Citrus Sinensis ID: 009738
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 527 | ||||||
| 224139878 | 687 | white-brown-complex ABC transporter fami | 0.971 | 0.745 | 0.614 | 0.0 | |
| 224139880 | 607 | white-brown-complex ABC transporter fami | 0.973 | 0.845 | 0.594 | 0.0 | |
| 224106203 | 707 | white-brown-complex ABC transporter fami | 0.979 | 0.729 | 0.566 | 0.0 | |
| 255577264 | 697 | ATP-binding cassette transporter, putati | 0.981 | 0.741 | 0.565 | 1e-180 | |
| 356570462 | 630 | PREDICTED: ABC transporter G family memb | 0.943 | 0.788 | 0.608 | 1e-180 | |
| 297835074 | 691 | abc transporter family protein [Arabidop | 0.981 | 0.748 | 0.546 | 1e-176 | |
| 255544918 | 707 | ATP-binding cassette transporter, putati | 0.979 | 0.729 | 0.558 | 1e-176 | |
| 307136071 | 724 | white-brown-complex ABC transporter fami | 0.992 | 0.722 | 0.564 | 1e-176 | |
| 20260310 | 691 | unknown protein [Arabidopsis thaliana] g | 0.981 | 0.748 | 0.546 | 1e-176 | |
| 297734945 | 622 | unnamed protein product [Vitis vinifera] | 1.0 | 0.847 | 0.577 | 1e-176 |
| >gi|224139878|ref|XP_002323321.1| white-brown-complex ABC transporter family [Populus trichocarpa] gi|222867951|gb|EEF05082.1| white-brown-complex ABC transporter family [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 668 bits (1724), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 315/513 (61%), Positives = 412/513 (80%), Gaps = 1/513 (0%)
Query: 1 MTNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDE 60
MT DEIN ++E TI+KMGLQ CA+ K+GNWHLRG+S GEK+RLSIS+EILTQP VL LDE
Sbjct: 139 MTKDEINSVIENTIMKMGLQDCADNKVGNWHLRGLSGGEKRRLSISLEILTQPYVLFLDE 198
Query: 61 PTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAK 120
PTSGLDSASA FVI LK IALDGRIVVCSIHQPSS++F LFDDL LLS+GETIYFG+AK
Sbjct: 199 PTSGLDSASALFVIHALKNIALDGRIVVCSIHQPSSYIFDLFDDLCLLSSGETIYFGEAK 258
Query: 121 MAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLKSQAPTEIPMSSNSQMYLSTE 180
+AVKFFAEAGFPCP+RRNPSDHFLRCINSDFDK+A + L+S + + + SN + +TE
Sbjct: 259 LAVKFFAEAGFPCPTRRNPSDHFLRCINSDFDKMASTLLRSLRDSAVSVPSNFETSFTTE 318
Query: 181 EIKAKLVEEYRNSEISMDIRQRVRELAH-NEQEETVLSKDRASWWKQLCILSHRSFLNML 239
+IKAKL+E+YR+SE S++ R ++R++A NE+ + L + R +WWKQL L+ RSF+NM+
Sbjct: 319 DIKAKLIEKYRSSEYSINTRTKIRQIALINEELMSGLIEIRINWWKQLYTLTIRSFVNMI 378
Query: 240 RDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFI 299
RD+GY+W+R +FY+L+S+ GI+Y +VGLSN A R KC ++Y FLICLSVGGLPSF+
Sbjct: 379 RDLGYFWVRTLFYILISLGAGIMYFDVGLSNSAFVTRAKCYTYVYDFLICLSVGGLPSFL 438
Query: 300 EEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFC 359
EE K SY E ++ HYGEAVF+LSNF +SF FLVI+S+SSGTI+ YMV+FH GFSHYC+ C
Sbjct: 439 EEWKVSYHELLNRHYGEAVFMLSNFFASFIFLVIMSLSSGTIVFYMVKFHLGFSHYCYLC 498
Query: 360 LSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPM 419
++ F C +I+E+ M+VALLVPN LMG+GV ++ + M S ++R + DLPKFFW+YPM
Sbjct: 499 MNFFFCFAIMESVAMIVALLVPNFLMGIGVSAFAVMFLSMASGLYRPLPDLPKFFWRYPM 558
Query: 420 SYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFC 479
+YI+F +WA++GQFKNDM+GLEF+P V G+PK++G++IL +GV++NY KWWDLAAL
Sbjct: 559 AYISFTSWAVQGQFKNDMLGLEFEPFVQGEPKIQGKQILHDFFGVRVNYSKWWDLAALLL 618
Query: 480 ILTCYKIVLFATLKYKDKASKLLHRLFARSIFR 512
+L C+K++ + LKYK + LL R A+ +
Sbjct: 619 LLLCHKLLFLSILKYKQRLVLLLRRFCAKRTLK 651
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224139880|ref|XP_002323322.1| white-brown-complex ABC transporter family [Populus trichocarpa] gi|222867952|gb|EEF05083.1| white-brown-complex ABC transporter family [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224106203|ref|XP_002314084.1| white-brown-complex ABC transporter family [Populus trichocarpa] gi|222850492|gb|EEE88039.1| white-brown-complex ABC transporter family [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255577264|ref|XP_002529514.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223531030|gb|EEF32883.1| ATP-binding cassette transporter, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356570462|ref|XP_003553406.1| PREDICTED: ABC transporter G family member 15-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297835074|ref|XP_002885419.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata] gi|297331259|gb|EFH61678.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255544918|ref|XP_002513520.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223547428|gb|EEF48923.1| ATP-binding cassette transporter, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|307136071|gb|ADN33920.1| white-brown-complex ABC transporter family protein [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|20260310|gb|AAM13053.1| unknown protein [Arabidopsis thaliana] gi|23198394|gb|AAN15724.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297734945|emb|CBI17179.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 527 | ||||||
| TAIR|locus:2092960 | 691 | ABCG15 "ATP-binding cassette G | 0.981 | 0.748 | 0.528 | 1.9e-154 | |
| TAIR|locus:2033899 | 687 | ABCG12 "ATP-binding cassette G | 0.992 | 0.761 | 0.520 | 3.3e-150 | |
| TAIR|locus:2033939 | 678 | ABCG13 "ATP-binding cassette G | 0.998 | 0.775 | 0.463 | 4.8e-133 | |
| TAIR|locus:2030898 | 703 | ABCG11 "ATP-binding cassette G | 0.984 | 0.738 | 0.462 | 4.2e-127 | |
| TAIR|locus:2046203 | 730 | ABCG3 "ATP-binding cassette G3 | 0.922 | 0.665 | 0.316 | 1.5e-65 | |
| CGD|CAL0002254 | 579 | orf19.3120 [Candida albicans ( | 0.273 | 0.248 | 0.413 | 1e-45 | |
| UNIPROTKB|Q5A0X6 | 579 | CaO19.10632 "Putative uncharac | 0.273 | 0.248 | 0.413 | 1e-45 | |
| UNIPROTKB|Q9UNQ0 | 655 | ABCG2 "ATP-binding cassette su | 0.931 | 0.749 | 0.275 | 1.3e-45 | |
| DICTYBASE|DDB_G0269214 | 793 | abcG1 "ABC transporter G famil | 0.280 | 0.186 | 0.44 | 2.3e-44 | |
| WB|WBGene00015479 | 598 | wht-1 [Caenorhabditis elegans | 0.886 | 0.780 | 0.288 | 3.1e-44 |
| TAIR|locus:2092960 ABCG15 "ATP-binding cassette G15" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1506 (535.2 bits), Expect = 1.9e-154, P = 1.9e-154
Identities = 274/518 (52%), Positives = 381/518 (73%)
Query: 1 MTNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDE 60
M+ +E++DIVE TI+++GLQ C++ IGNWH RG+S GE+KR+SI++EILT+P +L LDE
Sbjct: 135 MSKEEVSDIVEGTIMELGLQDCSDRVIGNWHARGVSGGERKRVSIALEILTRPQILFLDE 194
Query: 61 PTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHXXXXXXXXXXXSNGETIYFGDAK 120
PTSGLDSASAFFVIQ L+ IA DGR V+ S+HQPSS S+GE++YFG+AK
Sbjct: 195 PTSGLDSASAFFVIQALRNIARDGRTVISSVHQPSSEVFALFDDLFLLSSGESVYFGEAK 254
Query: 121 MAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLKSQAPTEIPMSSNSQMYLSTE 180
AV+FFAE+GFPCP +RNPSDHFLRCINSDFD V + SQ E P +S+ M L+T
Sbjct: 255 SAVEFFAESGFPCPKKRNPSDHFLRCINSDFDTVTATLKGSQRIQETPATSDPLMNLATS 314
Query: 181 EIKAKLVEEYRNSEISMDIRQRVRELAHNEQEETVLSK-DRASWWKQLCILSHRSFLNML 239
IKA+LVE Y+ S+ + + R+REL++ E E + K A+WWKQL L+ RSF+NM
Sbjct: 315 VIKARLVENYKRSKYAKSAKSRIRELSNIEGLEMEIRKGSEATWWKQLRTLTARSFINMC 374
Query: 240 RDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFI 299
RD+GYYW RI+ Y++VSI+VG ++ +VG S +I R C FI GF+ +S+GG PSF+
Sbjct: 375 RDVGYYWTRIISYIVVSISVGTIFYDVGYSYTSILARVSCGGFITGFMTFMSIGGFPSFL 434
Query: 300 EEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFC 359
EE K Y+ER+S +YG +V++LSN++SSFPFLV +S+ +GTI + +V+F PGFSHY FC
Sbjct: 435 EEMKVFYKERLSGYYGVSVYILSNYISSFPFLVAISVITGTITYNLVKFRPGFSHYAFFC 494
Query: 360 LSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPM 419
L++F VS++E+ MMVVA +VPN LMG+ G LI ++MM S FR + DLPK FW+YP+
Sbjct: 495 LNIFFSVSVIESLMMVVASVVPNFLMGLITGAGLIGIIMMTSGFFRLLPDLPKIFWRYPV 554
Query: 420 SYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFC 479
SYI++ +WAI+G +KND +GLEF+P PG+PK+ GEE++ K++GV++ Y KWWDLAA+
Sbjct: 555 SYISYGSWAIQGGYKNDFLGLEFEPLFPGEPKMTGEEVIEKVFGVKVTYSKWWDLAAVVA 614
Query: 480 ILTCYKIVLFATLKYKDKASKLLHRLFARSIFRQTPQK 517
IL CY+++ F LK +++A L + A+ R ++
Sbjct: 615 ILVCYRLLFFVVLKLRERAGPALKAIQAKRTMRNLDRR 652
|
|
| TAIR|locus:2033899 ABCG12 "ATP-binding cassette G12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033939 ABCG13 "ATP-binding cassette G13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2030898 ABCG11 "ATP-binding cassette G11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046203 ABCG3 "ATP-binding cassette G3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0002254 orf19.3120 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5A0X6 CaO19.10632 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UNQ0 ABCG2 "ATP-binding cassette sub-family G member 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0269214 abcG1 "ABC transporter G family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00015479 wht-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 527 | |||
| TIGR00955 | 617 | TIGR00955, 3a01204, The Eye Pigment Precursor Tran | 2e-82 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 8e-48 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 1e-42 | |
| PLN03211 | 659 | PLN03211, PLN03211, ABC transporter G-25; Provisio | 3e-41 | |
| cd03213 | 194 | cd03213, ABCG_EPDR, Eye pigment and drug resistanc | 9e-41 | |
| cd03234 | 226 | cd03234, ABCG_White, White pigment protein homolog | 8e-37 | |
| cd03232 | 192 | cd03232, ABCG_PDR_domain2, Second domain of the pl | 2e-33 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 1e-26 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 2e-25 | |
| cd03233 | 202 | cd03233, ABCG_PDR_domain1, First domain of the ple | 4e-22 | |
| pfam01061 | 210 | pfam01061, ABC2_membrane, ABC-2 type transporter | 1e-20 | |
| COG1131 | 293 | COG1131, CcmA, ABC-type multidrug transport system | 3e-20 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 5e-16 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 9e-16 | |
| cd03297 | 214 | cd03297, ABC_ModC_molybdenum_transporter, ATP-bind | 3e-12 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 5e-12 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 1e-11 | |
| cd03263 | 220 | cd03263, ABC_subfamily_A, ATP-binding cassette dom | 3e-11 | |
| cd03230 | 173 | cd03230, ABC_DR_subfamily_A, ATP-binding cassette | 3e-11 | |
| cd03226 | 205 | cd03226, ABC_cobalt_CbiO_domain2, Second domain of | 4e-11 | |
| cd03235 | 213 | cd03235, ABC_Metallic_Cations, ATP-binding cassett | 6e-11 | |
| TIGR01166 | 190 | TIGR01166, cbiO, cobalt transport protein ATP-bind | 2e-10 | |
| cd03229 | 178 | cd03229, ABC_Class3, ATP-binding cassette domain o | 3e-10 | |
| cd03256 | 241 | cd03256, ABC_PhnC_transporter, ATP-binding cassett | 4e-10 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 2e-09 | |
| TIGR03608 | 206 | TIGR03608, L_ocin_972_ABC, putative bacteriocin ex | 3e-09 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 3e-09 | |
| COG4555 | 245 | COG4555, NatA, ABC-type Na+ transport system, ATPa | 4e-09 | |
| cd03219 | 236 | cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas | 4e-09 | |
| cd03264 | 211 | cd03264, ABC_drug_resistance_like, ABC-type multid | 4e-09 | |
| TIGR01184 | 230 | TIGR01184, ntrCD, nitrate transport ATP-binding su | 4e-09 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 8e-09 | |
| cd03266 | 218 | cd03266, ABC_NatA_sodium_exporter, ATP-binding cas | 1e-08 | |
| cd03260 | 227 | cd03260, ABC_PstB_phosphate_transporter, ATP-bindi | 1e-08 | |
| PRK13638 | 271 | PRK13638, cbiO, cobalt transporter ATP-binding sub | 2e-08 | |
| pfam00005 | 119 | pfam00005, ABC_tran, ABC transporter | 2e-08 | |
| TIGR02315 | 243 | TIGR02315, ABC_phnC, phosphonate ABC transporter, | 4e-08 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 6e-08 | |
| PRK13639 | 275 | PRK13639, cbiO, cobalt transporter ATP-binding sub | 7e-08 | |
| TIGR03522 | 301 | TIGR03522, GldA_ABC_ATP, gliding motility-associat | 9e-08 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 1e-07 | |
| cd03228 | 171 | cd03228, ABCC_MRP_Like, ATP-binding cassette domai | 1e-07 | |
| TIGR03375 | 694 | TIGR03375, type_I_sec_LssB, type I secretion syste | 2e-07 | |
| cd03292 | 214 | cd03292, ABC_FtsE_transporter, ATP-binding cassett | 2e-07 | |
| PRK14246 | 257 | PRK14246, PRK14246, phosphate ABC transporter ATP- | 2e-07 | |
| COG0411 | 250 | COG0411, LivG, ABC-type branched-chain amino acid | 3e-07 | |
| cd03268 | 208 | cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c | 4e-07 | |
| COG1117 | 253 | COG1117, PstB, ABC-type phosphate transport system | 4e-07 | |
| cd03223 | 166 | cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset | 5e-07 | |
| cd03269 | 210 | cd03269, ABC_putative_ATPase, ATP-binding cassette | 6e-07 | |
| PRK13631 | 320 | PRK13631, cbiO, cobalt transporter ATP-binding sub | 6e-07 | |
| cd03221 | 144 | cd03221, ABCF_EF-3, ATP-binding cassette domain of | 8e-07 | |
| COG4598 | 256 | COG4598, HisP, ABC-type histidine transport system | 8e-07 | |
| TIGR03873 | 256 | TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra | 8e-07 | |
| PRK13539 | 207 | PRK13539, PRK13539, cytochrome c biogenesis protei | 9e-07 | |
| PRK14270 | 251 | PRK14270, PRK14270, phosphate ABC transporter ATP- | 1e-06 | |
| PRK09984 | 262 | PRK09984, PRK09984, phosphonate/organophosphate es | 1e-06 | |
| PRK09536 | 402 | PRK09536, btuD, corrinoid ABC transporter ATPase; | 1e-06 | |
| PRK14262 | 250 | PRK14262, PRK14262, phosphate ABC transporter ATP- | 1e-06 | |
| PRK10619 | 257 | PRK10619, PRK10619, histidine/lysine/arginine/orni | 1e-06 | |
| TIGR02324 | 224 | TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys | 1e-06 | |
| cd03257 | 228 | cd03257, ABC_NikE_OppD_transporters, ATP-binding c | 1e-06 | |
| COG3638 | 258 | COG3638, COG3638, ABC-type phosphate/phosphonate t | 2e-06 | |
| TIGR00972 | 247 | TIGR00972, 3a0107s01c2, phosphate ABC transporter, | 2e-06 | |
| COG4178 | 604 | COG4178, COG4178, ABC-type uncharacterized transpo | 2e-06 | |
| TIGR02673 | 214 | TIGR02673, FtsE, cell division ATP-binding protein | 2e-06 | |
| cd03252 | 237 | cd03252, ABCC_Hemolysin, ATP-binding cassette doma | 2e-06 | |
| cd03231 | 201 | cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog | 2e-06 | |
| COG2884 | 223 | COG2884, FtsE, Predicted ATPase involved in cell d | 2e-06 | |
| cd03261 | 235 | cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca | 2e-06 | |
| cd03253 | 236 | cd03253, ABCC_ATM1_transporter, ATP-binding casset | 2e-06 | |
| COG2274 | 709 | COG2274, SunT, ABC-type bacteriocin/lantibiotic ex | 2e-06 | |
| COG1134 | 249 | COG1134, TagH, ABC-type polysaccharide/polyol phos | 3e-06 | |
| COG4988 | 559 | COG4988, CydD, ABC-type transport system involved | 3e-06 | |
| PRK14274 | 259 | PRK14274, PRK14274, phosphate ABC transporter ATP- | 3e-06 | |
| PRK14244 | 251 | PRK14244, PRK14244, phosphate ABC transporter ATP- | 3e-06 | |
| PRK10982 | 491 | PRK10982, PRK10982, galactose/methyl galaxtoside t | 3e-06 | |
| PRK14269 | 246 | PRK14269, PRK14269, phosphate ABC transporter ATP- | 3e-06 | |
| COG1127 | 263 | COG1127, Ttg2A, ABC-type transport system involved | 4e-06 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 4e-06 | |
| TIGR03771 | 223 | TIGR03771, anch_rpt_ABC, anchored repeat-type ABC | 4e-06 | |
| TIGR03864 | 236 | TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi | 4e-06 | |
| PRK13636 | 283 | PRK13636, cbiO, cobalt transporter ATP-binding sub | 5e-06 | |
| COG1135 | 339 | COG1135, AbcC, ABC-type metal ion transport system | 5e-06 | |
| TIGR01842 | 544 | TIGR01842, type_I_sec_PrtD, type I secretion syste | 5e-06 | |
| COG4148 | 352 | COG4148, ModC, ABC-type molybdate transport system | 6e-06 | |
| cd03299 | 235 | cd03299, ABC_ModC_like, ATP-binding cassette domai | 7e-06 | |
| PRK14273 | 254 | PRK14273, PRK14273, phosphate ABC transporter ATP- | 7e-06 | |
| PRK14248 | 268 | PRK14248, PRK14248, phosphate ABC transporter ATP- | 7e-06 | |
| COG1119 | 257 | COG1119, ModF, ABC-type molybdenum transport syste | 8e-06 | |
| COG4152 | 300 | COG4152, COG4152, ABC-type uncharacterized transpo | 8e-06 | |
| PRK14253 | 249 | PRK14253, PRK14253, phosphate ABC transporter ATP- | 8e-06 | |
| COG4987 | 573 | COG4987, CydC, ABC-type transport system involved | 8e-06 | |
| PRK14236 | 272 | PRK14236, PRK14236, phosphate transporter ATP-bind | 9e-06 | |
| cd03220 | 224 | cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon | 9e-06 | |
| COG1124 | 252 | COG1124, DppF, ABC-type dipeptide/oligopeptide/nic | 9e-06 | |
| PRK14258 | 261 | PRK14258, PRK14258, phosphate ABC transporter ATP- | 1e-05 | |
| COG4618 | 580 | COG4618, ArpD, ABC-type protease/lipase transport | 1e-05 | |
| TIGR03740 | 223 | TIGR03740, galliderm_ABC, gallidermin-class lantib | 1e-05 | |
| cd03262 | 213 | cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai | 1e-05 | |
| TIGR03411 | 242 | TIGR03411, urea_trans_UrtD, urea ABC transporter, | 1e-05 | |
| TIGR02868 | 530 | TIGR02868, CydC, thiol reductant ABC exporter, Cyd | 2e-05 | |
| cd03251 | 234 | cd03251, ABCC_MsbA, ATP-binding cassette domain of | 2e-05 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 2e-05 | |
| TIGR01188 | 302 | TIGR01188, drrA, daunorubicin resistance ABC trans | 2e-05 | |
| COG4133 | 209 | COG4133, CcmA, ABC-type transport system involved | 2e-05 | |
| PRK13652 | 277 | PRK13652, cbiO, cobalt transporter ATP-binding sub | 2e-05 | |
| cd03249 | 238 | cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett | 2e-05 | |
| COG4586 | 325 | COG4586, COG4586, ABC-type uncharacterized transpo | 2e-05 | |
| PRK14266 | 250 | PRK14266, PRK14266, phosphate ABC transporter ATP- | 2e-05 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 2e-05 | |
| PRK14250 | 241 | PRK14250, PRK14250, phosphate ABC transporter ATP- | 2e-05 | |
| PRK15056 | 272 | PRK15056, PRK15056, manganese/iron transporter ATP | 3e-05 | |
| PRK14272 | 252 | PRK14272, PRK14272, phosphate ABC transporter ATP- | 3e-05 | |
| COG1136 | 226 | COG1136, SalX, ABC-type antimicrobial peptide tran | 3e-05 | |
| TIGR02142 | 354 | TIGR02142, modC_ABC, molybdenum ABC transporter, A | 3e-05 | |
| cd03255 | 218 | cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse | 3e-05 | |
| PRK10744 | 260 | PRK10744, pstB, phosphate transporter ATP-binding | 3e-05 | |
| COG4674 | 249 | COG4674, COG4674, Uncharacterized ABC-type transpo | 3e-05 | |
| PRK14235 | 267 | PRK14235, PRK14235, phosphate transporter ATP-bind | 4e-05 | |
| TIGR02982 | 220 | TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi | 4e-05 | |
| PRK13647 | 274 | PRK13647, cbiO, cobalt transporter ATP-binding sub | 4e-05 | |
| COG4559 | 259 | COG4559, COG4559, ABC-type hemin transport system, | 4e-05 | |
| PRK13643 | 288 | PRK13643, cbiO, cobalt transporter ATP-binding sub | 5e-05 | |
| COG4619 | 223 | COG4619, COG4619, ABC-type uncharacterized transpo | 5e-05 | |
| TIGR03258 | 362 | TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans | 6e-05 | |
| PRK13537 | 306 | PRK13537, PRK13537, nodulation ABC transporter Nod | 6e-05 | |
| PRK14239 | 252 | PRK14239, PRK14239, phosphate transporter ATP-bind | 6e-05 | |
| TIGR01189 | 198 | TIGR01189, ccmA, heme ABC exporter, ATP-binding pr | 7e-05 | |
| COG3839 | 338 | COG3839, MalK, ABC-type sugar transport systems, A | 7e-05 | |
| TIGR01288 | 303 | TIGR01288, nodI, ATP-binding ABC transporter famil | 7e-05 | |
| cd03265 | 220 | cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist | 7e-05 | |
| PRK14241 | 258 | PRK14241, PRK14241, phosphate transporter ATP-bind | 7e-05 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 8e-05 | |
| TIGR02314 | 343 | TIGR02314, ABC_MetN, D-methionine ABC transporter, | 8e-05 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 8e-05 | |
| TIGR02204 | 576 | TIGR02204, MsbA_rel, ABC transporter, permease/ATP | 9e-05 | |
| PRK14240 | 250 | PRK14240, PRK14240, phosphate transporter ATP-bind | 9e-05 | |
| PRK13657 | 588 | PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra | 1e-04 | |
| cd03298 | 211 | cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin | 1e-04 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 2e-04 | |
| PRK10636 | 638 | PRK10636, PRK10636, putative ABC transporter ATP-b | 2e-04 | |
| PRK13637 | 287 | PRK13637, cbiO, cobalt transporter ATP-binding sub | 2e-04 | |
| PRK14260 | 259 | PRK14260, PRK14260, phosphate ABC transporter ATP- | 2e-04 | |
| PRK14263 | 261 | PRK14263, PRK14263, phosphate ABC transporter ATP- | 2e-04 | |
| COG4608 | 268 | COG4608, AppF, ABC-type oligopeptide transport sys | 2e-04 | |
| PRK11264 | 250 | PRK11264, PRK11264, putative amino-acid ABC transp | 2e-04 | |
| cd03248 | 226 | cd03248, ABCC_TAP, ATP-binding cassette domain of | 2e-04 | |
| COG4161 | 242 | COG4161, ArtP, ABC-type arginine transport system, | 2e-04 | |
| PRK14257 | 329 | PRK14257, PRK14257, phosphate ABC transporter ATP- | 2e-04 | |
| PRK14264 | 305 | PRK14264, PRK14264, phosphate ABC transporter ATP- | 2e-04 | |
| PRK14238 | 271 | PRK14238, PRK14238, phosphate transporter ATP-bind | 3e-04 | |
| TIGR02770 | 230 | TIGR02770, nickel_nikD, nickel import ATP-binding | 3e-04 | |
| PRK14275 | 286 | PRK14275, PRK14275, phosphate ABC transporter ATP- | 3e-04 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 3e-04 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 3e-04 | |
| COG1126 | 240 | COG1126, GlnQ, ABC-type polar amino acid transport | 3e-04 | |
| cd03300 | 232 | cd03300, ABC_PotA_N, ATP-binding cassette domain o | 3e-04 | |
| cd03217 | 200 | cd03217, ABC_FeS_Assembly, ABC-type transport syst | 3e-04 | |
| PRK14245 | 250 | PRK14245, PRK14245, phosphate ABC transporter ATP- | 3e-04 | |
| COG4778 | 235 | COG4778, PhnL, ABC-type phosphonate transport syst | 3e-04 | |
| COG1101 | 263 | COG1101, PhnK, ABC-type uncharacterized transport | 3e-04 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 4e-04 | |
| PTZ00243 | 1560 | PTZ00243, PTZ00243, ABC transporter; Provisional | 4e-04 | |
| PRK13536 | 340 | PRK13536, PRK13536, nodulation factor exporter sub | 4e-04 | |
| cd03258 | 233 | cd03258, ABC_MetN_methionine_transporter, ATP-bind | 4e-04 | |
| PRK13651 | 305 | PRK13651, PRK13651, cobalt transporter ATP-binding | 4e-04 | |
| PRK10535 | 648 | PRK10535, PRK10535, macrolide transporter ATP-bind | 4e-04 | |
| PRK14254 | 285 | PRK14254, PRK14254, phosphate ABC transporter ATP- | 5e-04 | |
| PRK11300 | 255 | PRK11300, livG, leucine/isoleucine/valine transpor | 5e-04 | |
| cd03254 | 229 | cd03254, ABCC_Glucan_exporter_like, ATP-binding ca | 5e-04 | |
| COG3840 | 231 | COG3840, ThiQ, ABC-type thiamine transport system, | 5e-04 | |
| TIGR03719 | 552 | TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot | 5e-04 | |
| PRK14237 | 267 | PRK14237, PRK14237, phosphate transporter ATP-bind | 5e-04 | |
| PRK09493 | 240 | PRK09493, glnQ, glutamine ABC transporter ATP-bind | 6e-04 | |
| PRK10908 | 222 | PRK10908, PRK10908, cell division protein FtsE; Pr | 6e-04 | |
| TIGR02211 | 221 | TIGR02211, LolD_lipo_ex, lipoprotein releasing sys | 6e-04 | |
| PRK14242 | 253 | PRK14242, PRK14242, phosphate transporter ATP-bind | 7e-04 | |
| PRK14249 | 251 | PRK14249, PRK14249, phosphate ABC transporter ATP- | 7e-04 | |
| PRK14243 | 264 | PRK14243, PRK14243, phosphate transporter ATP-bind | 7e-04 | |
| COG5265 | 497 | COG5265, ATM1, ABC-type transport system involved | 7e-04 | |
| TIGR01846 | 694 | TIGR01846, type_I_sec_HlyB, type I secretion syste | 7e-04 | |
| PRK09452 | 375 | PRK09452, potA, putrescine/spermidine ABC transpor | 8e-04 | |
| PRK10575 | 265 | PRK10575, PRK10575, iron-hydroxamate transporter A | 8e-04 | |
| PRK14256 | 252 | PRK14256, PRK14256, phosphate ABC transporter ATP- | 8e-04 | |
| PRK11144 | 352 | PRK11144, modC, molybdate transporter ATP-binding | 8e-04 | |
| PRK14259 | 269 | PRK14259, PRK14259, phosphate ABC transporter ATP- | 9e-04 | |
| PRK14255 | 252 | PRK14255, PRK14255, phosphate ABC transporter ATP- | 9e-04 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 0.001 | |
| COG3842 | 352 | COG3842, PotA, ABC-type spermidine/putrescine tran | 0.001 | |
| COG1137 | 243 | COG1137, YhbG, ABC-type (unclassified) transport s | 0.001 | |
| COG0444 | 316 | COG0444, DppD, ABC-type dipeptide/oligopeptide/nic | 0.001 | |
| cd03218 | 232 | cd03218, ABC_YhbG, ATP-binding cassette component | 0.001 | |
| PRK14267 | 253 | PRK14267, PRK14267, phosphate ABC transporter ATP- | 0.001 | |
| PRK00635 | 1809 | PRK00635, PRK00635, excinuclease ABC subunit A; Pr | 0.001 | |
| PRK13650 | 279 | PRK13650, cbiO, cobalt transporter ATP-binding sub | 0.001 | |
| PRK14251 | 251 | PRK14251, PRK14251, phosphate ABC transporter ATP- | 0.001 | |
| PRK14268 | 258 | PRK14268, PRK14268, phosphate ABC transporter ATP- | 0.001 | |
| PRK11160 | 574 | PRK11160, PRK11160, cysteine/glutathione ABC trans | 0.001 | |
| COG0410 | 237 | COG0410, LivF, ABC-type branched-chain amino acid | 0.001 | |
| cd03267 | 236 | cd03267, ABC_NatA_like, ATP-binding cassette domai | 0.001 | |
| TIGR01978 | 243 | TIGR01978, sufC, FeS assembly ATPase SufC | 0.001 | |
| cd03224 | 222 | cd03224, ABC_TM1139_LivF_branched, ATP-binding cas | 0.001 | |
| cd03215 | 182 | cd03215, ABC_Carb_Monos_II, Second domain of the A | 0.002 | |
| PRK13649 | 280 | PRK13649, cbiO, cobalt transporter ATP-binding sub | 0.002 | |
| cd03247 | 178 | cd03247, ABCC_cytochrome_bd, ATP-binding cassette | 0.002 | |
| PRK14271 | 276 | PRK14271, PRK14271, phosphate ABC transporter ATP- | 0.002 | |
| PRK11174 | 588 | PRK11174, PRK11174, cysteine/glutathione ABC trans | 0.002 | |
| PRK11000 | 369 | PRK11000, PRK11000, maltose/maltodextrin transport | 0.002 | |
| COG0396 | 251 | COG0396, sufC, Cysteine desulfurase activator ATPa | 0.002 | |
| PRK14252 | 265 | PRK14252, PRK14252, phosphate ABC transporter ATP- | 0.002 | |
| TIGR02323 | 253 | TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys | 0.002 | |
| PRK13640 | 282 | PRK13640, cbiO, cobalt transporter ATP-binding sub | 0.002 | |
| TIGR01193 | 708 | TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t | 0.003 | |
| COG4136 | 213 | COG4136, COG4136, ABC-type uncharacterized transpo | 0.003 | |
| PRK13548 | 258 | PRK13548, hmuV, hemin importer ATP-binding subunit | 0.003 | |
| cd03246 | 173 | cd03246, ABCC_Protease_Secretion, ATP-binding cass | 0.003 | |
| PRK14265 | 274 | PRK14265, PRK14265, phosphate ABC transporter ATP- | 0.003 | |
| PRK11819 | 556 | PRK11819, PRK11819, putative ABC transporter ATP-b | 0.003 | |
| PRK13646 | 286 | PRK13646, cbiO, cobalt transporter ATP-binding sub | 0.003 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 0.004 | |
| PRK11248 | 255 | PRK11248, tauB, taurine transporter ATP-binding su | 0.004 | |
| PRK13635 | 279 | PRK13635, cbiO, cobalt transporter ATP-binding sub | 0.004 | |
| CHL00131 | 252 | CHL00131, ycf16, sulfate ABC transporter protein; | 0.004 | |
| cd03259 | 213 | cd03259, ABC_Carb_Solutes_like, ATP-binding casset | 0.004 | |
| COG4525 | 259 | COG4525, TauB, ABC-type taurine transport system, | 0.004 | |
| TIGR03797 | 686 | TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste | 0.004 |
| >gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
Score = 268 bits (686), Expect = 2e-82
Identities = 146/529 (27%), Positives = 244/529 (46%), Gaps = 72/529 (13%)
Query: 1 MTNDEINDIVEETIIKMGLQACAETKIGN-WHLRGISSGEKKRLSISIEILTQPTVLLLD 59
+T E + V+E + +GL+ CA T+IG ++G+S GE+KRL+ + E+LT P +L D
Sbjct: 132 VTKKEKRERVDEVLQALGLRKCANTRIGVPGRVKGLSGGERKRLAFASELLTDPPLLFCD 191
Query: 60 EPTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDA 119
EPTSGLDS A+ V+QVLK +A G+ ++C+IHQPSS LF LFD ++L++ G Y G
Sbjct: 192 EPTSGLDSFMAYSVVQVLKGLAQKGKTIICTIHQPSSELFELFDKIILMAEGRVAYLGSP 251
Query: 120 KMAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLKSQAPTEIPMSSNSQMYLST 179
AV FF++ G PCP NP+D +++ + IP S N S
Sbjct: 252 DQAVPFFSDLGHPCPENYNPADFYVQVL-----------------AVIPGSENE----SR 290
Query: 180 EEIKAKLVEEYRNSEISMDIRQRVRELAHNEQ------EETVLSKDRASWWKQLCILSHR 233
E I+ K+ + + S+I D+ + E ASWW Q L R
Sbjct: 291 ERIE-KICDSFAVSDIGRDMLVNTNLWSGKAGGLVKDSENMEGIGYNASWWTQFYALLKR 349
Query: 234 SFLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYG-------- 285
S+L++LRD +R++ ++ +I +G++YL GL+ K V I G
Sbjct: 350 SWLSVLRDPLLLKVRLIQTMMTAILIGLIYLGQGLT-------QKGVQNINGALFLFLTN 402
Query: 286 --FLICLSV-----GGLPSFIEEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISS 338
F V LP F+ E S R+S ++ L+ ++ P +IL
Sbjct: 403 MTFQNVFPVINVFTAELPVFLRET-RSGLYRVSAYF------LAKTIAELPLFIILPALF 455
Query: 339 GTILHYMVQFHPGFSHYCHFCLSLFCC--VSIVET-CMMVVALLVPNVLMGMGVGTALIV 395
+I ++M+ G + HF LF V+ V T +++ + M + VG ++
Sbjct: 456 TSITYWMIGLRSGAT---HFLTFLFLVTLVANVATSFGYLISCAFSSTSMALTVGPPFVI 512
Query: 396 LMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEG----QFKNDMIGLEFDPAVPGDPK 451
++ F +P +F +SY+++ + EG Q+ + G
Sbjct: 513 PFLLFGGFFINSDSIPVYFKW--LSYLSWFRYGNEGLLINQWSDVDNIECTSANTTGPCP 570
Query: 452 LKGEEILLKLYGVQLNYCKWWDLAALFCILTCYKIVLFATLKYKDKASK 500
GE IL L + + DL L ++ ++++ + L+ + + +
Sbjct: 571 SSGEVILETLSFRNADL--YLDLIGLVILIFFFRLLAYFALRIRIRRKR 617
|
[Transport and binding proteins, Other]. Length = 617 |
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters | Back alignment and domain information |
|---|
| >gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems | Back alignment and domain information |
|---|
| >gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters | Back alignment and domain information |
|---|
| >gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter | Back alignment and domain information |
|---|
| >gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D | Back alignment and domain information |
|---|
| >gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter | Back alignment and domain information |
|---|
| >gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F | Back alignment and domain information |
|---|
| >gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters | Back alignment and domain information |
|---|
| >gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein | Back alignment and domain information |
|---|
| >gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents | Back alignment and domain information |
|---|
| >gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters | Back alignment and domain information |
|---|
| >gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein | Back alignment and domain information |
|---|
| >gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system | Back alignment and domain information |
|---|
| >gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234806 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA | Back alignment and domain information |
|---|
| >gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like | Back alignment and domain information |
|---|
| >gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 527 | |||
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 100.0 | |
| KOG0061 | 613 | consensus Transporter, ABC superfamily (Breast can | 100.0 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 100.0 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 100.0 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 100.0 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 100.0 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 100.0 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 100.0 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 100.0 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.94 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.94 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 99.93 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.93 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.92 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 99.92 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.92 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.92 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.91 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 99.9 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.9 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.9 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 99.9 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.9 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.9 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 99.9 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.9 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.89 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 99.89 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.89 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.89 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.89 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.89 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.88 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.88 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 99.88 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 99.88 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.88 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.88 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 99.88 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.88 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.88 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.88 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 99.88 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.88 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.88 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 99.88 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 99.88 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 99.88 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.88 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.87 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.87 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.87 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.87 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.87 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.87 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.87 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.87 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.87 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 99.87 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 99.87 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.87 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 99.87 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.87 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 99.87 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 99.87 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.87 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.87 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 99.87 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 99.87 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.87 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.87 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.87 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.87 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.87 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.87 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 99.87 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 99.86 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.86 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.86 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.86 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 99.86 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.86 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.86 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.86 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.86 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.86 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 99.86 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 99.86 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 99.86 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.86 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 99.86 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 99.86 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 99.86 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 99.86 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 99.86 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.86 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.86 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.86 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 99.86 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 99.86 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.86 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.86 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.86 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.86 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 99.86 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 99.86 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 99.86 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.86 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 99.86 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 99.85 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.85 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 99.85 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 99.85 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.85 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 99.85 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.85 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.85 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 99.85 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.85 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.85 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.85 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.85 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 99.85 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.85 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 99.85 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.85 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.85 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 99.85 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.85 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.85 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.85 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 99.85 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.85 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 99.85 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.84 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.84 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.84 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.84 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.84 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 99.84 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 99.84 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 99.84 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 99.84 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.84 | |
| PF01061 | 210 | ABC2_membrane: ABC-2 type transporter; InterPro: I | 99.84 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.84 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 99.84 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.84 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.84 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.84 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.84 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.84 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 99.84 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.84 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.84 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.84 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 99.84 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 99.84 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.84 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.84 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.84 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 99.84 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 99.84 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.83 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.83 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 99.83 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.83 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.83 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.83 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.83 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.83 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.83 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 99.83 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.83 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.83 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.83 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.83 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.83 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.83 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 99.83 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.83 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.82 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 99.82 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.82 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.82 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 99.82 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.82 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.82 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.82 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.81 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 99.81 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 99.81 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 99.81 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.81 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 99.81 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 99.81 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.81 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 99.8 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.8 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 99.8 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 99.8 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 99.8 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 99.8 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 99.8 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 99.8 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 99.8 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 99.8 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 99.8 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.8 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.79 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 99.79 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 99.79 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 99.79 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.79 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 99.78 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 99.78 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 99.78 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 99.78 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 99.78 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 99.78 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.78 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 99.78 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 99.78 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 99.78 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.78 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 99.78 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.77 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 99.77 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 99.77 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 99.77 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 99.77 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 99.77 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 99.77 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 99.77 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 99.77 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 99.77 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 99.77 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.77 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.77 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.77 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 99.76 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 99.76 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 99.76 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 99.76 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.76 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 99.76 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.76 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.76 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.76 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.76 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 99.76 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 99.76 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 99.76 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 99.75 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 99.75 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 99.75 | |
| KOG0059 | 885 | consensus Lipid exporter ABCA1 and related protein | 99.75 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.75 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.75 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.75 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 99.75 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 99.75 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.75 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 99.75 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 99.74 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 99.74 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.74 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 99.74 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 99.74 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.74 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.74 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 99.73 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 99.73 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 99.73 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 99.73 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.73 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 99.73 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.73 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 99.72 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.72 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 99.72 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 99.72 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 99.72 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 99.72 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.71 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.71 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.71 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 99.71 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 99.71 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.71 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.7 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 99.7 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.7 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.7 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 99.69 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.69 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.69 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.69 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.69 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.68 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.68 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.68 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 99.67 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 99.67 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.67 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.67 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 99.66 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 99.65 | |
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 99.65 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.65 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.65 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.65 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.64 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 99.64 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 99.64 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.64 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 99.63 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.63 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.63 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 99.63 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 99.62 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.6 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 99.59 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.59 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.59 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 99.59 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.59 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.58 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.58 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 99.58 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.58 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.56 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 99.54 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.54 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.51 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 99.5 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.49 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 99.48 | |
| COG4170 | 330 | SapD ABC-type antimicrobial peptide transport syst | 99.46 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.44 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.43 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 99.41 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.41 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 99.39 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 99.39 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 99.34 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 99.34 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.34 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 99.33 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 99.31 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 99.3 | |
| TIGR01247 | 236 | drrB daunorubicin resistance ABC transporter membr | 99.3 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 99.29 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.29 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 99.29 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 99.28 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 99.26 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.24 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.22 | |
| TIGR01291 | 253 | nodJ ABC-2 type transporter, NodJ family. Nearly a | 99.22 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 99.21 | |
| TIGR03062 | 208 | pip_yhgE_Cterm YhgE/Pip C-terminal domain. This fa | 99.16 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 99.14 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 99.14 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 99.13 | |
| TIGR00025 | 232 | Mtu_efflux ABC transporter efflux protein, DrrB fa | 99.1 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 99.09 | |
| TIGR03861 | 253 | phenyl_ABC_PedC alcohol ABC transporter, permease | 99.08 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 99.05 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.04 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 99.03 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 99.03 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 98.96 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.94 | |
| PRK15066 | 257 | inner membrane transport permease; Provisional | 98.94 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 98.85 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.84 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 98.81 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.81 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 98.81 | |
| KOG2355 | 291 | consensus Predicted ABC-type transport, ATPase com | 98.8 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 98.78 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.72 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.72 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 98.63 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 98.57 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 98.56 | |
| KOG0063 | 592 | consensus RNAse L inhibitor, ABC superfamily [RNA | 98.55 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 98.55 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 98.53 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 98.48 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 98.45 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 98.43 | |
| COG0842 | 286 | ABC-type multidrug transport system, permease comp | 98.39 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 98.36 | |
| PF13304 | 303 | AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T | 98.34 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 98.32 | |
| KOG0063 | 592 | consensus RNAse L inhibitor, ABC superfamily [RNA | 98.28 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 98.27 | |
| KOG0064 | 728 | consensus Peroxisomal long-chain acyl-CoA transpor | 98.23 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 98.23 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 98.14 | |
| PF13558 | 90 | SbcCD_C: Putative exonuclease SbcCD, C subunit; PD | 98.12 | |
| PRK13695 | 174 | putative NTPase; Provisional | 98.01 | |
| PF06422 | 103 | PDR_CDR: CDR ABC transporter; InterPro: IPR010929 | 98.01 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 98.0 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 97.95 | |
| TIGR01248 | 152 | drrC daunorubicin resistance protein C. The model | 97.94 | |
| TIGR03518 | 240 | ABC_perm_GldF gliding motility-associated ABC tran | 97.89 | |
| PF12679 | 277 | ABC2_membrane_2: ABC-2 family transporter protein | 97.83 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 97.81 | |
| PRK13830 | 818 | conjugal transfer protein TrbE; Provisional | 97.73 | |
| COG1682 | 263 | TagG ABC-type polysaccharide/polyol phosphate expo | 97.67 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 97.53 | |
| cd03286 | 218 | ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS | 97.52 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 97.47 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.37 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.27 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 97.27 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.16 | |
| PRK15176 | 264 | Vi polysaccharide export inner membrane protein Ve | 97.13 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 97.1 | |
| PF13175 | 415 | AAA_15: AAA ATPase domain | 97.07 | |
| PF12698 | 344 | ABC2_membrane_3: ABC-2 family transporter protein; | 96.96 | |
| PF08370 | 65 | PDR_assoc: Plant PDR ABC transporter associated; I | 96.9 | |
| PRK13891 | 852 | conjugal transfer protein TrbE; Provisional | 96.87 | |
| COG4637 | 373 | Predicted ATPase [General function prediction only | 96.85 | |
| PF03379 | 215 | CcmB: CcmB protein; InterPro: IPR003544 Within mit | 96.71 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.56 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 96.3 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 96.26 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 96.2 | |
| PF13166 | 712 | AAA_13: AAA domain | 96.14 | |
| COG1277 | 278 | NosY ABC-type transport system involved in multi-c | 96.05 | |
| PRK13873 | 811 | conjugal transfer ATPase TrbE; Provisional | 96.01 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 95.56 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 95.47 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 95.05 | |
| PRK13898 | 800 | type IV secretion system ATPase VirB4; Provisional | 94.87 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 94.81 | |
| PRK05399 | 854 | DNA mismatch repair protein MutS; Provisional | 94.79 | |
| TIGR01190 | 211 | ccmB heme exporter protein CcmB. This model descri | 94.43 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 94.43 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 94.37 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 94.31 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 94.29 | |
| PF12051 | 382 | DUF3533: Protein of unknown function (DUF3533); In | 94.17 | |
| COG4587 | 268 | ABC-type uncharacterized transport system, permeas | 94.09 | |
| COG1511 | 780 | Predicted membrane protein [Function unknown] | 93.76 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 93.52 | |
| COG1195 | 363 | RecF Recombinational DNA repair ATPase (RecF pathw | 93.27 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 93.14 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 92.68 | |
| COG4694 | 758 | Uncharacterized protein conserved in bacteria [Fun | 92.59 |
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-81 Score=696.29 Aligned_cols=471 Identities=27% Similarity=0.506 Sum_probs=412.4
Q ss_pred CHHHHHHHHHHHHHHcCCcccccccccCc-ccCCCCHHHHHHHHHHHHHHhCCCEEEEeCCCCCCCHHHHHHHHHHHHHH
Q 009738 2 TNDEINDIVEETIIKMGLQACAETKIGNW-HLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCI 80 (527)
Q Consensus 2 ~~~~~~~~v~~~l~~l~L~~~~~~~i~~~-~~~~lSgGer~Rl~ia~~l~~~p~llllDEPtsgLD~~~~~~i~~~l~~l 80 (527)
++++++++++++++.+||.+++|+++|+. ..++||||||||++||++|+.+|++++|||||+|||+.++.++++.|+++
T Consensus 133 ~~~~~~~~v~~~l~~lgL~~~~~t~vg~~~~~~~LSgGqrkRvsia~aL~~~p~vlllDEPtsgLD~~~~~~l~~~L~~l 212 (617)
T TIGR00955 133 TKKEKRERVDEVLQALGLRKCANTRIGVPGRVKGLSGGERKRLAFASELLTDPPLLFCDEPTSGLDSFMAYSVVQVLKGL 212 (617)
T ss_pred CHHHHHHHHHHHHHHcCchhcCcCccCCCCCCCCcCcchhhHHHHHHHHHcCCCEEEeeCCCcchhHHHHHHHHHHHHHH
Confidence 34667788999999999999999999985 36899999999999999999999999999999999999999999999999
Q ss_pred HhCCCEEEEEecCChhHHHhhcCeEEEEeCCeEEEEeChhhHHHHHhhcCCCCCCCCCchHHHHHhhccCcccccccccc
Q 009738 81 ALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLK 160 (527)
Q Consensus 81 ~~~~~tvi~~~H~~~~~i~~~~d~v~~l~~G~~~~~G~~~~~~~~f~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (527)
+++|+|+|+++|||+.+++++||++++|++|+++|.|+++++.+||++.|++||++.||+|+++++++.+.+.
T Consensus 213 ~~~g~tvi~~~hq~~~~i~~~~D~i~ll~~G~~v~~G~~~~~~~~f~~~g~~~p~~~n~ad~~~~~~~~~~~~------- 285 (617)
T TIGR00955 213 AQKGKTIICTIHQPSSELFELFDKIILMAEGRVAYLGSPDQAVPFFSDLGHPCPENYNPADFYVQVLAVIPGS------- 285 (617)
T ss_pred HhCCCEEEEEeCCCCHHHHHHhceEEEeeCCeEEEECCHHHHHHHHHHcCCCCCCCCChHHHHHHHhhcCccc-------
Confidence 9889999999999988999999999999999999999999999999999999999999999999987643210
Q ss_pred CCCCCCCCCCCCccccccHHHHHHHHHHHHhcchhhHHHHHHHHHhhccC-----ccc-cccCCCCCCHHHHHHHHHHHH
Q 009738 161 SQAPTEIPMSSNSQMYLSTEEIKAKLVEEYRNSEISMDIRQRVRELAHNE-----QEE-TVLSKDRASWWKQLCILSHRS 234 (527)
Q Consensus 161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~-----~~~-~~~~~~~~s~~~Q~~~L~~R~ 234 (527)
+ ....+..+++.+.|+.++..++..+........+ ... .....+..+|++|+.+|++|+
T Consensus 286 -----~----------~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~l~~R~ 350 (617)
T TIGR00955 286 -----E----------NESRERIEKICDSFAVSDIGRDMLVNTNLWSGKAGGLVKDSENMEGIGYNASWWTQFYALLKRS 350 (617)
T ss_pred -----c----------cchHHHHHHHHHHHhcchhhHHHHHHhhhhhccccccccccccccccccCCCHHHHHHHHHHHH
Confidence 0 0012234556777777766555444332211110 001 112345789999999999999
Q ss_pred HHHHHhChHHHHHHHHHHHHHHHHHHHHhccCCCChhhhhhhhHHHHHHHHHHHHHH-hhhHHHHHHHHHHHHHhhcCCC
Q 009738 235 FLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLS-VGGLPSFIEEHKASYRERISCH 313 (527)
Q Consensus 235 ~~~~~Rd~~~~~~r~~~~~~~~li~G~lf~~l~~~~~~i~~r~~~l~f~~~~~~~~~-~~~~~~f~~er~v~~rE~~~g~ 313 (527)
+++.+|||.++..|+++.+++|+++|++|++++++++++++|.|++|++.+++.+.+ ...++.|+.||++|+||+.+|+
T Consensus 351 ~~~~~R~~~~~~~~~~~~i~~~li~G~~f~~~~~~~~~~~~~~g~lf~~~~~~~f~~~~~~~~~f~~er~v~~rE~~~~~ 430 (617)
T TIGR00955 351 WLSVLRDPLLLKVRLIQTMMTAILIGLIYLGQGLTQKGVQNINGALFLFLTNMTFQNVFPVINVFTAELPVFLRETRSGL 430 (617)
T ss_pred HHHHhcCHHHHHHHHHHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCc
Confidence 999999999999999999999999999999999999999999999999888877765 4668899999999999999999
Q ss_pred CChhHHHHHHHHHHHHHHHHHHhhhhhhhhccccccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhhHHHHHHHHHH
Q 009738 314 YGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFCLSLFCCVSIVETCMMVVALLVPNVLMGMGVGTAL 393 (527)
Q Consensus 314 Y~~~~y~la~~l~~lP~~~~~~~if~~i~Y~m~gl~~~~~~f~~f~l~~~~~~~~~~~~~~~v~~~~~~~~~a~~~~~~~ 393 (527)
|++++|++|++++|+|+.++.+++|.+|+|||+|+++++.+|++|++++++..+++.++++++++++|+..+|+.+++++
T Consensus 431 Y~~~~y~la~~l~~lp~~~~~~~if~~i~Y~~~gl~~~~~~f~~f~l~~~l~~~~~~s~~~~i~~~~~~~~~a~~~~~~~ 510 (617)
T TIGR00955 431 YRVSAYFLAKTIAELPLFIILPALFTSITYWMIGLRSGATHFLTFLFLVTLVANVATSFGYLISCAFSSTSMALTVGPPF 510 (617)
T ss_pred cCHHHHHHHHHHHHHHHHHHHHHHHHhhhheeccCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCchHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhhccccCCCCCCcccccccccccCHHHHHHHHHHHhhhcCCcc-CCCC---CCCCCCcHHHHHHHhhCCcCcch
Q 009738 394 IVLMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEGQFKNDMIGLEF-DPAV---PGDPKLKGEEILLKLYGVQLNYC 469 (527)
Q Consensus 394 ~~~~~lf~Gf~i~~~~ip~~~w~w~~~yiSp~~Y~~~~l~~nef~g~~~-~~~~---~~~~~~~G~~~L~~~~~~~~~~~ 469 (527)
+.++++|+||+++.++||.| |+| ++|+||++|++||++.|||.|.++ +|.. .+.|..+|+++|+. +|++.+ +
T Consensus 511 ~~~~~lf~G~~i~~~~ip~~-~~W-~~~isp~~ya~~al~~nef~~~~~~~c~~~~~~~~c~~~g~~~l~~-~g~~~~-~ 586 (617)
T TIGR00955 511 VIPFLLFGGFFINSDSIPVY-FKW-LSYLSWFRYGNEGLLINQWSDVDNIECTSANTTGPCPSSGEVILET-LSFRNA-D 586 (617)
T ss_pred HHHHHHHhhcccChhhccHH-HHH-HHHcCHHHHHHHHHHHHHhCCCccccccCcCcCCCCCcChHHHHHh-cCCCcc-c
Confidence 99999999999999999985 899 999999999999999999999775 4432 12244689999985 788754 4
Q ss_pred hhhHHHHHHHHHHHHHHHHHHHHHhhcch
Q 009738 470 KWWDLAALFCILTCYKIVLFATLKYKDKA 498 (527)
Q Consensus 470 ~w~~~~iL~~~~v~f~~~~~~~L~~~~~~ 498 (527)
.|.|+++|++++++|++++|++|+++.+.
T Consensus 587 ~~~~~~il~~~~~~~~~l~~~~L~~~~~~ 615 (617)
T TIGR00955 587 LYLDLIGLVILIFFFRLLAYFALRIRIRR 615 (617)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence 79999999999999999999999987653
|
|
| >KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF01061 ABC2_membrane: ABC-2 type transporter; InterPro: IPR013525 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01247 drrB daunorubicin resistance ABC transporter membrane protein | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01291 nodJ ABC-2 type transporter, NodJ family | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03062 pip_yhgE_Cterm YhgE/Pip C-terminal domain | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00025 Mtu_efflux ABC transporter efflux protein, DrrB family | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR03861 phenyl_ABC_PedC alcohol ABC transporter, permease protein | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK15066 inner membrane transport permease; Provisional | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >COG0842 ABC-type multidrug transport system, permease component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PF06422 PDR_CDR: CDR ABC transporter; InterPro: IPR010929 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >TIGR01248 drrC daunorubicin resistance protein C | Back alignment and domain information |
|---|
| >TIGR03518 ABC_perm_GldF gliding motility-associated ABC transporter permease protein GldF | Back alignment and domain information |
|---|
| >PF12679 ABC2_membrane_2: ABC-2 family transporter protein | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK13830 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >COG1682 TagG ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK15176 Vi polysaccharide export inner membrane protein VexB; Provisional | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13175 AAA_15: AAA ATPase domain | Back alignment and domain information |
|---|
| >PF12698 ABC2_membrane_3: ABC-2 family transporter protein; PDB: 2P0S_B 3CNI_A | Back alignment and domain information |
|---|
| >PF08370 PDR_assoc: Plant PDR ABC transporter associated; InterPro: IPR013581 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PRK13891 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >COG4637 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03379 CcmB: CcmB protein; InterPro: IPR003544 Within mitochondria and bacteria, a family of related proteins is involved in the assembly of periplasmic c-type cytochromes: these include CycK [], CcmF [,], NrfE [] and CcbS [] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >COG1277 NosY ABC-type transport system involved in multi-copper enzyme maturation, permease component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13873 conjugal transfer ATPase TrbE; Provisional | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13898 type IV secretion system ATPase VirB4; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK05399 DNA mismatch repair protein MutS; Provisional | Back alignment and domain information |
|---|
| >TIGR01190 ccmB heme exporter protein CcmB | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PF12051 DUF3533: Protein of unknown function (DUF3533); InterPro: IPR022703 This transmembrane domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >COG4587 ABC-type uncharacterized transport system, permease component [General function prediction only] | Back alignment and domain information |
|---|
| >COG1511 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4694 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 527 | ||||
| 4ayt_A | 595 | Structure Of The Human Mitochondrial Abc Transporte | 3e-06 | ||
| 4ayw_A | 619 | Structure Of The Human Mitochondrial Abc Transporte | 4e-06 | ||
| 1b0u_A | 262 | Atp-Binding Subunit Of The Histidine Permease From | 8e-06 | ||
| 1f3o_A | 235 | Crystal Structure Of Mj0796 Atp-Binding Cassette Le | 2e-05 | ||
| 1l2t_A | 235 | Dimeric Structure Of Mj0796, A Bacterial Abc Transp | 3e-05 | ||
| 2ihy_A | 279 | Structure Of The Staphylococcus Aureus Putative Atp | 3e-05 | ||
| 3g5u_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 3e-05 | ||
| 3g60_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 3e-05 | ||
| 4f4c_A | 1321 | The Crystal Structure Of The Multi-Drug Transporter | 4e-05 | ||
| 1mv5_A | 243 | Crystal Structure Of Lmra Atp-Binding Domain Length | 6e-05 | ||
| 2olj_A | 263 | Abc Protein Artp In Complex With AdpMG2+ Length = 2 | 9e-05 | ||
| 3nh6_A | 306 | Nucleotide Binding Domain Of Human Abcb6 (Apo Struc | 9e-05 | ||
| 3c41_J | 242 | Abc Protein Artp In Complex With Amp-PnpMG2+ Length | 1e-04 | ||
| 3tif_A | 235 | Dimeric Structure Of A Post-Hydrolysis State Of The | 1e-04 | ||
| 2hyd_A | 578 | Multidrug Abc Transporter Sav1866 Length = 578 | 1e-04 | ||
| 1vpl_A | 256 | Crystal Structure Of Abc Transporter Atp-binding Pr | 2e-04 | ||
| 3gfo_A | 275 | Structure Of Cbio1 From Clostridium Perfringens: Pa | 7e-04 | ||
| 2pcj_A | 224 | Crystal Structure Of Abc Transporter (Aq_297) From | 8e-04 | ||
| 3b5j_A | 243 | Crystal Structures Of The S504a Mutant Of An Isolat | 8e-04 | ||
| 3dhw_C | 343 | Crystal Structure Of Methionine Importer Metni Leng | 8e-04 | ||
| 2pmk_A | 243 | Crystal Structures Of An Isolated Abc-Atpase In Com | 8e-04 |
| >pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 | Back alignment and structure |
|
| >pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 | Back alignment and structure |
| >pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 | Back alignment and structure |
| >pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 | Back alignment and structure |
| >pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 | Back alignment and structure |
| >pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 | Back alignment and structure |
| >pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 | Back alignment and structure |
| >pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 | Back alignment and structure |
| >pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 | Back alignment and structure |
| >pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 | Back alignment and structure |
| >pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 | Back alignment and structure |
| >pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 | Back alignment and structure |
| >pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 | Back alignment and structure |
| >pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 | Back alignment and structure |
| >pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 | Back alignment and structure |
| >pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 | Back alignment and structure |
| >pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 | Back alignment and structure |
| >pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 | Back alignment and structure |
| >pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 527 | |||
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 9e-13 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 1e-12 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 5e-11 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 3e-10 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 1e-08 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 6e-06 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 3e-08 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 5e-08 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 2e-07 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 6e-07 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 3e-07 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 4e-07 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 6e-07 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 8e-07 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 2e-05 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 1e-06 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 1e-06 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 3e-06 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 2e-06 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 4e-06 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 5e-06 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 2e-05 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 1e-05 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 5e-05 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 3e-05 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 2e-04 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 2e-04 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 3e-04 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 3e-04 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 6e-04 |
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 | Back alignment and structure |
|---|
Score = 67.2 bits (165), Expect = 9e-13
Identities = 30/114 (26%), Positives = 59/114 (51%), Gaps = 8/114 (7%)
Query: 8 DIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDS 67
+ + + + L A+ + + +S G+++ + I+ I ++ ++LLDEPTS LD
Sbjct: 107 QVAMQALDYLNLTHLAKREFTS-----LSGGQRQLILIARAIASECKLILLDEPTSALDL 161
Query: 68 ASAFFVIQVLKCIALD-GRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAK 120
A+ V+ +L +A VV + HQP + + + + LLL N + FG+ +
Sbjct: 162 ANQDIVLSLLIDLAQSQNMTVVFTTHQP-NQVVAIANKTLLL-NKQNFKFGETR 213
|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 527 | |||
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.93 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.92 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.92 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.92 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.92 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.91 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.91 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.91 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.91 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.91 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.91 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.91 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 99.91 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.9 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.9 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.9 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.9 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.9 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.9 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.9 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.9 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.9 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.9 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.89 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 99.89 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.89 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.87 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 99.87 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.87 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.86 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.86 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.86 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.84 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.83 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.83 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 99.82 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.82 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.82 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.82 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.81 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.81 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.81 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 99.81 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 99.8 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 99.8 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.79 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 99.79 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.79 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.78 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.78 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.78 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.78 | |
| 1f2t_B | 148 | RAD50 ABC-ATPase; DNA double-strand break repair, | 99.78 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.77 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.77 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.77 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 99.75 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.75 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.75 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.74 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 99.74 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 99.74 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.73 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 99.72 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.72 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.72 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 99.71 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.7 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.7 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 99.65 | |
| 3kta_B | 173 | Chromosome segregation protein SMC; structural mai | 99.54 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 99.53 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.53 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 99.53 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 99.52 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 99.43 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 99.42 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 99.39 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 99.34 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 99.32 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 99.13 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.12 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 98.95 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 98.92 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 98.89 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 98.63 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 98.62 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 98.62 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 98.61 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 98.56 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 98.51 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 98.51 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 98.43 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 98.37 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 98.3 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 98.28 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 98.16 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 98.15 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 98.12 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 98.11 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 98.1 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 98.08 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 98.02 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 98.01 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 97.98 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.91 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.9 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.9 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.76 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.72 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 97.72 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.61 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 97.36 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.35 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.13 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 97.12 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.09 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 96.97 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.89 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.82 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 96.39 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.26 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 96.15 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.12 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 96.11 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 95.95 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.79 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 95.65 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 95.59 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 95.57 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 95.56 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 95.49 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 94.37 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 94.16 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 94.15 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 93.76 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 92.93 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 92.91 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 92.57 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 92.44 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 91.57 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 91.38 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 90.14 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 89.86 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 89.46 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 89.31 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 88.55 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 88.17 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 87.93 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 83.79 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 83.25 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 83.01 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 82.97 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 81.91 |
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
Probab=99.93 E-value=2.9e-25 Score=221.40 Aligned_cols=116 Identities=26% Similarity=0.448 Sum_probs=106.5
Q ss_pred CHHHHHHHHHHHHHHcCCcccccccccCcccCCCCHHHHHHHHHHHHHHhCCCEEEEeCCCCCCCHHHHHHHHHHHHHHH
Q 009738 2 TNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIA 81 (527)
Q Consensus 2 ~~~~~~~~v~~~l~~l~L~~~~~~~i~~~~~~~lSgGer~Rl~ia~~l~~~p~llllDEPtsgLD~~~~~~i~~~l~~l~ 81 (527)
++++.+++++++++.+||++.++++++ +|||||||||+||++|+.+|++|||||||+|||+.++..+++.|++++
T Consensus 116 ~~~~~~~~~~~~l~~~~L~~~~~~~~~-----~LSgGqkQRv~iAraL~~~P~lLlLDEPts~LD~~~~~~i~~~l~~l~ 190 (275)
T 3gfo_A 116 PEDEIRKRVDNALKRTGIEHLKDKPTH-----CLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQ 190 (275)
T ss_dssp CHHHHHHHHHHHHHHTTCGGGTTSBGG-----GSCHHHHHHHHHHHHHTTCCSEEEEECTTTTCCHHHHHHHHHHHHHHH
T ss_pred CHHHHHHHHHHHHHHcCCchhhcCCcc-----cCCHHHHHHHHHHHHHHcCCCEEEEECccccCCHHHHHHHHHHHHHHH
Confidence 356677889999999999988887665 599999999999999999999999999999999999999999999998
Q ss_pred -hCCCEEEEEecCChhHHHhhcCeEEEEeCCeEEEEeChhhHH
Q 009738 82 -LDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAV 123 (527)
Q Consensus 82 -~~~~tvi~~~H~~~~~i~~~~d~v~~l~~G~~~~~G~~~~~~ 123 (527)
++|+|||+++|++ +++.++|||+++|++|++++.|+++++.
T Consensus 191 ~~~g~tvi~vtHdl-~~~~~~~drv~~l~~G~i~~~g~~~~~~ 232 (275)
T 3gfo_A 191 KELGITIIIATHDI-DIVPLYCDNVFVMKEGRVILQGNPKEVF 232 (275)
T ss_dssp HHHCCEEEEEESCC-SSGGGGCSEEEEEETTEEEEEECHHHHT
T ss_pred hhCCCEEEEEecCH-HHHHHhCCEEEEEECCEEEEECCHHHHh
Confidence 5699999999997 4688899999999999999999998764
|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 527 | ||||
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 1e-13 | |
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 3e-11 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 3e-11 | |
| d1l2ta_ | 230 | c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann | 3e-10 | |
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 5e-10 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 9e-10 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 1e-09 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 3e-09 | |
| d1ji0a_ | 240 | c.37.1.12 (A:) Branched chain aminoacid ABC transp | 8e-09 | |
| d1l7vc_ | 231 | c.37.1.12 (C:) ABC transporter involved in vitamin | 2e-08 | |
| d3dhwc1 | 240 | c.37.1.12 (C:1-240) Methionine import ATP-binding | 2e-08 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 1e-07 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 2e-07 | |
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 2e-07 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 5e-07 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 9e-07 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 1e-05 | |
| d3d31a2 | 229 | c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor | 3e-05 | |
| d1oxxk2 | 242 | c.37.1.12 (K:1-242) Glucose transport protein GlcV | 1e-04 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 1e-04 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-04 | |
| d2onka1 | 240 | c.37.1.12 (A:1-240) Molybdate/tungstate import ATP | 0.003 |
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 69.2 bits (169), Expect = 1e-13
Identities = 19/114 (16%), Positives = 42/114 (36%), Gaps = 3/114 (2%)
Query: 4 DEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTS 63
+ + T +G + +S G++ R+S++ + + LLD P
Sbjct: 129 KSVVKACQLQQDITKFAEQDNTVLGEGGVT-LSGGQRARISLARAVYKDADLYLLDSPFG 187
Query: 64 GLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFG 117
LD + V + C + + + + D +L+L G + ++G
Sbjct: 188 YLDVFTEEQVFESCVCKLMANKTRILVTSKMEH--LRKADKILILHQGSSYFYG 239
|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 527 | |||
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.95 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.95 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.95 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.95 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.95 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 99.95 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.94 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.94 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.94 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.94 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.94 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.93 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 99.91 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.9 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.89 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.89 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.89 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.88 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 99.86 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 99.73 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.49 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.18 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 98.72 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 98.04 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.97 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 97.25 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 92.96 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 90.9 |
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Maltose transport protein MalK, N-terminal domain species: Archaeon Thermococcus litoralis [TaxId: 2265]
Probab=99.95 E-value=4.4e-28 Score=233.11 Aligned_cols=117 Identities=24% Similarity=0.367 Sum_probs=108.9
Q ss_pred CHHHHHHHHHHHHHHcCCcccccccccCcccCCCCHHHHHHHHHHHHHHhCCCEEEEeCCCCCCCHHHHHHHHHHHHHHH
Q 009738 2 TNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIA 81 (527)
Q Consensus 2 ~~~~~~~~v~~~l~~l~L~~~~~~~i~~~~~~~lSgGer~Rl~ia~~l~~~p~llllDEPtsgLD~~~~~~i~~~l~~l~ 81 (527)
++++.+++++++++.+||++.+|++. ++|||||||||+|||||+.+|++|||||||+|||+.++.++++.|+++.
T Consensus 112 ~~~e~~~~v~~~l~~~~l~~~~~~~p-----~~LSGGqkQRv~IAraL~~~P~iLllDEPt~~LD~~~~~~i~~~l~~l~ 186 (240)
T d1g2912 112 PRQEIDQRVREVAELLGLTELLNRKP-----RELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQ 186 (240)
T ss_dssp CHHHHHHHHHHHHHHHTCGGGTTCCG-----GGSCHHHHHHHHHHHHHHTCCSEEEEECTTTTSCHHHHHHHHHHHHHHH
T ss_pred CHHHHHHHHHHHHHHcCChhHhcCCh-----hhCCHHHHHHHHHHHHHhcCCCEEEecCCCcccCHHHHHHHHHHHHHHH
Confidence 57888999999999999998877665 4699999999999999999999999999999999999999999999998
Q ss_pred hC-CCEEEEEecCChhHHHhhcCeEEEEeCCeEEEEeChhhHHH
Q 009738 82 LD-GRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAVK 124 (527)
Q Consensus 82 ~~-~~tvi~~~H~~~~~i~~~~d~v~~l~~G~~~~~G~~~~~~~ 124 (527)
++ |.|+|+++|++ +++.++|||+++|++|++++.|+++++.+
T Consensus 187 ~~~g~tvi~vTHd~-~~~~~~~drv~vm~~G~iv~~G~~~el~~ 229 (240)
T d1g2912 187 RQLGVTTIYVTHDQ-VEAMTMGDRIAVMNRGVLQQVGSPDEVYD 229 (240)
T ss_dssp HHHTCEEEEEESCH-HHHHHHCSEEEEEETTEEEEEECHHHHHH
T ss_pred hccCCEEEEEcCCH-HHHHHhCCEEEEEECCEEEEEcCHHHHHh
Confidence 76 99999999995 68999999999999999999999998753
|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|