Citrus Sinensis ID: 009635

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530

MGQSLKIRVKTGTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYLSSSFRTSPRPSKPLKVVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP

ccccccccccccccccccccEEEEcccccccccccHHHHHHHHcccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccEEEccccccEEccccEEEccccHHHHHHHHHHccccccccccccEEEEccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHccccHHHHcccccHHccccccHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccEEEcccccEEEEEcccccEEEEEEccccEEEccEEEEcccHHHHHHHccccccccHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEccccccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccc

cccEEEccccccccccccccEEEEEccccccccccccHHHHHccccccccccccccccEEEEEccEHHHHHHHHHHHHcccEEEEEccccccEccccEEEEccccEEHHcHHHHHccHHHHHHHHHHcccHHHccccccEEEEEcccccccEcEccccccccccccHHHHHEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHHHcccccHHHHHccccHHHHcHHHHHHHHHcccEEEEcccEEEEEEcccccEEEEEEccccEEEEEEEEEEcccHHHHHHccHHHHccHHHHHHHcccccEEEEEEEEEcHHHHHHHHHHcccccccccEEHHHHcccHHHccccccEEEEEEcccccHccccHHHHHHHHHHHHHHHccHHccccccccEEEEEEEEEcccHHHcccccccccccccccccccEEEcccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccc

MGQSLKIRVktgtrkgfcpskvvcvdyprpdidntsNFLEAAYLsssfrtsprpskplkVVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKiaawkdgdgdwyetglhiFFGAYPNIQNLFGELGINDRLQWKEHSMifampnkpgefsrfdfpevlpaplNGILAILrnnemltwpEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMrkqgvpdrVTTEVFIAMSKalnfinpdeLSMQCILIALNRFLqekhgskmafldgnpperlcLPIVEHIQSlggevrlnsrvqkielnddgtvknflltngnvidgdayvfatpvdilklqlpeNWKEMAYFKRLEklvgvpviniHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCkeyynpnqSMLELvfapaeewiscsdSEIIDATMKELAKLFpdeisadqSKAKIVKYHVVktprsvyktipncepcrplqrspvegfylagDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGkgrlaeasmcp

mgqslkirvktgtrkgfcpskvvcvDYPRPDIDNTSNFLEAAYLSSsfrtsprpskPLKVVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKielnddgtvKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKtprsvyktipncepcrplqRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP

*********KTGTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYL*************LKVVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARG***********

*************************DYPRPDIDNTSNF*********************VVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQ********************

MGQSLKIRVKTGTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYLS*********SKPLKVVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKG*********

*****K*****GTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYLSSSFRTSPRPSKPLKVVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARG***********

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		530	2.2.26 [Sep-21-2011]
Q07356		566	15-cis-phytoene desaturas	yes	no	0.988	0.925	0.853	0.0
P28553		570	Phytoene dehydrogenase, c	yes	no	0.996	0.926	0.850	0.0
P28554		583	Phytoene dehydrogenase, c	N/A	no	0.996	0.905	0.843	0.0
P80093		582	15-cis-phytoene desaturas	N/A	no	0.996	0.907	0.838	0.0
Q40406		570	Phytoene dehydrogenase, c	N/A	no	0.943	0.877	0.858	0.0
Q0DUI8		578	Phytoene dehydrogenase, c	yes	no	0.973	0.892	0.843	0.0
A2XDA1		578	Phytoene dehydrogenase, c	N/A	no	0.973	0.892	0.843	0.0
P49086		571	Phytoene dehydrogenase, c	N/A	no	0.949	0.880	0.844	0.0
P29273		472	Phytoene dehydrogenase OS	N/A	no	0.852	0.957	0.65	1e-175
P26294		474	15-cis-phytoene desaturas	yes	no	0.884	0.989	0.633	1e-175

>sp\|Q07356\|PDS_ARATH 15-cis-phytoene desaturase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=PDS PE=1 SV=1	Back alignment and function desciption

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/526 (85%), Positives = 498/526 (94%), Gaps = 2/526 (0%)

Query: 3   QSLKIRVKTGTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYLSSSFRTSPRPSKPLKVVI 62
           Q+LK R +  +  G  P +VVCVD PRP+++NT NFLEAA LS+SFR++PRP+KPLKVVI
Sbjct: 40  QALKTRTRRRSTAG--PLQVVCVDIPRPELENTVNFLEAASLSASFRSAPRPAKPLKVVI 97

Query: 63  AGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPNIQ 122
           AGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKD DGDWYETGLHIFFGAYPN+Q
Sbjct: 98  AGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDEDGDWYETGLHIFFGAYPNVQ 157

Query: 123 NLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPE 182
           NLFGELGINDRLQWKEHSMIFAMP+KPGEFSRFDFP+VLPAPLNGI AILRNNEMLTWPE
Sbjct: 158 NLFGELGINDRLQWKEHSMIFAMPSKPGEFSRFDFPDVLPAPLNGIWAILRNNEMLTWPE 217

Query: 183 KVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDEL 242
           K+KFAIGLLPA++GGQAYVEAQDGL+V+EWM KQGVP+RVT EVFIAMSKALNFINPDEL
Sbjct: 218 KIKFAIGLLPAMVGGQAYVEAQDGLSVKEWMEKQGVPERVTDEVFIAMSKALNFINPDEL 277

Query: 243 SMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELND 302
           SMQCILIALNRFLQEKHGSKMAFLDGNPPERLC+P+V+HI+SLGGEV+LNSR++KIELND
Sbjct: 278 SMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPVVDHIRSLGGEVQLNSRIKKIELND 337

Query: 303 DGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIW 362
           DGTVK+FLLTNG+ ++GDAYVFA PVDILKL LP+ WKE+ YFK+L+KLVGVPVIN+HIW
Sbjct: 338 DGTVKSFLLTNGSTVEGDAYVFAAPVDILKLLLPDPWKEIPYFKKLDKLVGVPVINVHIW 397

Query: 363 FDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEII 422
           FDRKLKNTYDHLLFSRS+LLSVYADMSLTCKEYY+PN+SMLELVFAPAEEWIS +DS+II
Sbjct: 398 FDRKLKNTYDHLLFSRSNLLSVYADMSLTCKEYYDPNRSMLELVFAPAEEWISRTDSDII 457

Query: 423 DATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLA 482
           DATMKEL KLFPDEISADQSKAKI+KYHVVKTPRSVYKTIPNCEPCRPLQRSP+EGFYLA
Sbjct: 458 DATMKELEKLFPDEISADQSKAKILKYHVVKTPRSVYKTIPNCEPCRPLQRSPIEGFYLA 517

Query: 483 GDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASM 528
           GDYTKQKYLASMEGAVLSGK C+Q+IVQDY LLAA G  +L+EA++
Sbjct: 518 GDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAASGPRKLSEATV 563

This enzyme converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene. The zeta-carotene produced has a central C15-C15' double bond in the cis configuration and it requires isomerization before being recognized as substrate by ZDS, the next enzyme in the lycopene biosynthesis pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 3EC: .EC: 5EC: .EC: 5

>sp\|P28553\|CRTI_SOYBN Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Glycine max GN=PDS1 PE=2 SV=1	Back alignment and function description

>sp\|P28554\|CRTI_SOLLC Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Solanum lycopersicum GN=PDS PE=2 SV=1	Back alignment and function description

>sp\|P80093\|PDS_CAPAN 15-cis-phytoene desaturase, chloroplastic/chromoplastic OS=Capsicum annuum GN=PDS PE=1 SV=1	Back alignment and function description

>sp\|Q40406\|CRTI_NARPS Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Narcissus pseudonarcissus GN=PDS1 PE=1 SV=1	Back alignment and function description

>sp\|Q0DUI8\|CRTI_ORYSJ Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Oryza sativa subsp. japonica GN=PDS PE=2 SV=2	Back alignment and function description

>sp\|A2XDA1\|CRTI_ORYSI Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Oryza sativa subsp. indica GN=PDS1 PE=2 SV=2	Back alignment and function description

>sp\|P49086\|CRTI_MAIZE Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Zea mays GN=PDS1 PE=2 SV=1	Back alignment and function description

>sp\|P29273\|CRTI_SYNY3 Phytoene dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pds PE=3 SV=2	Back alignment and function description

>sp\|P26294\|PDS_SYNE7 15-cis-phytoene desaturase OS=Synechococcus elongatus (strain PCC 7942) GN=pds PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		530
25518260		553	phytoene desaturase (EC 1.14.99.-) 1 - c	1.0	0.958	0.996	0.0
350541925		553	phytoene desaturase [Citrus sinensis]	1.0	0.958	0.992	0.0
350541939		553	phytoene desaturase [Citrus sinensis]	1.0	0.958	0.992	0.0
350541929		553	phytoene desaturase [Citrus x paradisi]	1.0	0.958	0.996	0.0
350541931		553	phytoene desaturase [Citrus x paradisi]	1.0	0.958	0.994	0.0
350541927		553	phytoene desaturase [Citrus sinensis]	1.0	0.958	0.990	0.0
350541937		553	phytoene desaturase [Citrus sinensis]	1.0	0.958	0.992	0.0
350541935		553	phytoene desaturase [Citrus x paradisi]	1.0	0.958	0.992	0.0
13991882		552	phytoene desaturase [Citrus x paradisi]	0.998	0.958	0.994	0.0
190576745		553	phytoene desaturase [Citrus maxima]	1.0	0.958	0.990	0.0

>gi\|25518260\|pir\|\|JC7723 phytoene desaturase (EC 1.14.99.-) 1 - citrus gi\|9757659\|dbj\|BAB08179.1\| phytoene desaturase [Citrus unshiu] gi\|18073984\|emb\|CAC85666.1\| phytoene desaturase [Citrus sinensis] gi\|82394889\|gb\|ABB72445.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/530 (99%), Positives = 530/530 (100%)

Query: 1   MGQSLKIRVKTGTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYLSSSFRTSPRPSKPLKV 60
           MGQSLKIRVKTGTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYLSSSFRTSPRPSKPLKV
Sbjct: 24  MGQSLKIRVKTGTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYLSSSFRTSPRPSKPLKV 83

Query: 61  VIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPN 120
           VIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGK+AAWKDGDG+WYETGLHIFFGAYPN
Sbjct: 84  VIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKVAAWKDGDGNWYETGLHIFFGAYPN 143

Query: 121 IQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTW 180
           IQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTW
Sbjct: 144 IQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTW 203

Query: 181 PEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPD 240
           PEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPD
Sbjct: 204 PEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPD 263

Query: 241 ELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIEL 300
           ELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIEL
Sbjct: 264 ELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIEL 323

Query: 301 NDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIH 360
           NDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIH
Sbjct: 324 NDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIH 383

Query: 361 IWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSE 420
           IWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSE
Sbjct: 384 IWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSE 443

Query: 421 IIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFY 480
           IIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFY
Sbjct: 444 IIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFY 503

Query: 481 LAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP 530
           LAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP
Sbjct: 504 LAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP 553

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|350541925\|gb\|AEQ29518.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|350541939\|gb\|AEQ29525.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|350541929\|gb\|AEQ29520.1\| phytoene desaturase [Citrus x paradisi] gi\|350541933\|gb\|AEQ29522.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|350541931\|gb\|AEQ29521.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|350541927\|gb\|AEQ29519.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|350541937\|gb\|AEQ29524.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|350541935\|gb\|AEQ29523.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|13991882\|gb\|AAK51545.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|190576745\|gb\|ACE79168.1\| phytoene desaturase [Citrus maxima]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		530
TAIR\|locus:2129515		566	PDS3 "phytoene desaturase 3" [	0.988	0.925	0.853	1.3e-249
TAIR\|locus:2114789		558	ZDS "zeta-carotene desaturase"	0.633	0.602	0.302	1.6e-67
TAIR\|locus:2077670		488	PAO3 "polyamine oxidase 3" [Ar	0.398	0.432	0.227	3.9e-11
TAIR\|locus:2018571		497	PAO4 "polyamine oxidase 4" [Ar	0.407	0.434	0.222	2.2e-09
UNIPROTKB\|O69694		602	Rv3727 "Oxidoreductase" [Mycob	0.143	0.126	0.389	1e-08
TAIR\|locus:2053723		490	PAO2 "AT2G43020" [Arabidopsis	0.384	0.416	0.241	1.5e-08
ZFIN\|ZDB-GENE-030131-9110		511	wu:fa99f01 "wu:fa99f01" [Danio	0.107	0.111	0.508	1.6e-07
RGD\|2321736		642	LOC100360621 "rCG53598-like" [	0.149	0.123	0.437	1.9e-07
TAIR\|locus:2075029		477	AT3G09580 [Arabidopsis thalian	0.120	0.134	0.430	3.5e-07
UNIPROTKB\|F1RHU4		577	IL4I1 "Uncharacterized protein	0.149	0.136	0.412	4.4e-07

TAIR\|locus:2129515 PDS3 "phytoene desaturase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2404 (851.3 bits), Expect = 1.3e-249, P = 1.3e-249
 Identities = 449/526 (85%), Positives = 498/526 (94%)

Query:     3 QSLKIRVKTGTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYLSSSFRTSPRPSKPLKVVI 62
             Q+LK R +  +  G  P +VVCVD PRP+++NT NFLEAA LS+SFR++PRP+KPLKVVI
Sbjct:    40 QALKTRTRRRSTAG--PLQVVCVDIPRPELENTVNFLEAASLSASFRSAPRPAKPLKVVI 97

Query:    63 AGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPNIQ 122
             AGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKD DGDWYETGLHIFFGAYPN+Q
Sbjct:    98 AGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDEDGDWYETGLHIFFGAYPNVQ 157

Query:   123 NLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPE 182
             NLFGELGINDRLQWKEHSMIFAMP+KPGEFSRFDFP+VLPAPLNGI AILRNNEMLTWPE
Sbjct:   158 NLFGELGINDRLQWKEHSMIFAMPSKPGEFSRFDFPDVLPAPLNGIWAILRNNEMLTWPE 217

Query:   183 KVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDEL 242
             K+KFAIGLLPA++GGQAYVEAQDGL+V+EWM KQGVP+RVT EVFIAMSKALNFINPDEL
Sbjct:   218 KIKFAIGLLPAMVGGQAYVEAQDGLSVKEWMEKQGVPERVTDEVFIAMSKALNFINPDEL 277

Query:   243 SMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELND 302
             SMQCILIALNRFLQEKHGSKMAFLDGNPPERLC+P+V+HI+SLGGEV+LNSR++KIELND
Sbjct:   278 SMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPVVDHIRSLGGEVQLNSRIKKIELND 337

Query:   303 DGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIW 362
             DGTVK+FLLTNG+ ++GDAYVFA PVDILKL LP+ WKE+ YFK+L+KLVGVPVIN+HIW
Sbjct:   338 DGTVKSFLLTNGSTVEGDAYVFAAPVDILKLLLPDPWKEIPYFKKLDKLVGVPVINVHIW 397

Query:   363 FDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEII 422
             FDRKLKNTYDHLLFSRS+LLSVYADMSLTCKEYY+PN+SMLELVFAPAEEWIS +DS+II
Sbjct:   398 FDRKLKNTYDHLLFSRSNLLSVYADMSLTCKEYYDPNRSMLELVFAPAEEWISRTDSDII 457

Query:   423 DATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLA 482
             DATMKEL KLFPDEISADQSKAKI+KYHVVKTPRSVYKTIPNCEPCRPLQRSP+EGFYLA
Sbjct:   458 DATMKELEKLFPDEISADQSKAKILKYHVVKTPRSVYKTIPNCEPCRPLQRSPIEGFYLA 517

Query:   483 GDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASM 528
             GDYTKQKYLASMEGAVLSGK C+Q+IVQDY LLAA G  +L+EA++
Sbjct:   518 GDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAASGPRKLSEATV 563

GO:0009507 "chloroplast" evidence=ISM;IDA;TAS

GO:0009536 "plastid" evidence=IEA

GO:0016117 "carotenoid biosynthetic process" evidence=IEA;IDA

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009534 "chloroplast thylakoid" evidence=IDA

GO:0010155 "regulation of proton transport" evidence=RCA

GO:0046777 "protein autophosphorylation" evidence=RCA

GO:0016120 "carotene biosynthetic process" evidence=IDA

GO:0016166 "phytoene dehydrogenase activity" evidence=IDA

TAIR\|locus:2114789 ZDS "zeta-carotene desaturase" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2077670 PAO3 "polyamine oxidase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2018571 PAO4 "polyamine oxidase 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O69694 Rv3727 "Oxidoreductase" [Mycobacterium tuberculosis H37Rv (taxid:83332)]	Back alignment and assigned GO terms

TAIR\|locus:2053723 PAO2 "AT2G43020" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-9110 wu:fa99f01 "wu:fa99f01" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

RGD\|2321736 LOC100360621 "rCG53598-like" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

TAIR\|locus:2075029 AT3G09580 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RHU4 IL4I1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P80093	PDS_CAPAN	1, ., 3, ., 5, ., 5	0.8383	0.9962	0.9072	N/A	no
P49086	CRTI_MAIZE	1, ., 1, 4, ., 9, 9, ., -	0.8449	0.9490	0.8809	N/A	no
P26294	PDS_SYNE7	1, ., 3, ., 5, ., 5	0.6331	0.8849	0.9894	yes	no
P29273	CRTI_SYNY3	1, ., 1, 4, ., 9, 9, ., -	0.65	0.8528	0.9576	N/A	no
Q40406	CRTI_NARPS	1, ., 1, 4, ., 9, 9, ., -	0.858	0.9433	0.8771	N/A	no
P28554	CRTI_SOLLC	1, ., 1, 4, ., 9, 9, ., -	0.8439	0.9962	0.9056	N/A	no
Q0DUI8	CRTI_ORYSJ	1, ., 1, 4, ., 9, 9, ., -	0.8433	0.9735	0.8927	yes	no
Q07356	PDS_ARATH	1, ., 3, ., 5, ., 5	0.8536	0.9886	0.9257	yes	no
P28553	CRTI_SOYBN	1, ., 1, 4, ., 9, 9, ., -	0.8506	0.9962	0.9263	yes	no
A2XDA1	CRTI_ORYSI	1, ., 1, 4, ., 9, 9, ., -	0.8433	0.9735	0.8927	N/A	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.14.99	0.766
3rd Layer	1.14.99.30	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	PDS1	SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (582 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00018857001	SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (396 aa)	•	•	•		•	•		0.968
	GSVIVG00024765001	SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (389 aa)	•	•	•		•	•		0.967
	GSVIVG00027139001	SubName- Full=Chromosome chr8 scaffold_41, whole genome shotgun sequence; (569 aa)			•		•	•	•	0.964
	GSVIVG00023494001	SubName- Full=Chromosome undetermined scaffold_30, whole genome shotgun sequence; (437 aa)	•	•	•		•	•		0.960
	GSVIVG00031131001	SubName- Full=Chromosome chr14 scaffold_54, whole genome shotgun sequence; (583 aa)			•		•	•	•	0.917
	ZEP	SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (658 aa)						•		0.483
	BR6OX1	SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (312 aa)						•		0.480
	GSVIVG00016085001	SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (471 aa)				•		•		0.480
	GSVIVG00006255001	SubName- Full=Chromosome chr1 scaffold_166, whole genome shotgun sequence; (442 aa)			•					0.455
	GSVIVG00032312001	SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (356 aa)			•	•				0.454

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		530
PLN02612		567	PLN02612, PLN02612, phytoene desaturase	0.0
TIGR02731		453	TIGR02731, phytoene_desat, phytoene desaturase	0.0
COG3349		485	COG3349, COG3349, Uncharacterized conserved protei	1e-148
pfam01593		444	pfam01593, Amino_oxidase, Flavin containing amine	1e-100
TIGR02732		474	TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot	1e-98
PLN02487		569	PLN02487, PLN02487, zeta-carotene desaturase	2e-89
TIGR03467		411	TIGR03467, HpnE, squalene-associated FAD-dependent	1e-42
PRK07233		434	PRK07233, PRK07233, hypothetical protein; Provisio	1e-32
COG1232		444	COG1232, HemY, Protoporphyrinogen oxidase [Coenzym	1e-19
pfam13450		66	pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-	7e-17
COG2907		447	COG2907, COG2907, Predicted NAD/FAD-binding protei	1e-12
COG1233		487	COG1233, COG1233, Phytoene dehydrogenase and relat	3e-11
COG1231		450	COG1231, COG1231, Monoamine oxidase [Amino acid tr	5e-11
TIGR00562		462	TIGR00562, proto_IX_ox, protoporphyrinogen oxidase	4e-10
PLN02576		496	PLN02576, PLN02576, protoporphyrinogen oxidase	7e-09
PRK11883		451	PRK11883, PRK11883, protoporphyrinogen oxidase; Re	1e-08
PLN02268		435	PLN02268, PLN02268, probable polyamine oxidase	2e-07
TIGR02734		502	TIGR02734, crtI_fam, phytoene desaturase	2e-07
COG0492		305	COG0492, TrxB, Thioredoxin reductase [Posttranslat	7e-07
COG0654		387	COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox	7e-07
pfam01266		234	pfam01266, DAO, FAD dependent oxidoreductase	3e-06
PRK04176		257	PRK04176, PRK04176, ribulose-1,5-biphosphate synth	6e-06
COG0644		396	COG0644, FixC, Dehydrogenases (flavoproteins) [Ene	1e-05
COG0665		387	COG0665, DadA, Glycine/D-amino acid oxidases (deam	1e-05
PLN02676		487	PLN02676, PLN02676, polyamine oxidase	1e-05
PRK07208		479	PRK07208, PRK07208, hypothetical protein; Provisio	2e-05
PLN02529		738	PLN02529, PLN02529, lysine-specific histone demeth	3e-05
COG1635		262	COG1635, THI4, Ribulose 1,5-bisphosphate synthetas	3e-05
TIGR03997		645	TIGR03997, mycofact_OYE_2, mycofactocin system Fad	3e-05
PLN02268		435	PLN02268, PLN02268, probable polyamine oxidase	5e-05
pfam07992		283	pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp	5e-05
TIGR02032		295	TIGR02032, GG-red-SF, geranylgeranyl reductase fam	2e-04
PRK12771		564	PRK12771, PRK12771, putative glutamate synthase (N	2e-04
PLN02328		808	PLN02328, PLN02328, lysine-specific histone demeth	2e-04
PRK11749		457	PRK11749, PRK11749, dihydropyrimidine dehydrogenas	3e-04
PRK12834		549	PRK12834, PRK12834, putative FAD-binding dehydroge	4e-04
TIGR03996		633	TIGR03996, mycofact_OYE_1, mycofactocin system Fad	4e-04
pfam01946		229	pfam01946, Thi4, Thi4 family	6e-04
PRK12810		471	PRK12810, gltD, glutamate synthase subunit beta; R	7e-04
PRK09853		1019	PRK09853, PRK09853, putative selenate reductase su	7e-04
pfam00890		401	pfam00890, FAD_binding_2, FAD binding domain	9e-04
COG0446		415	COG0446, HcaD, Uncharacterized NAD(FAD)-dependent	0.001
PRK12814		652	PRK12814, PRK12814, putative NADPH-dependent gluta	0.001
pfam01266		234	pfam01266, DAO, FAD dependent oxidoreductase	0.002
TIGR00292		254	TIGR00292, TIGR00292, thiazole biosynthesis enzyme	0.002
COG2509		486	COG2509, COG2509, Uncharacterized FAD-dependent de	0.003
COG1148		622	COG1148, HdrA, Heterodisulfide reductase, subunit	0.003
PRK08163		396	PRK08163, PRK08163, salicylate hydroxylase; Provis	0.003
TIGR01292		299	TIGR01292, TRX_reduct, thioredoxin-disulfide reduc	0.003
COG3573		552	COG3573, COG3573, Predicted oxidoreductase [Genera	0.003
PRK12844		557	PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrog	0.004
COG0562		374	COG0562, Glf, UDP-galactopyranose mutase [Cell env	0.004
PRK12843		578	PRK12843, PRK12843, putative FAD-binding dehydroge	0.004
PLN03000		881	PLN03000, PLN03000, amine oxidase	0.004

>gnl\|CDD\|215330 PLN02612, PLN02612, phytoene desaturase	Back alignment and domain information

 Score = 1124 bits (2910), Expect = 0.0
 Identities = 457/534 (85%), Positives = 500/534 (93%), Gaps = 6/534 (1%)

Query: 1   MGQSLKIRVKTGTRK------GFCPSKVVCVDYPRPDIDNTSNFLEAAYLSSSFRTSPRP 54
           MG SL++   + +R       G  P +VVCVDYPRP+++NT NFLEAA LS+SFR++PRP
Sbjct: 31  MGHSLRVPTSSSSRTRRRRNSGRGPLQVVCVDYPRPELENTVNFLEAAALSASFRSAPRP 90

Query: 55  SKPLKVVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIF 114
           +KPLKVVIAGAGLAGLSTAKYLADAGHKP+LLEARDVLGGK+AAWKD DGDWYETGLHIF
Sbjct: 91  AKPLKVVIAGAGLAGLSTAKYLADAGHKPILLEARDVLGGKVAAWKDEDGDWYETGLHIF 150

Query: 115 FGAYPNIQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRN 174
           FGAYPN+QNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGI AILRN
Sbjct: 151 FGAYPNVQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGIWAILRN 210

Query: 175 NEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKAL 234
           NEMLTWPEK+KFAIGLLPAI+GGQAYVEAQDGL+V+EWMRKQGVPDRV  EVFIAMSKAL
Sbjct: 211 NEMLTWPEKIKFAIGLLPAIVGGQAYVEAQDGLSVKEWMRKQGVPDRVNDEVFIAMSKAL 270

Query: 235 NFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSR 294
           NFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLC+PIV+H QSLGGEVRLNSR
Sbjct: 271 NFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPIVDHFQSLGGEVRLNSR 330

Query: 295 VQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGV 354
           ++KIELNDDGTVK+FLLTNG+V++GD YV ATPVDILKL LP+ WKE+ YFK+L+KLVGV
Sbjct: 331 IKKIELNDDGTVKHFLLTNGSVVEGDVYVSATPVDILKLLLPDQWKEIPYFKKLDKLVGV 390

Query: 355 PVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWI 414
           PVIN+HIWFDRKLKNTYDHLLFSRS LLSVYADMS TCKEYY+PN+SMLELVFAPAEEWI
Sbjct: 391 PVINVHIWFDRKLKNTYDHLLFSRSPLLSVYADMSTTCKEYYDPNKSMLELVFAPAEEWI 450

Query: 415 SCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRS 474
           S SD +IIDATMKELAKLFPDEISADQSKAKI+KYHVVKTPRSVYKT+PNCEPCRPLQRS
Sbjct: 451 SRSDEDIIDATMKELAKLFPDEISADQSKAKILKYHVVKTPRSVYKTVPNCEPCRPLQRS 510

Query: 475 PVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASM 528
           P+EGFYLAGDYTKQKYLASMEGAVLSGKLCAQ+IVQDY LLAARG  +L+EA++
Sbjct: 511 PIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQSIVQDYELLAARGPRKLSEATV 564

Length = 567

>gnl\|CDD\|131778 TIGR02731, phytoene_desat, phytoene desaturase	Back alignment and domain information

>gnl\|CDD\|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase	Back alignment and domain information

>gnl\|CDD\|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase	Back alignment and domain information

>gnl\|CDD\|215268 PLN02487, PLN02487, zeta-carotene desaturase	Back alignment and domain information

>gnl\|CDD\|234221 TIGR03467, HpnE, squalene-associated FAD-dependent desaturase	Back alignment and domain information

>gnl\|CDD\|235977 PRK07233, PRK07233, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain	Back alignment and domain information

>gnl\|CDD\|225459 COG2907, COG2907, Predicted NAD/FAD-binding protein [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>gnl\|CDD\|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|213540 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase	Back alignment and domain information

>gnl\|CDD\|215314 PLN02576, PLN02576, protoporphyrinogen oxidase	Back alignment and domain information

>gnl\|CDD\|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>gnl\|CDD\|177909 PLN02268, PLN02268, probable polyamine oxidase	Back alignment and domain information

>gnl\|CDD\|233988 TIGR02734, crtI_fam, phytoene desaturase	Back alignment and domain information

>gnl\|CDD\|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|216400 pfam01266, DAO, FAD dependent oxidoreductase	Back alignment and domain information

>gnl\|CDD\|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|215362 PLN02676, PLN02676, polyamine oxidase	Back alignment and domain information

>gnl\|CDD\|235967 PRK07208, PRK07208, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1	Back alignment and domain information

>gnl\|CDD\|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|234436 TIGR03997, mycofact_OYE_2, mycofactocin system FadH/OYE family oxidoreductase 2	Back alignment and domain information

>gnl\|CDD\|177909 PLN02268, PLN02268, probable polyamine oxidase	Back alignment and domain information

>gnl\|CDD\|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase	Back alignment and domain information

>gnl\|CDD\|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family	Back alignment and domain information

>gnl\|CDD\|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>gnl\|CDD\|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>gnl\|CDD\|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|188511 TIGR03996, mycofact_OYE_1, mycofactocin system FadH/OYE family oxidoreductase 1	Back alignment and domain information

>gnl\|CDD\|145231 pfam01946, Thi4, Thi4 family	Back alignment and domain information

>gnl\|CDD\|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>gnl\|CDD\|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>gnl\|CDD\|216176 pfam00890, FAD_binding_2, FAD binding domain	Back alignment and domain information

>gnl\|CDD\|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|216400 pfam01266, DAO, FAD dependent oxidoreductase	Back alignment and domain information

>gnl\|CDD\|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme	Back alignment and domain information

>gnl\|CDD\|225307 COG2509, COG2509, Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional	Back alignment and domain information

>gnl\|CDD\|233345 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase	Back alignment and domain information

>gnl\|CDD\|226103 COG3573, COG3573, Predicted oxidoreductase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|183787 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|223636 COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|237225 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|178578 PLN03000, PLN03000, amine oxidase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		530
PLN02612		567	phytoene desaturase	100.0
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	100.0
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	100.0
PLN02487		569	zeta-carotene desaturase	100.0
PRK07233		434	hypothetical protein; Provisional	100.0
COG3349		485	Uncharacterized conserved protein [Function unknow	100.0
PRK12416		463	protoporphyrinogen oxidase; Provisional	100.0
PLN02268		435	probable polyamine oxidase	100.0
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	100.0
PLN02576		496	protoporphyrinogen oxidase	100.0
PRK11883		451	protoporphyrinogen oxidase; Reviewed	100.0
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	100.0
TIGR03467		419	HpnE squalene-associated FAD-dependent desaturase.	100.0
COG1232		444	HemY Protoporphyrinogen oxidase [Coenzyme metaboli	100.0
PRK07208		479	hypothetical protein; Provisional	100.0
PLN02676		487	polyamine oxidase	100.0
KOG0029		501	consensus Amine oxidase [Secondary metabolites bio	100.0
PLN02529		738	lysine-specific histone demethylase 1	100.0
PLN02568		539	polyamine oxidase	100.0
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	100.0
PLN03000		881	amine oxidase	100.0
PLN02328		808	lysine-specific histone demethylase 1 homolog	100.0
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	100.0
KOG0685		498	consensus Flavin-containing amine oxidase [Coenzym	100.0
PLN02976		1713	amine oxidase	100.0
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	100.0
PF01593		450	Amino_oxidase: Flavin containing amine oxidoreduct	100.0
KOG1276		491	consensus Protoporphyrinogen oxidase [Coenzyme tra	99.97
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	99.95
COG2907		447	Predicted NAD/FAD-binding protein [General functio	99.95
KOG4254		561	consensus Phytoene desaturase [Coenzyme transport	99.94
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	99.93
PRK13977		576	myosin-cross-reactive antigen; Provisional	99.86
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	99.79
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	99.78
COG2081		408	Predicted flavoproteins [General function predicti	99.73
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	99.71
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	99.69
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	99.68
TIGR00031		377	UDP-GALP_mutase UDP-galactopyranose mutase. The ge	99.68
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	99.66
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	99.66
KOG2820		399	consensus FAD-dependent oxidoreductase [General fu	99.66
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	99.65
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	99.64
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	99.59
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	99.57
PF13450		68	NAD_binding_8: NAD(P)-binding Rossmann-like domain	99.56
COG0579		429	Predicted dehydrogenase [General function predicti	99.54
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	99.52
PRK10157		428	putative oxidoreductase FixC; Provisional	99.51
PRK10015		429	oxidoreductase; Provisional	99.5
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	99.5
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	99.49
PF06100		500	Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross	99.49
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	99.48
PLN02464		627	glycerol-3-phosphate dehydrogenase	99.47
PTZ00383		497	malate:quinone oxidoreductase; Provisional	99.46
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	99.46
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	99.44
PRK11728		393	hydroxyglutarate oxidase; Provisional	99.44
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.42
PF00996		438	GDI: GDP dissociation inhibitor; InterPro: IPR0182	99.4
COG1635		262	THI4 Ribulose 1,5-bisphosphate synthetase, convert	99.38
PRK07045		388	putative monooxygenase; Reviewed	99.38
KOG2844		856	consensus Dimethylglycine dehydrogenase precursor	99.38
PLN02463		447	lycopene beta cyclase	99.36
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.36
PRK07121		492	hypothetical protein; Validated	99.36
PRK06184		502	hypothetical protein; Provisional	99.36
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	99.35
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.35
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	99.34
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	99.33
COG0562		374	Glf UDP-galactopyranose mutase [Cell envelope biog	99.32
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	99.32
PRK07190		487	hypothetical protein; Provisional	99.32
PRK06847		375	hypothetical protein; Provisional	99.32
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	99.31
PRK09126		392	hypothetical protein; Provisional	99.3
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	99.3
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	99.3
PRK05257		494	malate:quinone oxidoreductase; Validated	99.3
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	99.3
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	99.3
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	99.3
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	99.3
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	99.3
PRK08244		493	hypothetical protein; Provisional	99.29
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	99.29
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	99.28
PLN02697		529	lycopene epsilon cyclase	99.27
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	99.27
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	99.27
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	99.26
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	99.26
PRK08274		466	tricarballylate dehydrogenase; Validated	99.25
PF01946		230	Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K.	99.25
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	99.25
PRK06834		488	hypothetical protein; Provisional	99.24
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	99.24
PRK07588		391	hypothetical protein; Provisional	99.24
PRK08013		400	oxidoreductase; Provisional	99.24
PRK06185		407	hypothetical protein; Provisional	99.24
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	99.22
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.22
PRK08132		547	FAD-dependent oxidoreductase; Provisional	99.21
PRK13339		497	malate:quinone oxidoreductase; Reviewed	99.2
PRK06126		545	hypothetical protein; Provisional	99.2
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.17
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.17
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.16
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	99.16
PRK11445		351	putative oxidoreductase; Provisional	99.16
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	99.15
PRK07395		553	L-aspartate oxidase; Provisional	99.15
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	99.15
PRK06175		433	L-aspartate oxidase; Provisional	99.15
PLN02985		514	squalene monooxygenase	99.13
PRK07804		541	L-aspartate oxidase; Provisional	99.13
KOG2853		509	consensus Possible oxidoreductase [General functio	99.13
PRK12839		572	hypothetical protein; Provisional	99.13
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	99.12
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	99.12
PLN02661		357	Putative thiazole synthesis	99.12
PRK06996		398	hypothetical protein; Provisional	99.12
TIGR00275		400	flavoprotein, HI0933 family. The model when search	99.12
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	99.11
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	99.11
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	99.11
PRK08294		634	phenol 2-monooxygenase; Provisional	99.1
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	99.1
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.1
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	99.1
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	99.09
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	99.09
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	99.08
PRK08163		396	salicylate hydroxylase; Provisional	99.08
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	99.08
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.08
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	99.07
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	99.07
PRK05868		372	hypothetical protein; Validated	99.07
PLN02815		594	L-aspartate oxidase	99.06
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	99.06
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	99.06
PRK08401		466	L-aspartate oxidase; Provisional	99.04
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	99.04
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	99.04
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	99.03
PRK12842		574	putative succinate dehydrogenase; Reviewed	99.03
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.03
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	99.01
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	99.01
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	99.01
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	99.01
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	99.01
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	99.0
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	99.0
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	99.0
PRK07538		413	hypothetical protein; Provisional	99.0
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	98.97
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	98.97
PRK07236		386	hypothetical protein; Provisional	98.97
PRK08071		510	L-aspartate oxidase; Provisional	98.96
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	98.96
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	98.96
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	98.96
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	98.95
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	98.95
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	98.95
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	98.93
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	98.93
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	98.92
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	98.92
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	98.92
PRK07512		513	L-aspartate oxidase; Provisional	98.9
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	98.89
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	98.89
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	98.89
PRK09077		536	L-aspartate oxidase; Provisional	98.89
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	98.89
PRK12831		464	putative oxidoreductase; Provisional	98.88
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	98.88
PRK08275		554	putative oxidoreductase; Provisional	98.87
KOG0042		680	consensus Glycerol-3-phosphate dehydrogenase [Ener	98.87
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	98.86
PRK06116		450	glutathione reductase; Validated	98.86
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	98.85
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	98.85
PRK06753		373	hypothetical protein; Provisional	98.84
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	98.84
PTZ00367		567	squalene epoxidase; Provisional	98.84
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	98.83
KOG2404		477	consensus Fumarate reductase, flavoprotein subunit	98.83
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	98.82
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	98.82
KOG2614		420	consensus Kynurenine 3-monooxygenase and related f	98.82
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	98.82
PRK09897		534	hypothetical protein; Provisional	98.81
COG0029		518	NadB Aspartate oxidase [Coenzyme metabolism]	98.79
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	98.79
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	98.79
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	98.79
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	98.79
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	98.79
KOG2852		380	consensus Possible oxidoreductase [General functio	98.78
PRK06475		400	salicylate hydroxylase; Provisional	98.76
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	98.76
PRK12779		944	putative bifunctional glutamate synthase subunit b	98.76
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	98.75
PRK12775		1006	putative trifunctional 2-polyprenylphenol hydroxyl	98.75
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	98.74
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	98.73
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	98.73
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	98.73
KOG2415		621	consensus Electron transfer flavoprotein ubiquinon	98.73
KOG1399		448	consensus Flavin-containing monooxygenase [Seconda	98.72
TIGR01789		370	lycopene_cycl lycopene cyclase. This model represe	98.72
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	98.71
PF00743		531	FMO-like: Flavin-binding monooxygenase-like; Inter	98.71
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	98.68
COG3075		421	GlpB Anaerobic glycerol-3-phosphate dehydrogenase	98.68
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	98.67
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	98.67
KOG2665		453	consensus Predicted FAD-dependent oxidoreductase [	98.66
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	98.65
COG0492		305	TrxB Thioredoxin reductase [Posttranslational modi	98.65
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	98.63
PRK10262		321	thioredoxin reductase; Provisional	98.63
TIGR03377		516	glycerol3P_GlpA glycerol-3-phosphate dehydrogenase	98.62
KOG1439		440	consensus RAB proteins geranylgeranyltransferase c	98.61
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	98.6
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	98.59
PRK06370		463	mercuric reductase; Validated	98.59
PTZ00058		561	glutathione reductase; Provisional	98.58
PLN02507		499	glutathione reductase	98.55
PTZ00052		499	thioredoxin reductase; Provisional	98.55
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	98.53
COG3573		552	Predicted oxidoreductase [General function predict	98.51
PLN02546		558	glutathione reductase	98.5
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	98.48
COG1053		562	SdhA Succinate dehydrogenase/fumarate reductase, f	98.48
PRK07845		466	flavoprotein disulfide reductase; Reviewed	98.47
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	98.46
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	98.46
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	98.46
PRK02106		560	choline dehydrogenase; Validated	98.44
COG4716		587	Myosin-crossreactive antigen [Function unknown]	98.42
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	98.41
KOG1298		509	consensus Squalene monooxygenase [Lipid transport	98.4
PRK14989		847	nitrite reductase subunit NirD; Provisional	98.3
COG5044		434	MRS6 RAB proteins geranylgeranyltransferase compon	98.27
PLN02852		491	ferredoxin-NADP+ reductase	98.26
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	98.25
KOG4405		547	consensus GDP dissociation inhibitor [Signal trans	98.25
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	98.25
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	98.23
KOG1335		506	consensus Dihydrolipoamide dehydrogenase [Energy p	98.23
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	98.2
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	98.19
PRK13512		438	coenzyme A disulfide reductase; Provisional	98.16
COG4529		474	Uncharacterized protein conserved in bacteria [Fun	98.14
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	98.12
PRK09564		444	coenzyme A disulfide reductase; Reviewed	98.11
PRK07846		451	mycothione reductase; Reviewed	98.08
COG0445		621	GidA Flavin-dependent tRNA uridine 5-carboxymethyl	98.07
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	98.06
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	98.05
KOG0405		478	consensus Pyridine nucleotide-disulphide oxidoredu	98.04
PTZ00188		506	adrenodoxin reductase; Provisional	98.02
PRK14694		468	putative mercuric reductase; Provisional	98.02
PF07156		368	Prenylcys_lyase: Prenylcysteine lyase; InterPro: I	98.01
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	98.01
TIGR02053		463	MerA mercuric reductase. This model represents the	98.0
PRK14727		479	putative mercuric reductase; Provisional	98.0
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	97.99
KOG1336		478	consensus Monodehydroascorbate/ferredoxin reductas	97.97
PRK06567		1028	putative bifunctional glutamate synthase subunit b	97.97
PRK13748		561	putative mercuric reductase; Provisional	97.97
PRK12814		652	putative NADPH-dependent glutamate synthase small	97.96
PRK05335		436	tRNA (uracil-5-)-methyltransferase Gid; Reviewed	97.96
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	97.92
PRK06370		463	mercuric reductase; Validated	97.89
COG0493		457	GltD NADPH-dependent glutamate synthase beta chain	97.85
TIGR01317		485	GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal	97.83
KOG3923		342	consensus D-aspartate oxidase [Amino acid transpor	97.83
KOG0404		322	consensus Thioredoxin reductase [Posttranslational	97.82
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	97.82
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	97.82
TIGR00137		433	gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo	97.81
PF07992		201	Pyr_redox_2: Pyridine nucleotide-disulphide oxidor	97.79
TIGR02053		463	MerA mercuric reductase. This model represents the	97.79
KOG0399		2142	consensus Glutamate synthase [Amino acid transport	97.74
PRK12770		352	putative glutamate synthase subunit beta; Provisio	97.74
PRK07845		466	flavoprotein disulfide reductase; Reviewed	97.74
PRK09564		444	coenzyme A disulfide reductase; Reviewed	97.72
KOG2960		328	consensus Protein involved in thiamine biosynthesi	97.71
PTZ00153		659	lipoamide dehydrogenase; Provisional	97.71
COG0446		415	HcaD Uncharacterized NAD(FAD)-dependent dehydrogen	97.65
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	97.65
KOG2311		679	consensus NAD/FAD-utilizing protein possibly invol	97.65
PRK13984		604	putative oxidoreductase; Provisional	97.65
PLN02507		499	glutathione reductase	97.64
PRK07846		451	mycothione reductase; Reviewed	97.64
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	97.64
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	97.61
TIGR03385		427	CoA_CoA_reduc CoA-disulfide reductase. Members of	97.61
PRK05675		570	sdhA succinate dehydrogenase flavoprotein subunit;	97.6
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	97.6
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	97.59
PTZ00058		561	glutathione reductase; Provisional	97.58
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	97.54
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	97.47
KOG1800		468	consensus Ferredoxin/adrenodoxin reductase [Nucleo	97.44
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	97.41
PRK14727		479	putative mercuric reductase; Provisional	97.39
PRK14694		468	putative mercuric reductase; Provisional	97.35
PRK13748		561	putative mercuric reductase; Provisional	97.32
COG2303		542	BetA Choline dehydrogenase and related flavoprotei	97.3
PLN02546		558	glutathione reductase	97.3
COG3634		520	AhpF Alkyl hydroperoxide reductase, large subunit	97.28
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	97.27
PLN02785		587	Protein HOTHEAD	97.27
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	97.26
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	97.24
PTZ00153		659	lipoamide dehydrogenase; Provisional	97.17
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	97.06
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	96.73
KOG4716		503	consensus Thioredoxin reductase [Posttranslational	96.57
COG1251		793	NirB NAD(P)H-nitrite reductase [Energy production	96.52
COG1206		439	Gid NAD(FAD)-utilizing enzyme possibly involved in	96.51
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	96.4
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	96.29
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	96.29
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	96.14
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	96.13
COG3486		436	IucD Lysine/ornithine N-monooxygenase [Secondary m	96.09
KOG1238		623	consensus Glucose dehydrogenase/choline dehydrogen	95.95
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	95.86
KOG1346		659	consensus Programmed cell death 8 (apoptosis-induc	95.8
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.73
KOG3855		481	consensus Monooxygenase involved in coenzyme Q (ub	95.57
PRK02705		459	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.46
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	95.36
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	95.35
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	95.28
COG0569		225	TrkA K+ transport systems, NAD-binding component [	95.22
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	95.22
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	95.07
PF01262		168	AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal	95.02
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	95.01
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	95.01
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	95.0
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	94.97
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	94.96
PRK12831		464	putative oxidoreductase; Provisional	94.85
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	94.83
KOG2755		334	consensus Oxidoreductase [General function predict	94.79
PRK13512		438	coenzyme A disulfide reductase; Provisional	94.79
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	94.76
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	94.74
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	94.72
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	94.67
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	94.57
cd01080		168	NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of	94.56
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	94.5
PRK06249		313	2-dehydropantoate 2-reductase; Provisional	94.5
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	94.4
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	94.4
PRK14989		847	nitrite reductase subunit NirD; Provisional	94.38
COG1004		414	Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en	94.33
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	94.26
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	94.11
COG0686		371	Ald Alanine dehydrogenase [Amino acid transport an	94.07
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	94.0
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	93.99
KOG2304		298	consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t	93.92
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	93.85
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	93.76
TIGR01816		565	sdhA_forward succinate dehydrogenase, flavoprotein	93.75
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	93.74
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	93.71
PRK06719		157	precorrin-2 dehydrogenase; Validated	93.68
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	93.67
PRK04148		134	hypothetical protein; Provisional	93.61
cd05292		308	LDH_2 A subgroup of L-lactate dehydrogenases. L-la	93.61
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	93.58
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	93.57
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	93.52
PRK10262		321	thioredoxin reductase; Provisional	93.5
TIGR01763		305	MalateDH_bact malate dehydrogenase, NAD-dependent.	93.46
PRK06116		450	glutathione reductase; Validated	93.39
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	93.37
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	93.29
PLN02545		295	3-hydroxybutyryl-CoA dehydrogenase	93.25
TIGR00518		370	alaDH alanine dehydrogenase. The family of known L	93.22
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	93.2
PRK12770		352	putative glutamate synthase subunit beta; Provisio	93.17
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	93.06
TIGR03026		411	NDP-sugDHase nucleotide sugar dehydrogenase. All o	93.05
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	92.99
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	92.98
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	92.85
PRK14619		308	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	92.8
PTZ00052		499	thioredoxin reductase; Provisional	92.79
cd05311		226	NAD_bind_2_malic_enz NAD(P) binding domain of mali	92.77
TIGR02279		503	PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa	92.69
COG0771		448	MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas	92.63
PRK04690		468	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	92.59
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	92.58
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	92.56
PRK14620		326	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	92.55
KOG3851		446	consensus Sulfide:quinone oxidoreductase/flavo-bin	92.54
PF00056		141	Ldh_1_N: lactate/malate dehydrogenase, NAD binding	92.43
PRK00094		325	gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr	92.41
PRK08268		507	3-hydroxy-acyl-CoA dehydrogenase; Validated	92.38
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	92.35
PRK01710		458	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	92.23
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	92.2
cd05293		312	LDH_1 A subgroup of L-lactate dehydrogenases. L-la	92.17
PRK09424		509	pntA NAD(P) transhydrogenase subunit alpha; Provis	92.17
cd05191		86	NAD_bind_amino_acid_DH NAD(P) binding domain of am	92.08
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	92.0
PRK12549		284	shikimate 5-dehydrogenase; Reviewed	91.99
PRK15057		388	UDP-glucose 6-dehydrogenase; Provisional	91.9
PRK11730		715	fadB multifunctional fatty acid oxidation complex	91.85
PRK15116		268	sulfur acceptor protein CsdL; Provisional	91.85
PRK07531		495	bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe	91.79
PRK03369		488	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	91.79
COG3634		520	AhpF Alkyl hydroperoxide reductase, large subunit	91.77
PLN02353		473	probable UDP-glucose 6-dehydrogenase	91.76
COG1250		307	FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo	91.7
TIGR02437		714	FadB fatty oxidation complex, alpha subunit FadB.	91.62
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	91.59
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	91.58
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	91.58
PLN02256		304	arogenate dehydrogenase	91.53
PRK02472		447	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	91.53
PRK04308		445	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	91.43
PRK12779		944	putative bifunctional glutamate synthase subunit b	91.36
PTZ00082		321	L-lactate dehydrogenase; Provisional	91.28
KOG1336		478	consensus Monodehydroascorbate/ferredoxin reductas	91.27
PRK06223		307	malate dehydrogenase; Reviewed	91.22
PRK08306		296	dipicolinate synthase subunit A; Reviewed	91.14
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	91.05
PRK07417		279	arogenate dehydrogenase; Reviewed	91.04
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	90.98
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	90.93
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	90.87
PRK00421		461	murC UDP-N-acetylmuramate--L-alanine ligase; Provi	90.83
PRK01368		454	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	90.72
cd05291		306	HicDH_like L-2-hydroxyisocapronate dehydrogenases	90.69
TIGR01915		219	npdG NADPH-dependent F420 reductase. This model re	90.69
COG0281		432	SfcA Malic enzyme [Energy production and conversio	90.69
PRK00141		473	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	90.67
COG1893		307	ApbA Ketopantoate reductase [Coenzyme metabolism]	90.67
TIGR00561		511	pntA NAD(P) transhydrogenase, alpha subunit. In so	90.65
TIGR02441		737	fa_ox_alpha_mit fatty acid oxidation complex, alph	90.61
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	90.6
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	90.45
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	90.35
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	90.34
PRK12548		289	shikimate 5-dehydrogenase; Provisional	90.24
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	90.24
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	90.17
TIGR02355		240	moeB molybdopterin synthase sulfurylase MoeB. This	90.16
PF13478		136	XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2	90.09
TIGR00507		270	aroE shikimate 5-dehydrogenase. This model finds p	89.97
PRK05690		245	molybdopterin biosynthesis protein MoeB; Provision	89.84
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	89.78
COG1251		793	NirB NAD(P)H-nitrite reductase [Energy production	89.73
PTZ00117		319	malate dehydrogenase; Provisional	89.71
cd01339		300	LDH-like_MDH L-lactate dehydrogenase-like malate d	89.57
TIGR02964		246	xanthine_xdhC xanthine dehydrogenase accessory pro	89.55
TIGR02440		699	FadJ fatty oxidation complex, alpha subunit FadJ.	89.54
PRK11154		708	fadJ multifunctional fatty acid oxidation complex	89.52
PRK08328		231	hypothetical protein; Provisional	89.52
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	89.45
PRK02006		498	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	89.43
PRK00066		315	ldh L-lactate dehydrogenase; Reviewed	89.37
PRK00258		278	aroE shikimate 5-dehydrogenase; Reviewed	89.22
cd00757		228	ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1	89.16
TIGR01505		291	tartro_sem_red 2-hydroxy-3-oxopropionate reductase	89.07
cd05290		307	LDH_3 A subgroup of L-lactate dehydrogenases. L-la	88.98
PRK05562		223	precorrin-2 dehydrogenase; Provisional	88.91
cd01065		155	NAD_bind_Shikimate_DH NAD(P) binding domain of Shi	88.89
PRK09496		453	trkA potassium transporter peripheral membrane com	88.88
TIGR01809		282	Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO	88.71
PRK11199		374	tyrA bifunctional chorismate mutase/prephenate deh	88.7
PRK03803		448	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	88.68
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	88.52
PTZ00142		470	6-phosphogluconate dehydrogenase; Provisional	88.49
cd05312		279	NAD_bind_1_malic_enz NAD(P) binding domain of mali	88.43
PF10727		127	Rossmann-like: Rossmann-like domain; InterPro: IPR	88.42
PRK12550		272	shikimate 5-dehydrogenase; Reviewed	88.37
PRK14027		283	quinate/shikimate dehydrogenase; Provisional	88.29
KOG1335		506	consensus Dihydrolipoamide dehydrogenase [Energy p	88.22
PLN02695		370	GDP-D-mannose-3',5'-epimerase	88.21
KOG2495		491	consensus NADH-dehydrogenase (ubiquinone) [Energy	88.14

>PLN02612 phytoene desaturase	Back alignment and domain information

Probab=100.00  E-value=2.7e-59  Score=482.35  Aligned_cols=513  Identities=88%  Similarity=1.417  Sum_probs=425.8

Q ss_pred             CCCCceeeecCCCCCCccccchhhhhhhhcCCCCCCCCCCCCCeEEEECCChHHHHHHHHHHHCCCcEEEEecCcccCce
Q 009635           16 GFCPSKVVCVDYPRPDIDNTSNFLEAAYLSSSFRTSPRPSKPLKVVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGK   95 (530)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dVvIIGaG~aGl~aA~~L~~~G~~V~vlEa~~~~GG~   95 (530)
                      +.+|.++.|+++|.|....+.+|.............+......+|+|||||++||+||++|++.|++|+|+|+++++||+
T Consensus        52 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~iiG~G~~Gl~~a~~l~~~g~~~~~~e~~~~~gG~  131 (567)
T PLN02612         52 GRGPLQVVCVDYPRPELENTVNFLEAAALSASFRSAPRPAKPLKVVIAGAGLAGLSTAKYLADAGHKPILLEARDVLGGK  131 (567)
T ss_pred             CCCCceEEecCCCCCchhhHHHHHhhhhhccccccCCCCCCCCCEEEECCCHHHHHHHHHHHhcCCeEEEEecCCCCCCc
Confidence            45689999999999999999999876544444444444556789999999999999999999999999999999999999


Q ss_pred             eeeeecCCCCEEeeeeceecCCcchHHHHHHHcCCCCCcceeccceeeecCCCCCCcccccCCCCCCCchhhHHHHHhcc
Q 009635           96 IAAWKDGDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNN  175 (530)
Q Consensus        96 ~~~~~~~~g~~~d~G~~~~~~~~~~~~~l~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  175 (530)
                      +.++...+|+.+|.|+|++.+.++++.++++++|+.....+......+.+....+.+..+.++..+|.+...+..++...
T Consensus       132 ~~s~~~~~G~~~D~G~h~~~g~~~~~~~ll~elG~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~P~~l~~~~~~l~~~  211 (567)
T PLN02612        132 VAAWKDEDGDWYETGLHIFFGAYPNVQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGIWAILRNN  211 (567)
T ss_pred             ceeeEcCCCCEEcCCceEEeCCCchHHHHHHHhCCcccceecccceEEEecCCCCceeeCcCchhcCChhhhhHHHHhcC
Confidence            99987557999999999999999999999999999887777776676665555555555555555666666677777666


Q ss_pred             cCCChHHHHHhhhhhhhhhhcCcccccccCcccHHHHHHHcCCCHHHHHHHHHHHHhhcccCCCCcccHHHHHHHHHHHH
Q 009635          176 EMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFL  255 (530)
Q Consensus       176 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  255 (530)
                      ..+.+.++++....+.+.......+....++.|+.+|+++.+.++.+.++++.++...+++.+++++++...+..+..++
T Consensus       212 ~~ls~~~kl~~~~~~~~~~~~~~~~~~~~d~~Sv~e~l~~~~~~~~~~~~~~~~l~~~~~~~~p~~~S~~~~l~~l~~~l  291 (567)
T PLN02612        212 EMLTWPEKIKFAIGLLPAIVGGQAYVEAQDGLSVKEWMRKQGVPDRVNDEVFIAMSKALNFINPDELSMQCILIALNRFL  291 (567)
T ss_pred             ccCCHHHHHHHHHhhhHHhcccchhhhhcCcCcHHHHHHhcCCCHHHHHHHHHHHHHHhcCCCHHHhhHHHHHHHHHHHH
Confidence            67778888776655544333333444566789999999999999999999999999888889999999998887777776


Q ss_pred             hhccCCeEEeecCCCCccchHHHHHHHHHcCcEEEecceeeEEEecCCCCEEEEEEcCCcEEecCEEEEccChHHHhhhC
Q 009635          256 QEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQL  335 (530)
Q Consensus       256 ~~~~g~~~~~~~gg~~~~l~~~l~~~l~~~g~~i~~~t~V~~I~~~~~g~~~~v~~~~G~~i~ad~VI~a~~~~~~~~ll  335 (530)
                      ....+....+++|+.+..+++.|.+.+++.|++|++|++|++|..++++++++|++.+|+++.||+||+|+|+..+..|+
T Consensus       292 ~~~~gs~~~~~~G~~~~~l~~~l~~~l~~~G~~I~l~~~V~~I~~~~~g~v~~v~~~~G~~~~ad~VI~a~p~~~l~~Ll  371 (567)
T PLN02612        292 QEKHGSKMAFLDGNPPERLCMPIVDHFQSLGGEVRLNSRIKKIELNDDGTVKHFLLTNGSVVEGDVYVSATPVDILKLLL  371 (567)
T ss_pred             hccCCceEeeecCCchHHHHHHHHHHHHhcCCEEEeCCeeeEEEECCCCcEEEEEECCCcEEECCEEEECCCHHHHHHhC
Confidence            66677788888887558899999999999999999999999999866777777888889899999999999999999998


Q ss_pred             CccccccHHHHHHhccCCccEEEEEEEeccccccccCccccccCCcceeeeccCcccccccCCCccEEEEEeeCccccCC
Q 009635          336 PENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWIS  415 (530)
Q Consensus       336 ~~~~~~~~~~~~l~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~v~~~~~~~~~~~~~  415 (530)
                      ++...+..+.++++++.+.++.+++++|++++|...+++++...+..+++.+++..++.|.+++..++.+++.++.+|..
T Consensus       372 ~~~~~~~~~~~~l~~l~~~~v~~v~l~~dr~~~~~~~~~~~~~~~~~~~~~d~S~~~~~~~~~~~~ll~~~~~~a~~~~~  451 (567)
T PLN02612        372 PDQWKEIPYFKKLDKLVGVPVINVHIWFDRKLKNTYDHLLFSRSPLLSVYADMSTTCKEYYDPNKSMLELVFAPAEEWIS  451 (567)
T ss_pred             cchhcCcHHHHHHHhcCCCCeEEEEEEECcccCCCCCceeecCCCCceeehhhhhcchhhcCCCCeEEEEEEEcChhhhc
Confidence            87655556677788888889999999999999876666667766666777777776777777777777777777889999


Q ss_pred             CChhHHHHHHHHHHHHhCCCCcccccccceEEEEEEeecCCceeecCCCCCCCCCCCCCCCCceEEecccccCCCCCcHH
Q 009635          416 CSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASME  495 (530)
Q Consensus       416 ~~~e~~~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~l~~aG~~~~~~~~~~i~  495 (530)
                      +++|++++.++++|+++||+....+.....+..+.+..+|.+.|.+.++...++|.+++|++|||||||++.+.|+++++
T Consensus       452 ~sdeei~e~vl~~L~~lfp~~~~~~~~~~~i~~~~~v~~P~a~~~~~pg~~~~rp~~~tPi~~l~lAGd~t~~~~~~sme  531 (567)
T PLN02612        452 RSDEDIIDATMKELAKLFPDEISADQSKAKILKYHVVKTPRSVYKTVPNCEPCRPLQRSPIEGFYLAGDYTKQKYLASME  531 (567)
T ss_pred             CCHHHHHHHHHHHHHHHCCcccccccCCceEEEEEEeccCCceEEeCCCCcccCccccCccCCEEEeecceeCCchhhHH
Confidence            99999999999999999997544433345678888999999999888887777888999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhhhHhhhcccchhhccC
Q 009635          496 GAVLSGKLCAQAIVQDYVLLAARGKGRLAEASM  528 (530)
Q Consensus       496 gA~~sg~~aA~~vl~~~~~~~~~~~~~~~~~~~  528 (530)
                      ||+.||++||++|+++++...++....++|++.
T Consensus       532 GAv~SG~~AA~~I~~~~~~~~~~~~~~~~~~~~  564 (567)
T PLN02612        532 GAVLSGKLCAQSIVQDYELLAARGPRKLSEATV  564 (567)
T ss_pred             HHHHHHHHHHHHHHHHhcccccccccccccccc
Confidence            999999999999999998877777777777653

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>COG3349 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03467 HpnE squalene-associated FAD-dependent desaturase	Back alignment and domain information

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO)	Back alignment and domain information

>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG2907 Predicted NAD/FAD-binding protein [General function prediction only]	Back alignment and domain information

>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism]	Back alignment and domain information

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis []	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function	Back alignment and domain information

>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>KOG2853 consensus Possible oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PLN02661 Putative thiazole synthesis	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PTZ00367 squalene epoxidase; Provisional	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only]	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>COG0029 NadB Aspartate oxidase [Coenzyme metabolism]	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>KOG2852 consensus Possible oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion]	Back alignment and domain information

>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR01789 lycopene_cycl lycopene cyclase	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes []	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown]	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit	Back alignment and domain information

>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>COG3573 Predicted oxidoreductase [General function prediction only]	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

>COG4716 Myosin-crossreactive antigen [Function unknown]	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism]	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02852 ferredoxin-NADP+ reductase	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion]	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>COG4529 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PTZ00188 adrenodoxin reductase; Provisional	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only]	Back alignment and domain information

>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit	Back alignment and domain information

>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase	Back alignment and domain information

>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only]	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase	Back alignment and domain information

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PLN02785 Protein HOTHEAD	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion]	Back alignment and domain information

>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only]	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms]	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion]	Back alignment and domain information

>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>KOG2755 consensus Oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK06249 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism]	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PLN02545 3-hydroxybutyryl-CoA dehydrogenase	Back alignment and domain information

>TIGR00518 alaDH alanine dehydrogenase	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2	Back alignment and domain information

>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC	Back alignment and domain information

>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion]	Back alignment and domain information

>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []	Back alignment and domain information

>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional	Back alignment and domain information

>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>PRK12549 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK15057 UDP-glucose 6-dehydrogenase; Provisional	Back alignment and domain information

>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated	Back alignment and domain information

>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02353 probable UDP-glucose 6-dehydrogenase	Back alignment and domain information

>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism]	Back alignment and domain information

>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>PLN02256 arogenate dehydrogenase	Back alignment and domain information

>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>PTZ00082 L-lactate dehydrogenase; Provisional	Back alignment and domain information

>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only]	Back alignment and domain information

>PRK06223 malate dehydrogenase; Reviewed	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>PRK07417 arogenate dehydrogenase; Reviewed	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional	Back alignment and domain information

>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases	Back alignment and domain information

>TIGR01915 npdG NADPH-dependent F420 reductase	Back alignment and domain information

>COG0281 SfcA Malic enzyme [Energy production and conversion]	Back alignment and domain information

>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]	Back alignment and domain information

>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit	Back alignment and domain information

>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial	Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>PRK12548 shikimate 5-dehydrogenase; Provisional	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A	Back alignment and domain information

>TIGR00507 aroE shikimate 5-dehydrogenase	Back alignment and domain information

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion]	Back alignment and domain information

>PTZ00117 malate dehydrogenase; Provisional	Back alignment and domain information

>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins	Back alignment and domain information

>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC	Back alignment and domain information

>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ	Back alignment and domain information

>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>PRK08328 hypothetical protein; Provisional	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK00066 ldh L-lactate dehydrogenase; Reviewed	Back alignment and domain information

>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA	Back alignment and domain information

>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK05562 precorrin-2 dehydrogenase; Provisional	Back alignment and domain information

>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type	Back alignment and domain information

>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional	Back alignment and domain information

>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>PTZ00142 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1	Back alignment and domain information

>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins	Back alignment and domain information

>PRK12550 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK14027 quinate/shikimate dehydrogenase; Provisional	Back alignment and domain information

>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PLN02695 GDP-D-mannose-3',5'-epimerase	Back alignment and domain information

>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		530
4e0v_A		497	Structure Of L-Amino Acid Oxidase From The B. Jarar		1e-07
1reo_A		486	L-Amino Acid Oxidase From Agkistrodon Halys Pallas		2e-07
1f8r_A		498	Crystal Structure Of L-Amino Acid Oxidase From Call		2e-07
3kve_A		486	Structure Of Native L-Amino Acid Oxidase From Viper		4e-07
2hko_A		664	Crystal Structure Of Lsd1 Length = 664		7e-06
2h94_A		664	Crystal Structure And Mechanism Of Human Lysine-Spe		7e-06
2dw4_A		660	Crystal Structure Of Human Lsd1 At 2.3 A Resolution		7e-06
2iw5_A		666	Structural Basis For Corest-dependent Demethylation		7e-06
2v1d_A		730	Structural Basis Of Lsd1-Corest Selectivity In Hist		7e-06
2ejr_A		662	Lsd1-Tranylcypromine Complex Length = 662		7e-06
2x0l_A		734	Crystal Structure Of A Neuro-Specific Splicing Vari		7e-06
2xaf_A		852	Crystal Structure Of Lsd1-Corest In Complex With Pa		1e-05
3rha_A		482	The Crystal Structure Of Oxidoreductase From Arthro		5e-05
2bxr_A		527	Human Monoamine Oxidase A In Complex With Clorgylin		1e-04
2z5y_A		513	Crystal Structure Of Human Monoamine Oxidase A (G11		1e-04
2z5x_A		513	Crystal Structure Of Human Monoamine Oxidase A With		1e-04
2vvm_A		495	The Structure Of Mao-N-D5, A Variant Of Monoamine O		3e-04
2vvl_G		495	The Structure Of Mao-N-D3, A Variant Of Monoamine O		3e-04
2vvl_A		495	The Structure Of Mao-N-D3, A Variant Of Monoamine O		3e-04
2yg6_A		453	Structure-Based Redesign Of Cofactor Binding In Put		3e-04
3gf4_A		390	Structure Of Udp-Galactopyranose Mutase Bound To Ud		6e-04
1wam_A		384	Structure Of Udp-Galactopyranose Mutase From Klebsi		6e-04
2bi7_A		384	Udp-Galactopyranose Mutase From Klebsiella Pneumoni		7e-04
1o5w_A		534	The Structure Basis Of Specific Recognitions For Su		7e-04

>pdb|4E0V|A Chain A, Structure Of L-Amino Acid Oxidase From The B. Jararacussu Venom Length = 497