.71 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 95.7 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 95.66 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 95.64 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 95.63 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 95.6 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 95.55 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 95.53 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 95.52 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 95.52 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 95.5 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 95.45 | |
| COG3598 | 402 | RepA RecA-family ATPase [DNA replication, recombin | 95.45 | |
| PRK07414 | 178 | cob(I)yrinic acid a,c-diamide adenosyltransferase; | 95.44 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 95.43 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 95.42 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 95.4 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 95.4 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 95.4 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 95.38 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 95.33 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 95.31 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 95.28 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 95.22 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 95.21 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 95.18 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 95.18 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 95.16 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 95.14 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 95.11 | |
| CHL00071 | 409 | tufA elongation factor Tu | 95.03 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 95.02 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 95.0 | |
| KOG0635 | 207 | consensus Adenosine 5'-phosphosulfate kinase [Inor | 94.97 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 94.96 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 94.95 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 94.95 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 94.93 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 94.92 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.92 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 94.87 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 94.84 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 94.84 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 94.84 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 94.83 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 94.8 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 94.78 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 94.78 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 94.77 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 94.77 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 94.76 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 94.71 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 94.7 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 94.68 | |
| PRK01906 | 338 | tetraacyldisaccharide 4'-kinase; Provisional | 94.65 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 94.63 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 94.59 | |
| PTZ00416 | 836 | elongation factor 2; Provisional | 94.59 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 94.59 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 94.59 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 94.56 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 94.55 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 94.54 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 94.51 | |
| PRK06526 | 254 | transposase; Provisional | 94.46 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 94.44 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 94.43 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 94.43 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 94.41 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 94.41 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 94.37 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 94.36 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 94.27 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 94.25 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 94.21 | |
| PRK06217 | 183 | hypothetical protein; Validated | 94.16 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 94.12 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 94.11 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 94.11 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 94.09 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 94.09 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 94.07 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 94.06 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 94.04 | |
| PF02606 | 326 | LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr | 94.03 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 94.03 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 93.99 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 93.98 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 93.94 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 93.94 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 93.89 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 93.89 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 93.87 | |
| PRK12377 | 248 | putative replication protein; Provisional | 93.82 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 93.8 | |
| PLN02924 | 220 | thymidylate kinase | 93.79 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 93.77 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 93.75 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 93.75 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 93.72 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 93.7 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 93.7 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 93.69 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 93.65 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 93.62 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 93.61 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 93.61 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 93.58 | |
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 93.55 | |
| COG1663 | 336 | LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell env | 93.52 | |
| COG2403 | 449 | Predicted GTPase [General function prediction only | 93.51 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 93.5 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 93.48 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 93.47 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 93.46 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 93.44 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 93.43 | |
| PRK06749 | 428 | replicative DNA helicase; Provisional | 93.4 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 93.39 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 93.37 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 93.35 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 93.34 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 93.31 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 93.28 | |
| PF13173 | 128 | AAA_14: AAA domain | 93.28 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 93.28 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 93.27 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 93.25 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 93.24 | |
| PF06155 | 89 | DUF971: Protein of unknown function (DUF971); Inte | 93.24 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 93.23 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 93.22 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 93.19 | |
| PF02572 | 172 | CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase | 93.18 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 93.14 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 93.13 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 93.12 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 93.09 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 93.05 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 93.04 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 93.03 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 93.02 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 93.0 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 92.96 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 92.92 | |
| PLN03118 | 211 | Rab family protein; Provisional | 92.92 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 92.89 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 92.88 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 92.86 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 92.85 | |
| PF05729 | 166 | NACHT: NACHT domain | 92.84 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 92.8 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 92.8 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 92.79 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 92.78 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 92.76 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 92.73 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 92.7 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 92.69 | |
| KOG2749 | 415 | consensus mRNA cleavage and polyadenylation factor | 92.67 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 92.65 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 92.64 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 92.57 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 92.56 | |
| cd04102 | 202 | RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove | 92.55 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 92.55 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 92.51 | |
| PRK08727 | 233 | hypothetical protein; Validated | 92.5 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 92.48 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 92.42 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 92.4 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 92.39 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 92.38 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 92.31 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 92.31 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 92.31 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 92.29 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 92.28 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 92.26 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 92.19 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 92.18 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 92.14 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 92.11 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 92.1 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 92.08 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 92.04 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 92.04 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 92.03 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 91.99 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 91.97 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 91.93 | |
| PRK08181 | 269 | transposase; Validated | 91.93 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 91.9 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 91.85 | |
| PLN03108 | 210 | Rab family protein; Provisional | 91.81 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 91.79 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 91.74 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 91.72 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 91.71 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 91.7 | |
| TIGR03172 | 232 | probable selenium-dependent hydroxylase accessory | 91.7 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 91.67 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 91.67 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 91.65 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 91.65 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 91.65 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 91.61 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 91.61 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 91.59 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 91.57 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 91.54 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 91.5 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 91.5 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 91.47 | |
| PRK08116 | 268 | hypothetical protein; Validated | 91.45 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 91.43 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 91.39 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 91.35 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 91.32 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 91.26 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 91.25 | |
| PRK05380 | 533 | pyrG CTP synthetase; Validated | 91.23 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 91.1 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 91.06 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 90.98 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 90.94 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 90.9 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 90.87 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 90.85 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 90.84 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 90.74 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 90.73 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 90.7 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 90.66 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 90.52 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 90.51 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 90.42 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 90.4 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 90.35 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 90.32 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 90.25 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 90.22 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 90.2 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 90.19 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 90.14 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 90.04 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 90.01 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 89.89 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 89.87 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 89.85 | |
| COG0523 | 323 | Putative GTPases (G3E family) [General function pr | 89.81 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 89.79 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 89.76 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 89.74 | |
| PLN02422 | 232 | dephospho-CoA kinase | 89.71 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 89.7 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 89.68 | |
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 89.65 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 89.61 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 89.51 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 89.36 | |
| PLN02348 | 395 | phosphoribulokinase | 89.34 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 89.26 | |
| PRK03839 | 180 | putative kinase; Provisional | 89.26 | |
| COG2109 | 198 | BtuR ATP:corrinoid adenosyltransferase [Coenzyme m | 89.19 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 89.15 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 89.1 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 89.1 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 89.03 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 88.95 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 88.9 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 88.9 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 88.87 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 88.87 | |
| KOG3381 | 161 | consensus Uncharacterized conserved protein [Funct | 88.86 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 88.79 | |
| PRK13695 | 174 | putative NTPase; Provisional | 88.74 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 88.57 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 88.43 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 88.38 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 88.35 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 88.2 |
| >PRK11670 antiporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-50 Score=414.25 Aligned_cols=341 Identities=34% Similarity=0.547 Sum_probs=281.4
Q ss_pred ccHHHHHHHhccCCCCCCCCCccccCCeeEEEEecCCCeEEEEEEeCCCCCCchHHHHHHHHHHHhcCCCeeeEEEEccc
Q 009574 80 TAENDVLKALSQIIDPDFGTDIVSCGFVKDMQINEALGEVSFRLELTTPACPIKDMFEQRANEVVLAIPWVNKVNVTMSA 159 (532)
Q Consensus 80 ~~~~~v~~~L~~V~DPel~~~Iv~lglv~~v~i~~~~~~v~v~l~lt~~~cp~~~~l~~~i~~~L~~l~gv~~v~v~l~~ 159 (532)
..+++|+++|++|.||+++.|||++|+|+++.+++ +++.+.++++.+.||..+.+.+++++++..++|++++.+++..
T Consensus 12 ~~~~~v~~~l~~v~~p~~~~~~~~~~~v~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 89 (369)
T PRK11670 12 ALRAMVAGTLANFQHPTLKHNLTTLKALHHVALLD--DTLHIELVMPFVWNSAFEELKEQCSAELLRITGAKAIDWKLSH 89 (369)
T ss_pred chHHHHHHHHhcCCCCCCCCChhhhCCeeEEEEeC--CEEEEEEEECCCCchHHHHHHHHHHHHHHhcCCCceEEEEEee
Confidence 46689999999999999999999999999999987 7999999999999999999999999999999999988887765
Q ss_pred CCCcchhhccccccccCcceEEEEEeCcCCCcHHHHHHHHHHHHHHCCCcEEEEEcCCCCCCCCCCCCCcccccccCCCC
Q 009574 160 QPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEK 239 (532)
Q Consensus 160 ~p~~~~~~~~~~~~~~~~~kiIav~s~KGGvGKTTlA~nLA~~LA~~G~rVllID~D~~~~s~~~~lg~~~~~~~~~~~~ 239 (532)
...... ...-...+.+++++|+|+|+||||||||+|+|||.+||+.|+||++||+|+|+++++.+||.++..... ...
T Consensus 90 ~~~~~~-~~~~~~~~~~~~~vIaV~S~KGGVGKTT~avNLA~aLA~~G~rVlLID~D~qgps~~~~lg~~~~~~~~-~~~ 167 (369)
T PRK11670 90 NIATLK-RVNNQPGVNGVKNIIAVSSGKGGVGKSSTAVNLALALAAEGAKVGILDADIYGPSIPTMLGAEDQRPTS-PDG 167 (369)
T ss_pred ehhhhc-cccccccCCCCCEEEEEeCCCCCCCHHHHHHHHHHHHHHCCCcEEEEeCCCCCCCcchhcCCcccCCcc-cCC
Confidence 322110 101123577899999999999999999999999999999999999999999999999988865321111 112
Q ss_pred CceeecccCCcEEEecCCC--CCcccccCCchHHHHHHHHHHhcccCCCCEEEEcCCCCCChhhhhhhhhcCCCeEEEEe
Q 009574 240 RTIIPTEYLGVKLVSFGFS--GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVT 317 (532)
Q Consensus 240 ~~i~~~~~~~l~vl~~~~~--~~~~~~~~~~~~~~~l~~ll~~~~~~~yD~VIIDtpp~~~~~~~~~~~~~~~d~viiV~ 317 (532)
..+.+....++...+.+.. ......|++++....+.+++....|++|||||||||||+++..++..++.++|.+++|+
T Consensus 168 ~~i~p~~~~g~~~~~~~~l~~~~~~~i~~g~~~~~~l~~~l~~~~~~~yDyvIID~PPg~gd~~l~~~~l~aad~viiV~ 247 (369)
T PRK11670 168 THMAPIMAHGLATNSIGYLVTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVT 247 (369)
T ss_pred ceeeeeeccCcccccHHHhcCcCcceeecCcchHHHHHHHHHHHhhccCCEEEEeCCCCCchHHHHHhhhccCCeEEEEe
Confidence 2344433344443332221 12234567777777888887655578999999999999999777777777899999999
Q ss_pred CCCcchHHHHHHHHHHHHcCCCCEEEEEEecccccCC--CccccccCCchHHHHHHHhCCCcEEeccCchhhhhcccCCC
Q 009574 318 TPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDAD--GKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGM 395 (532)
Q Consensus 318 ~p~~~s~~~~~~~i~~l~~~~~~~~gvV~N~~~~~~~--~~~~~~~~~~~~~~l~~~~g~~~l~~IP~~~~i~~a~~~g~ 395 (532)
+|+..++.++.+.++++.+.+++++|+|+||+++.+. ++.+..|+++..+++++.|+.++++.||++..+.++.+.|+
T Consensus 248 tp~~~s~~da~~~i~~~~~~~~~ilGiV~Nm~~~~~~~~~~~~~if~~~~~~~lae~~~~~ll~~IP~~~~I~ea~~~G~ 327 (369)
T PRK11670 248 TPQDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAEKLAEKYHTQLLGQMPLHISLREDLDRGT 327 (369)
T ss_pred cCchhHHHHHHHHHHHHhccCCCeEEEEEcCCccccCCccchhhhcccchHHHHHHHcCCcEEEEeCCChHHHHHHHCCC
Confidence 9999999999999999999999999999999877653 33344577778999999999999999999999999999999
Q ss_pred ceEEeCCCCHHHHHHHHHHHHHHHHHHHh
Q 009574 396 PEVAADPCGEVANTFQDLGVCVVQQCAKI 424 (532)
Q Consensus 396 pv~~~~p~s~~a~~~~~La~~i~~~~~~~ 424 (532)
|+..+.|+++++++|.++++++.+++...
T Consensus 328 Pv~~~~p~s~~a~~y~~LA~el~~~~~~~ 356 (369)
T PRK11670 328 PTVVSRPESEFTAIYRQLADRVAAQLYWQ 356 (369)
T ss_pred cEEEeCCCCHHHHHHHHHHHHHHHHHhhh
Confidence 99999999999999999999999887544
|
|
| >KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >CHL00175 minD septum-site determining protein; Validated | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01969 minD_arch cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13236 nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >PRK13233 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK10818 cell division inhibitor MinD; Provisional | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >CHL00072 chlL photochlorophyllide reductase subunit L | Back alignment and domain information |
|---|
| >TIGR01968 minD_bact septum site-determining protein MinD | Back alignment and domain information |
|---|
| >COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] | Back alignment and domain information |
|---|
| >PRK13234 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13231 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10037 cell division protein; Provisional | Back alignment and domain information |
|---|
| >PRK13869 plasmid-partitioning protein RepA; Provisional | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >TIGR03453 partition_RepA plasmid partitioning protein RepA | Back alignment and domain information |
|---|
| >COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02518 ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13705 plasmid-partitioning protein SopA; Provisional | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >PHA02519 plasmid partition protein SopA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF06155 DUF971: Protein of unknown function (DUF971); InterPro: IPR010376 This domain is found in gamma-butyrobetaine dioxygenase and trimethyllysine dioxygenase proteins | Back alignment and domain information |
|---|
| >TIGR01007 eps_fam capsular exopolysaccharide family | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13849 putative crown gall tumor protein VirC1; Provisional | Back alignment and domain information |
|---|
| >cd03110 Fer4_NifH_child This protein family's function is unkown | Back alignment and domain information |
|---|
| >TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase | Back alignment and domain information |
|---|
| >TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG | Back alignment and domain information |
|---|
| >COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >COG3536 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins | Back alignment and domain information |
|---|
| >PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >COG2151 PaaD Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02409 carnitine_bodg gamma-butyrobetaine hydroxylase | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF01883 DUF59: Domain of unknown function DUF59; InterPro: IPR002744 This family includes prokaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02410 carnitine_TMLD trimethyllysine dioxygenase | Back alignment and domain information |
|---|
| >PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning [] | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03406 FeS_long_SufT probable FeS assembly SUF system protein SufT | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >PRK13886 conjugal transfer protein TraL; Provisional | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >TIGR00347 bioD dethiobiotin synthase | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK00090 bioD dithiobiotin synthetase; Reviewed | Back alignment and domain information |
|---|
| >KOG3889 consensus Predicted gamma-butyrobetaine,2-oxoglutarate dioxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3888 consensus Gamma-butyrobetaine,2-oxoglutarate dioxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02945 SUF_assoc FeS assembly SUF system protein | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00345 arsA arsenite-activated ATPase (arsA) | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit | Back alignment and domain information |
|---|
| >PRK01077 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK12374 putative dithiobiotin synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK13505 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A | Back alignment and domain information |
|---|
| >PRK05632 phosphate acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00313 cobQ cobyric acid synthase CobQ | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00784 cobyric acid synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR00379 cobB cobyrinic acid a,c-diamide synthase | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK06278 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >PRK13896 cobyrinic acid a,c-diamide synthase; Provisional | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13506 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0857 Pta BioD-like N-terminal domain of phosphotransacetylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3367 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >KOG1534 consensus Putative transcription factor FET5 [Transcription] | Back alignment and domain information |
|---|
| >TIGR00682 lpxK tetraacyldisaccharide 4'-kinase | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF07755 DUF1611: Protein of unknown function (DUF1611); InterPro: IPR011669 This entry contains a number of hypothetical bacterial and archaeal proteins | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK01906 tetraacyldisaccharide 4'-kinase; Provisional | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG2403 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06749 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PF06155 DUF971: Protein of unknown function (DUF971); InterPro: IPR010376 This domain is found in gamma-butyrobetaine dioxygenase and trimethyllysine dioxygenase proteins | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >cd04102 RabL3 RabL3 (Rab-like3) subfamily | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >TIGR03172 probable selenium-dependent hydroxylase accessory protein YqeC | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK05380 pyrG CTP synthetase; Validated | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >COG0523 Putative GTPases (G3E family) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3381 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 532 | ||||
| 3kb1_A | 262 | Crystal Structure Of The Nucleotide-Binding Protein | 3e-39 | ||
| 2ph1_A | 262 | Crystal Structure Of Nucleotide-Binding Protein Af2 | 2e-37 | ||
| 3vx3_A | 248 | Crystal Structure Of [nife] Hydrogenase Maturation | 2e-28 | ||
| 1uwd_A | 103 | Nmr Structure Of A Protein With Unknown Function Fr | 6e-09 | ||
| 1hyq_A | 263 | Mind Bacterial Cell Division Regulator From A. Fulg | 3e-05 |
| >pdb|3KB1|A Chain A, Crystal Structure Of The Nucleotide-Binding Protein Af_226 In Complex With Adp From Archaeoglobus Fulgidus, Northeast Structural Genomics Consortium Target Gr157 Length = 262 | Back alignment and structure |
|
| >pdb|2PH1|A Chain A, Crystal Structure Of Nucleotide-Binding Protein Af2382 From Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr165 Length = 262 | Back alignment and structure |
| >pdb|3VX3|A Chain A, Crystal Structure Of [nife] Hydrogenase Maturation Protein Hypb From Thermococcus Kodakarensis Kod1 Length = 248 | Back alignment and structure |
| >pdb|1UWD|A Chain A, Nmr Structure Of A Protein With Unknown Function From Thermotoga Maritima (Tm0487), Which Belongs To The Duf59 Family. Length = 103 | Back alignment and structure |
| >pdb|1HYQ|A Chain A, Mind Bacterial Cell Division Regulator From A. Fulgidus Length = 263 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 532 | |||
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 1e-104 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 4e-23 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 4e-22 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 2e-19 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 5e-19 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 5e-15 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 2e-13 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 3e-12 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 4e-12 | |
| 3luu_A | 101 | Uncharacterized protein; AFE_2189, PFAM DUF971 fam | 6e-12 | |
| 1uwd_A | 103 | Hypothetical protein TM0487; similar to PAAD prote | 8e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-12 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 1e-11 | |
| 3cq1_A | 103 | Putative uncharacterized protein TTHB138; DTDP-4-k | 3e-11 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 3e-11 | |
| 2l6n_A | 132 | Uncharacterized protein YP_001092504.1; PJ06155C, | 1e-10 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 2e-10 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 3e-10 | |
| 3lno_A | 108 | Putative uncharacterized protein; alpha-beta fold, | 5e-10 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 2e-09 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 2e-04 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 2e-08 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 5e-08 | |
| 2l6p_A | 124 | PHAC1, PHAC2 and PHAD genes; DUF971, structural ge | 9e-08 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 1e-07 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 2e-07 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 1e-06 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 2e-06 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 9e-06 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 2e-05 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 4e-05 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 5e-05 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 1e-04 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 3e-04 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 3e-04 | |
| 3o2g_A | 388 | Gamma-butyrobetaine dioxygenase; gamma-butyrobetai | 7e-04 |
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Length = 262 | Back alignment and structure |
|---|
Score = 311 bits (800), Expect = e-104
Identities = 93/245 (37%), Positives = 133/245 (54%), Gaps = 5/245 (2%)
Query: 168 EQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVS 227
E++ E L KI + +AV S KGGVGKSTV LA A G +VGI DAD GPS+P +
Sbjct: 8 EEIKERLGKIKSRIAVMSGKGGVGKSTVTALLAVHYARQGKKVGILDADFLGPSIPILFG 67
Query: 228 PENRLLEMNPEKRTIIPTEYLGVKLVSFGF--SGQGRA-IMRGPMVSGVINQLLTTTEWG 284
N + ++ E + T+ G+K++S F + I RGP+++G+I + L WG
Sbjct: 68 LRNARIAVSAEGLEPVLTQKYGIKVMSMQFLLPKENTPVIWRGPLIAGMIREFLGRVAWG 127
Query: 285 ELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAV 344
ELD+L+ID+PPGTGD LT+ Q T V+V+TPQ+L + V K + M + + +
Sbjct: 128 ELDHLLIDLPPGTGDAPLTVMQDAKPTGVVVVSTPQELTAVIVEKAINMAEETNTSVLGL 187
Query: 345 VENMCHF--DADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADP 402
VENM +F G + Y FG G G + +++ I +PI L DSG E
Sbjct: 188 VENMSYFVCPNCGHKSYIFGEGKGESLAKKYNIGFFTSIPIEEELIKLADSGRIEEYEKD 247
Query: 403 CGEVA 407
E A
Sbjct: 248 WFESA 252
|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Length = 373 | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Length = 254 | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Length = 263 | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Length = 245 | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Length = 237 | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Length = 260 | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Length = 299 | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Length = 286 | Back alignment and structure |
|---|
| >3luu_A Uncharacterized protein; AFE_2189, PFAM DUF971 family, structural genomics, joint CEN structural genomics, JCSG; HET: MSE; 1.93A {Acidithiobacillus ferrooxidans} Length = 101 | Back alignment and structure |
|---|
| >1uwd_A Hypothetical protein TM0487; similar to PAAD protein, alpha/beta fold,structural genomics joint center for structural genomics, JCSG; NMR {Thermotoga maritima} SCOP: d.52.8.2 PDB: 1wcj_A Length = 103 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Length = 271 | Back alignment and structure |
|---|
| >3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* Length = 103 | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Length = 206 | Back alignment and structure |
|---|
| >2l6n_A Uncharacterized protein YP_001092504.1; PJ06155C, DUF971, structural genomics, PSI-biology, protein initiative; NMR {Shewanella loihica} Length = 132 | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Length = 209 | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Length = 286 | Back alignment and structure |
|---|
| >3lno_A Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} Length = 108 | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Length = 398 | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Length = 298 | Back alignment and structure |
|---|
| >2l6p_A PHAC1, PHAC2 and PHAD genes; DUF971, structural genomics, PSI-biology, protein structure initiative, joint center for structural genomics; NMR {Pseudomonas aeruginosa} Length = 124 | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Length = 257 | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Length = 267 | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Length = 361 | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Length = 329 | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Length = 403 | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Length = 374 | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 324 | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Length = 334 | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Length = 349 | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Length = 289 | Back alignment and structure |
|---|
| >3o2g_A Gamma-butyrobetaine dioxygenase; gamma-butyrobetaine hydroxylase, 2-OXOG dioxygenase 1, oxidoreductase, structural genomics; HET: OGA NM2; 1.78A {Homo sapiens} PDB: 3ms5_A* 3n6w_A Length = 388 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 532 | |||
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 100.0 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 99.98 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 99.97 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 99.97 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 99.97 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 99.97 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 99.97 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 99.97 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 99.96 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 99.96 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 99.96 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 99.96 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 99.96 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 99.96 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 99.95 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 99.95 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 99.95 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 99.95 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 99.94 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 99.92 | |
| 3luu_A | 101 | Uncharacterized protein; AFE_2189, PFAM DUF971 fam | 99.92 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 99.91 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 99.9 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 99.89 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 99.89 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 99.89 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 99.88 | |
| 2l6p_A | 124 | PHAC1, PHAC2 and PHAD genes; DUF971, structural ge | 99.87 | |
| 2l6n_A | 132 | Uncharacterized protein YP_001092504.1; PJ06155C, | 99.87 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 99.86 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 99.85 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 99.83 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 99.82 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 99.82 | |
| 3o2g_A | 388 | Gamma-butyrobetaine dioxygenase; gamma-butyrobetai | 99.72 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 99.72 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 99.71 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 99.67 | |
| 1uwd_A | 103 | Hypothetical protein TM0487; similar to PAAD prote | 99.64 | |
| 3lno_A | 108 | Putative uncharacterized protein; alpha-beta fold, | 99.63 | |
| 3cq1_A | 103 | Putative uncharacterized protein TTHB138; DTDP-4-k | 99.61 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 99.55 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 99.51 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 99.48 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 99.46 | |
| 3of5_A | 228 | Dethiobiotin synthetase; structural genomics, cent | 99.44 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 99.4 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 99.37 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 99.36 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 99.36 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 99.31 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 99.27 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 99.24 | |
| 3qxc_A | 242 | Dethiobiotin synthetase; DTBS, structural genomics | 99.24 | |
| 3ux2_A | 130 | MIP18 family protein FAM96A; immune system, DUF59, | 99.17 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 99.04 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 98.83 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 98.65 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 98.55 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 98.37 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 98.34 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.96 | |
| 2obn_A | 349 | Hypothetical protein; structural genomics, joint c | 97.92 | |
| 3pzx_A | 557 | Formate--tetrahydrofolate ligase; HET: TOE; 2.20A | 97.91 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 97.87 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.66 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 97.65 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.51 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 97.46 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 97.38 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 97.26 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 97.12 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 97.03 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.95 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 96.82 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 96.75 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 96.73 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.65 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 96.64 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 96.57 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 96.55 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 96.55 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 96.5 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 96.44 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 96.42 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 96.39 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 96.35 | |
| 2g0t_A | 350 | Conserved hypothetical protein; structural genomic | 96.35 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 96.35 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 96.29 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 96.25 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 96.25 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.21 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.19 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.19 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 96.19 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 96.12 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 96.12 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 96.11 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 96.11 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 96.08 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 96.07 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 96.05 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 96.02 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 95.97 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 95.94 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 95.87 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 95.86 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 95.85 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 95.84 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 95.83 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 95.82 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 95.81 | |
| 1vco_A | 550 | CTP synthetase; tetramer, riken structural genomic | 95.78 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 95.77 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 95.76 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 95.75 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 95.75 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 95.75 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 95.73 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 95.7 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 95.7 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 95.69 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 95.66 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 95.65 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 95.63 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 95.55 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 95.54 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 95.49 | |
| 1s1m_A | 545 | CTP synthase; CTP synthetase, UTP:ammonia ligase ( | 95.47 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 95.44 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 95.4 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 95.38 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 95.37 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 95.33 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 95.29 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 95.26 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 95.24 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 95.24 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 95.18 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 95.16 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 95.16 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 95.14 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 95.13 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.13 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 95.11 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 95.1 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 95.07 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 95.05 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 95.02 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 95.02 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 94.99 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 94.98 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 94.97 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 94.95 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.94 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 94.93 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 94.93 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 94.91 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 94.9 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 94.87 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 94.87 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 94.87 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 94.86 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 94.86 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 94.83 | |
| 3luu_A | 101 | Uncharacterized protein; AFE_2189, PFAM DUF971 fam | 94.83 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 94.82 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 94.81 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 94.77 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 94.71 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 94.66 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 94.66 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 94.65 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 94.62 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 94.59 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 94.58 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 94.55 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 94.48 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 94.48 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 94.45 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 94.43 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 94.39 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 94.39 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 94.36 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 94.35 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 94.33 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 94.33 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 94.28 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 94.26 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 94.25 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 94.23 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 94.11 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 94.11 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 94.08 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 94.06 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 94.05 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 94.03 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 94.01 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 93.99 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 93.97 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 93.92 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 93.92 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 93.91 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 93.89 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 93.82 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.82 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 93.81 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 93.8 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 93.8 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 93.78 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 93.74 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 93.72 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.72 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 93.6 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 93.58 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 93.51 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 93.5 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 93.43 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 93.43 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 93.42 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 93.29 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 93.28 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 93.27 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 93.24 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 93.24 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 93.21 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 93.19 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 93.17 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 93.15 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 93.13 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 93.13 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 93.09 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 93.04 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 93.03 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 92.98 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 92.97 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 92.91 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 92.91 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 92.89 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 92.85 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 92.85 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 92.83 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 92.83 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 92.82 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 92.77 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 92.67 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 92.66 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 92.6 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 92.59 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 92.59 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 92.54 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 92.53 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 92.47 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 92.46 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 92.46 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 92.44 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 92.37 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 92.36 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 92.33 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 92.29 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 92.25 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.24 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 92.22 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.19 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 92.06 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 91.99 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 91.98 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 91.93 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 91.92 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 91.92 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 91.88 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 91.88 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 91.88 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 91.86 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 91.82 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 91.81 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 91.77 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 91.69 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 91.57 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 91.56 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 91.56 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 91.51 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 91.41 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 91.41 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 91.33 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 91.3 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 91.29 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 91.23 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 91.18 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 91.08 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 91.06 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 91.05 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 91.02 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 90.94 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 90.93 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 90.85 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 90.84 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 90.76 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 90.75 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 90.73 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 90.69 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 90.65 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 90.63 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 90.54 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 90.48 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 90.47 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 90.42 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 90.41 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 90.35 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 90.29 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 90.23 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 90.21 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 90.08 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 90.04 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 90.02 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 89.86 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 89.86 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 89.79 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 89.65 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 89.61 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 89.51 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 89.23 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 89.2 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 89.19 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 89.14 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 89.12 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 89.03 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 88.99 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 88.96 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 88.92 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 88.9 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 88.89 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 88.85 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 88.78 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 88.57 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 88.56 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 88.54 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 88.28 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 88.26 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 88.05 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 87.96 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 87.87 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 87.84 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 87.81 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 87.77 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 87.68 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 87.63 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 87.61 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 87.58 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 87.45 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 87.3 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 87.23 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 87.06 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 86.98 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 86.93 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 86.92 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 86.9 | |
| 2c5m_A | 294 | CTP synthase; cytidine 5-prime triphosphate synthe | 86.89 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 86.86 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 86.68 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 86.63 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 86.62 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 86.59 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 86.51 | |
| 3do6_A | 543 | Formate--tetrahydrofolate ligase; TM1766, putative | 86.43 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 86.39 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 86.22 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 86.11 | |
| 2l6n_A | 132 | Uncharacterized protein YP_001092504.1; PJ06155C, | 86.09 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 86.07 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 86.02 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 85.94 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 85.78 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 85.59 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 85.34 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 85.11 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 84.93 | |
| 2vo1_A | 295 | CTP synthase 1; pyrimidine biosynthesis, glutamine | 84.83 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 84.69 | |
| 1w78_A | 422 | FOLC bifunctional protein; DHFS, dihydrofolate syn | 84.57 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 84.57 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 84.5 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 84.49 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 84.29 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 84.12 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 83.92 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 83.72 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 83.71 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 83.6 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 83.57 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 83.5 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 83.33 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 83.25 | |
| 1jbw_A | 428 | Folylpolyglutamate synthase; FPGS folate AMPPCP te | 83.01 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 82.91 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 82.89 | |
| 3nva_A | 535 | CTP synthase; rossman fold, nucleotide binding, LI | 82.82 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 82.67 | |
| 3nrs_A | 437 | Dihydrofolate:folylpolyglutamate synthetase; struc | 82.55 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 82.33 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 82.19 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 82.08 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 81.93 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 81.81 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 81.62 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 81.51 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 81.46 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 81.33 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 81.25 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 81.22 | |
| 1e8c_A | 498 | UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diami | 81.15 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 80.9 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 80.9 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 80.82 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 80.76 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 80.46 | |
| 2wtz_A | 535 | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-di | 80.09 |
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.4e-32 Score=273.19 Aligned_cols=232 Identities=18% Similarity=0.160 Sum_probs=175.6
Q ss_pred CcceEEEEEeCcCCCcHHHHHHHHHHHHHHCCCcEEEEEcCCCCCCCCCCCCCccc-cc----cc-----CCCCCceeec
Q 009574 176 KISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENR-LL----EM-----NPEKRTIIPT 245 (532)
Q Consensus 176 ~~~kiIav~s~KGGvGKTTlA~nLA~~LA~~G~rVllID~D~~~~s~~~~lg~~~~-~~----~~-----~~~~~~i~~~ 245 (532)
..+|||||+ |||||||||+|+|||.+||++|+||++||+|+|++++..+++.... .. .. ....+.+...
T Consensus 46 ~~aKVIAIa-GKGGVGKTTtavNLA~aLA~~GkkVllID~Dpq~~s~~~l~~~~~~~~~~~~~~~~~~~~~~~~~d~i~~ 124 (314)
T 3fwy_A 46 TGAKVFAVY-GKGGIGKSTTSSNLSAAFSILGKRVLQIGCDPKHDSTFTLTGSLVPTVIDVLKDVDFHPEELRPEDFVFE 124 (314)
T ss_dssp -CCEEEEEE-CSTTSSHHHHHHHHHHHHHHTTCCEEEEEESSSCCTTHHHHTSCCCCHHHHHHHTTSCGGGCCHHHHCEE
T ss_pred CCceEEEEE-CCCccCHHHHHHHHHHHHHHCCCeEEEEecCCCCcccccccCCCCCcchhhHhhhccccccccHhHheee
Confidence 457899998 7999999999999999999999999999999999887655443211 10 00 0111122334
Q ss_pred ccCCcEEEecCCCCCcccccCCchHHHHHHHHHHhcccCCCCEEEEcCCCCCChhhhhhhhhcCCCeEEEEeCCCcchHH
Q 009574 246 EYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFI 325 (532)
Q Consensus 246 ~~~~l~vl~~~~~~~~~~~~~~~~~~~~l~~ll~~~~~~~yD~VIIDtpp~~~~~~~~~~~~~~~d~viiV~~p~~~s~~ 325 (532)
...++.+++++....... +........+..+.+...++.||||++|||++.....+. +.+.++|.+++|++|+..++.
T Consensus 125 ~~~~i~~v~~~~~~~~~~-~~~~~~~~~~~~l~~~~~~d~~D~v~iD~~~~~~~~~~~-~al~aAd~viIvt~~e~~Al~ 202 (314)
T 3fwy_A 125 GFNGVMCVEAGGPPAGTG-CGGYVVGQTVKLLKQHHLLDDTDVVIFDVLGDVVCGGFA-APLQHADQAVVVTANDFDSIY 202 (314)
T ss_dssp CGGGCEEEECCCCCTTCS-CTTHHHHHHHHHHHHTTTTSSCSEEEEEECCSSCCGGGG-GGGGTCSEEEEEECSSHHHHH
T ss_pred cCCCeEEEeCCCCcccch-hhhccHHHHHHHHHhcchhhcCceEeeccCCcchhhhhH-hHHhhCCeEEEEeCCcHHHHH
Confidence 456889998775433322 223334445555555445689999999999987655442 335678999999999999999
Q ss_pred HHHHHHHHHHcC----CCCEEEEEEecccccCCCccccccCCchHHHHHHHhCCCcEEeccCchhhhhcccCCCceEEeC
Q 009574 326 DVAKGVRMFSKL----KVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAAD 401 (532)
Q Consensus 326 ~~~~~i~~l~~~----~~~~~gvV~N~~~~~~~~~~~~~~~~~~~~~l~~~~g~~~l~~IP~~~~i~~a~~~g~pv~~~~ 401 (532)
++.++++.++.. +.++.|+|+|+... ....+++.+.++.++++.||.+..+++|...|+|+++++
T Consensus 203 ~~~~l~~~i~~~~~~~~~~l~GiI~n~~~~-----------~~~v~~~a~~~~~~~lg~IP~d~~Vr~a~~~G~pvv~~~ 271 (314)
T 3fwy_A 203 AMNRIIAAVQAKSKNYKVRLAGCVANRSRA-----------TDEVDRFCKETNFRRLAHMPDLDAIRRSRLKKKTLFEMD 271 (314)
T ss_dssp HHHHHHHHHHTTTTTCCCEEEEEEEESCSC-----------CHHHHHHHHHHTCCEEEEECCCHHHHHHHHTTCCTTTSC
T ss_pred HHHHHHHHHHHHhccCCCceEEEEEcCCCc-----------hhHHHHHHHHhCCeEEEEecCchHHHHHHHcCCceEEEC
Confidence 999988887754 45678999998432 235688899999999999999999999999999999999
Q ss_pred CCCHHHHH---HHHHHHHHHHHH
Q 009574 402 PCGEVANT---FQDLGVCVVQQC 421 (532)
Q Consensus 402 p~s~~a~~---~~~La~~i~~~~ 421 (532)
|+|+.+.+ |++||++|+++.
T Consensus 272 P~S~~a~aa~~Y~~LA~eil~~~ 294 (314)
T 3fwy_A 272 EDQDVLAARAEYIRLAESLWRGL 294 (314)
T ss_dssp CCHHHHHHHHHHHHHHHHHHHCC
T ss_pred CCChhhHHHHHHHHHHHHHHhCC
Confidence 99987666 999999998654
|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3luu_A Uncharacterized protein; AFE_2189, PFAM DUF971 family, structural genomics, joint CEN structural genomics, JCSG; HET: MSE; 1.93A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >2l6p_A PHAC1, PHAC2 and PHAD genes; DUF971, structural genomics, PSI-biology, protein structure initiative, joint center for structural genomics; NMR {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2l6n_A Uncharacterized protein YP_001092504.1; PJ06155C, DUF971, structural genomics, PSI-biology, protein initiative; NMR {Shewanella loihica} | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >3o2g_A Gamma-butyrobetaine dioxygenase; gamma-butyrobetaine hydroxylase, 2-OXOG dioxygenase 1, oxidoreductase, structural genomics; HET: OGA NM2; 1.78A {Homo sapiens} PDB: 3ms5_A* 3n6w_A | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1uwd_A Hypothetical protein TM0487; similar to PAAD protein, alpha/beta fold,structural genomics joint center for structural genomics, JCSG; NMR {Thermotoga maritima} SCOP: d.52.8.2 PDB: 1wcj_A | Back alignment and structure |
|---|
| >3lno_A Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} SCOP: d.52.8.0 | Back alignment and structure |
|---|
| >3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A | Back alignment and structure |
|---|
| >3ux2_A MIP18 family protein FAM96A; immune system, DUF59, 3D domain swapping, protein-protein interaction, alpha and beta protein (A+B); HET: MSE; 1.80A {Homo sapiens} PDB: 3ux3_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3luu_A Uncharacterized protein; AFE_2189, PFAM DUF971 family, structural genomics, joint CEN structural genomics, JCSG; HET: MSE; 1.93A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3do6_A Formate--tetrahydrofolate ligase; TM1766, putative formyltetrahydrofolate synthetase, structural genomics; HET: MSE; 1.85A {Thermotoga maritima} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2l6n_A Uncharacterized protein YP_001092504.1; PJ06155C, DUF971, structural genomics, PSI-biology, protein initiative; NMR {Shewanella loihica} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2vo1_A CTP synthase 1; pyrimidine biosynthesis, glutamine amidotransferase, phosphorylation, amidotransferase, cytidine 5-prime triphos synthetase, UTP; 2.8A {Homo sapiens} SCOP: c.37.1.10 PDB: 3ihl_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* 3pyz_A* 3qcz_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.00A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, C shape; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} PDB: 2xja_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 532 | ||||
| d1ihua2 | 279 | c.37.1.10 (A:308-586) Arsenite-translocating ATPas | 2e-31 | |
| d1cp2a_ | 269 | c.37.1.10 (A:) Nitrogenase iron protein {Clostridi | 4e-28 | |
| d2afhe1 | 289 | c.37.1.10 (E:1-289) Nitrogenase iron protein {Azot | 7e-27 | |
| d1g3qa_ | 237 | c.37.1.10 (A:) Cell division regulator MinD {Archa | 5e-24 | |
| d1ihua1 | 296 | c.37.1.10 (A:1-296) Arsenite-translocating ATPase | 9e-23 | |
| d1hyqa_ | 232 | c.37.1.10 (A:) Cell division regulator MinD {Archa | 1e-21 | |
| d1byia_ | 224 | c.37.1.10 (A:) Dethiobiotin synthetase {Escherichi | 9e-20 | |
| d2cu6a1 | 91 | d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Th | 1e-17 | |
| d1uwda_ | 102 | d.52.8.2 (A:) Hypothetical protein TM0487 {Thermot | 3e-15 | |
| d1bifa1 | 213 | c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct | 0.003 |
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 279 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: Arsenite-translocating ATPase ArsA species: Escherichia coli [TaxId: 562]
Score = 120 bits (302), Expect = 2e-31
Identities = 43/264 (16%), Positives = 78/264 (29%), Gaps = 39/264 (14%)
Query: 160 QPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYG 219
+P P L + + + + + + KGGVGK+T+A +A LA MG V + +D
Sbjct: 2 RPDIPSL-SALVDDIARNEHGLIMLMGKGGVGKTTMAAAIAVRLADMGFDVHLTTSDPAA 60
Query: 220 PSLPTMVSPENRLL-------EMNPEKRTIIPTEYLGVKLVSFGFSGQGR-AIMRGPMVS 271
L ++ L E+ E G +L G
Sbjct: 61 -HLSMTLNGSLNNLQVSRIDPHEETERYRQHVLETKGKELDEAGKRLLEEDLRSPCTEEI 119
Query: 272 GVINQLLTTTEWGELDYLVIDMPP-------------------------GTGDIQLTLCQ 306
V ++V+D P G + L Q
Sbjct: 120 AVFQAFSRVIREAGKRFVVMDTAPTGHTLLLLDATGAYHREIAKKMGEKGHFTTPMMLLQ 179
Query: 307 VVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSG 366
T ++VT P+ ++ A + + + N AD + R
Sbjct: 180 DPERTKVLLVTLPETTPVLEAANLQADLERAGIHPWGWIINNSLSIADTRSPLLRMRAQQ 239
Query: 367 SQ----VVQQFGIPHLFDLPIRPT 386
V++ + +P+ +
Sbjct: 240 ELPQIESVKRQHASRVALVPVLAS 263
|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Length = 269 | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Length = 289 | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 237 | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296 | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 232 | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Length = 224 | Back information, alignment and structure |
|---|
| >d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]} Length = 91 | Back information, alignment and structure |
|---|
| >d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} Length = 102 | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 532 | |||
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 100.0 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 100.0 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 99.98 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 99.97 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 99.86 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 99.82 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 99.79 | |
| d1uwda_ | 102 | Hypothetical protein TM0487 {Thermotoga maritima [ | 99.76 | |
| d2cu6a1 | 91 | Hypothetical protein TTHB138 {Thermus thermophilus | 99.73 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 99.11 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 99.08 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 99.04 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 99.0 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 98.87 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 98.11 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.99 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 97.92 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 97.82 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 97.7 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.57 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 97.45 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 96.99 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.85 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 96.68 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.66 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 96.64 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 96.56 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.84 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 95.78 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 95.73 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 95.64 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 95.62 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.6 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 95.58 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.55 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 95.55 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 95.43 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.28 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 95.28 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 95.25 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 95.16 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 95.1 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 95.1 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.09 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 95.07 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 94.91 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.83 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 94.83 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 94.75 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 94.72 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 94.7 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 94.49 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 94.49 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 94.44 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 94.41 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 94.39 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 94.35 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 94.33 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 94.27 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 94.21 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.15 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 94.12 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 94.09 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 93.97 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 93.96 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 93.85 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 93.75 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 93.64 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 93.57 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 93.48 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 93.17 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 93.17 | |
| d1e8ca3 | 234 | UDP-N-acetylmuramyl tripeptide synthetase MurE {Es | 93.12 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 92.95 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 92.88 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 92.81 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 92.74 | |
| d2g0ta1 | 338 | Hypothetical protein TM0796 {Thermotoga maritima [ | 92.59 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 92.52 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 92.48 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 92.37 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 92.35 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 92.27 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 92.15 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 92.06 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 92.02 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 91.88 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 91.83 | |
| d1s1ma2 | 266 | CTP synthase PyrG, N-terminal domain {Escherichia | 91.75 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 91.71 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 91.71 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 91.59 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 91.55 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 91.34 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 91.2 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 91.19 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 91.12 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 90.91 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 90.73 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 90.69 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 90.56 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 90.49 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 90.45 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 90.42 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 90.21 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 90.09 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 89.87 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 89.75 | |
| d1veha_ | 92 | HIRA-interacting protein 5, HIRIP5 {Mouse (Mus mus | 89.66 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 89.3 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 89.28 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 89.07 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 89.02 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 88.99 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 88.78 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 88.73 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 88.56 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 88.54 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 88.48 | |
| d1eg7a_ | 549 | Formyltetrahydrofolate synthetase {Moorella thermo | 88.42 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 88.07 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 87.82 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 87.77 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 87.44 | |
| d1gg4a4 | 214 | UDP-murNac-tripeptide D-alanyl-D-alanine-adding en | 87.31 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 87.21 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 86.96 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 86.93 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 86.88 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 86.73 | |
| d1p3da3 | 215 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 86.7 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 86.59 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 86.44 | |
| d2jfga3 | 204 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 86.3 | |
| d2gc6a2 | 296 | Folylpolyglutamate synthetase {Lactobacillus casei | 86.26 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 86.22 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 86.08 | |
| d2vo1a1 | 273 | CTP synthase PyrG, N-terminal domain {Human (Homo | 86.02 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 85.72 | |
| d1j6ua3 | 207 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 85.71 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 85.68 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 85.52 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 84.89 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 84.82 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 83.99 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 83.78 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 82.66 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 82.24 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 82.18 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 81.65 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 81.53 | |
| d1vcoa2 | 272 | CTP synthase PyrG, N-terminal domain {Thermus ther | 81.23 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 80.96 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 80.75 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 80.74 | |
| d1o5za2 | 296 | Folylpolyglutamate synthetase {Thermotoga maritima | 80.43 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 80.36 | |
| d2auwa2 | 84 | Hypothetical protein NE0471 N-terminal domain {Nit | 80.26 |
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: Cell division regulator MinD species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Probab=100.00 E-value=1.3e-34 Score=277.73 Aligned_cols=225 Identities=23% Similarity=0.278 Sum_probs=181.0
Q ss_pred ceEEEEEeCcCCCcHHHHHHHHHHHHHHCCCcEEEEEcCCCCCCCCCCCCCcccc------cccCCCCCceeecccCCcE
Q 009574 178 SNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRL------LEMNPEKRTIIPTEYLGVK 251 (532)
Q Consensus 178 ~kiIav~s~KGGvGKTTlA~nLA~~LA~~G~rVllID~D~~~~s~~~~lg~~~~~------~~~~~~~~~i~~~~~~~l~ 251 (532)
||+|+|+|+||||||||+|+|||..||++|+||++||+|+++++++.++|.+... .......+........+++
T Consensus 1 ~kvIav~s~KGGvGKTtia~nlA~~la~~g~~VlliD~D~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (232)
T d1hyqa_ 1 VRTITVASGKGGTGKTTITANLGVALAQLGHDVTIVDADITMANLELILGMEGLPVTLQNVLAGEARIDEAIYVGPGGVK 80 (232)
T ss_dssp CEEEEEEESSSCSCHHHHHHHHHHHHHHTTCCEEEEECCCSSSSHHHHTTCCCCCCCHHHHHTTSSCGGGGCEECGGGCE
T ss_pred CEEEEEECCCCCChHHHHHHHHHHHHHhCCCCEEEEeCCCCCCCHHHHhCCCcCcchhhhhhccccccccccccCCccce
Confidence 7999999999999999999999999999999999999999999999988876431 1112222233344567899
Q ss_pred EEecCCCCCcccccCCchHHHHHHHHHHhcccCCCCEEEEcCCCCCChhhhhhhhhcCCCeEEEEeCCCcchHHHHHHHH
Q 009574 252 LVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGV 331 (532)
Q Consensus 252 vl~~~~~~~~~~~~~~~~~~~~l~~ll~~~~~~~yD~VIIDtpp~~~~~~~~~~~~~~~d~viiV~~p~~~s~~~~~~~i 331 (532)
++|++.......... ...+.++++.+. ..|||||||+||+.+...... +..+|.+++|+.|+..++..+.+.+
T Consensus 81 ~l~~~~~~~~~~~~~----~~~l~~~l~~l~-~~~D~viiD~~~~~~~~~~~~--l~~ad~v~~v~~~~~~~~~~~~~~~ 153 (232)
T d1hyqa_ 81 VVPAGVSLEGLRKAN----PEKLEDVLTQIM-ESTDILLLDAPAGLERSAVIA--IAAAQELLLVVNPEISSITDGLKTK 153 (232)
T ss_dssp EEECCSCHHHHHHHC----HHHHHHHHHHHH-HTCSEEEEECCSSSSHHHHHH--HHHSSEEEEEECSSHHHHHHHHHHH
T ss_pred eEeeecccccccccc----hhhHHHHHHHHh-hccceeeecccccccchhHHH--hhhhheeeeeccccccchhhhhhhh
Confidence 999765432222222 234555555554 799999999999998765544 5568999999999999999999999
Q ss_pred HHHHcCCCCEEEEEEecccccCCCccccccCCchHHHHHHHhCCCcEEeccCchhhhhcccCCCceEEeCCCCHHHHHHH
Q 009574 332 RMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQ 411 (532)
Q Consensus 332 ~~l~~~~~~~~gvV~N~~~~~~~~~~~~~~~~~~~~~l~~~~g~~~l~~IP~~~~i~~a~~~g~pv~~~~p~s~~a~~~~ 411 (532)
..+++.+.+++++|+||+.... . +...+++++.++.++++.||+++.+.+|...|+|+.++.|+++++++|+
T Consensus 154 ~~~~~~~~~~~~iv~N~~~~~~--~------~~~~~~i~~~~~~~~~~~IP~d~~~~~a~~~g~p~~~~~p~s~~a~~~~ 225 (232)
T d1hyqa_ 154 IVAERLGTKVLGVVVNRITTLG--I------EMAKNEIEAILEAKVIGLIPEDPEVRRAAAYGKPVVLRSPNSPAARAIV 225 (232)
T ss_dssp HHHHHHTCEEEEEEEEEECTTT--H------HHHHHHHHHHTTSCEEEEEECCHHHHHHHHHTSCHHHHCTTSHHHHHHH
T ss_pred hhhhhccccccccccccccccc--c------cchhhhHHhhcCCeEEEECCCCHHHHHHHHCCceEEEECCCCHHHHHHH
Confidence 9999999999999999964221 1 1245678888999999999999999999999999999999999999999
Q ss_pred HHHHHH
Q 009574 412 DLGVCV 417 (532)
Q Consensus 412 ~La~~i 417 (532)
+||++|
T Consensus 226 ~lA~~i 231 (232)
T d1hyqa_ 226 ELANYI 231 (232)
T ss_dssp HHHHHH
T ss_pred HHHHHh
Confidence 999987
|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g0ta1 c.37.1.10 (A:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1veha_ d.52.8.1 (A:) HIRA-interacting protein 5, HIRIP5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2auwa2 d.331.1.1 (A:4-87) Hypothetical protein NE0471 N-terminal domain {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|