Citrus Sinensis ID: 009738


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------
MTNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLKSQAPTEIPMSSNSQMYLSTEEIKAKLVEEYRNSEISMDIRQRVRELAHNEQEETVLSKDRASWWKQLCILSHRSFLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFIEEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFCLSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFCILTCYKIVLFATLKYKDKASKLLHRLFARSIFRQTPQKDDVNNISVVP
ccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHcccEEEEccccEEEccccccHHHHHHHccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccc
ccHHHHHHHHHHHHHHHcccHccccEEcccccccccccHHHHHHHHHHHHcccccEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHEccccEEEEccHHHHHHHHHHccccccccccHHHHHHHHccccccccccccccccccccccHHcHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEcccccccccHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHcccccccccccc
MTNDEINDIVEETIIKMGLQACAetkignwhlrgissgekKRLSISIEIltqptvllldeptsgldsasAFFVIQVLKCIaldgrivvcsihqpsshlfyLFDDLlllsngetiyfgDAKMAVKFFAeagfpcpsrrnpsdhflrCINSdfdkvagsslksqapteipmssnsqmyLSTEEIKAKLVEEYRNSEISMDIRQRVRELAHNEQEETVLSKDRASWWKQLCILSHRSFLNMLRDMGYYWLRIVFYVLVSITVGILYLnvglsnpaiygrpkCVAFIYGFLICLsvgglpsfiEEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVqfhpgfshychFCLSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSpvfrgvsdlpkffwqypmSYITFAAWAIEGqfkndmiglefdpavpgdpklkgEEILLKLYGVQLNYCKWWDLAALFCILTCYKIVLFATLKYKDKASKLLHRLFARSIfrqtpqkddvnnisvvp
MTNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSslksqapteipmssnsqmylSTEEIKAKLVEEYRNSEISMDIRQRVRELAHNeqeetvlskdraswWKQLCILSHRSFLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFIEEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFCLSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFCILTCYKIVLFATLKYKDKASKLLHRLFARsifrqtpqkddvnnisvvp
MTNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHlfylfddllllSNGETIYFGDAKMAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLKSQAPTEIPMSSNSQMYLSTEEIKAKLVEEYRNSEISMDIRQRVRELAHNEQEETVLSKDRASWWKQLCILSHRSFLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFIEEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFCLSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFCILTCYKIVLFATLKYKDKASKLLHRLFARSIFRQTPQKDDVNNISVVP
******NDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAVKFFAEAGFPCPS*****DHFLRCINSDF****************************************************************LSKDRASWWKQLCILSHRSFLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFIEEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFCLSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFCILTCYKIVLFATLKYKDKASKLLHRLFARSIFR***************
*TNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDK****************************IKAKLV**********************************SWWKQLCILSHRSFLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFIEEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFCLSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFCILTCYKIVLFATLKYKDKASKLL*************************
MTNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLKSQAPTEIPMSSNSQMYLSTEEIKAKLVEEYRNSEISMDIRQRVRELAH**********DRASWWKQLCILSHRSFLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFIEEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFCLSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFCILTCYKIVLFATLKYKDKASKLLHRLFARSIFRQTPQKDDVNNISVVP
MTNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAVKFFAEAGFPCPSRRNPSDHFLRCINSDFD**A***LKSQAPTEIPMSSNSQMYLSTEEIKAKLVEEYRNSEISMDIRQRVRELAH*******LSKDRASWWKQLCILSHRSFLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFIEEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFCLSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFCILTCYKIVLFATLKYKDKASKLLHRLFARSI*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLKSQAPTEIPMSSNSQMYLSTEEIKAKLVEEYRNSEISMDIRQRVRELAHNEQEETVLSKDRASWWKQLCILSHRSFLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFIEEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFCLSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFCILTCYKIVLFATLKYKDKASKLLHRLFARSIFRQTPQKDDVNNISVVP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query527 2.2.26 [Sep-21-2011]
Q8RWI9691 ABC transporter G family yes no 0.981 0.748 0.544 1e-178
Q9C8K2687 ABC transporter G family no no 0.992 0.761 0.536 1e-169
Q9C8J8678 ABC transporter G family no no 0.998 0.775 0.480 1e-147
Q8RXN0703 ABC transporter G family no no 0.990 0.742 0.472 1e-139
Q9ZUU9730 ABC transporter G family no no 0.922 0.665 0.328 6e-72
Q9UNQ0655 ATP-binding cassette sub- yes no 0.912 0.734 0.287 1e-50
Q5MB13654 ATP-binding cassette sub- yes no 0.912 0.735 0.284 4e-50
Q11180598 ABC transporter ATP-bindi yes no 0.774 0.682 0.305 1e-48
Q9ZU35725 ABC transporter G family no no 0.783 0.569 0.283 1e-47
Q55DW4793 ABC transporter G family yes no 0.916 0.609 0.275 8e-47
>sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 Back     alignment and function desciption
 Score =  624 bits (1609), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 282/518 (54%), Positives = 390/518 (75%), Gaps = 1/518 (0%)

Query: 1   MTNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDE 60
           M+ +E++DIVE TI+++GLQ C++  IGNWH RG+S GE+KR+SI++EILT+P +L LDE
Sbjct: 135 MSKEEVSDIVEGTIMELGLQDCSDRVIGNWHARGVSGGERKRVSIALEILTRPQILFLDE 194

Query: 61  PTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAK 120
           PTSGLDSASAFFVIQ L+ IA DGR V+ S+HQPSS +F LFDDL LLS+GE++YFG+AK
Sbjct: 195 PTSGLDSASAFFVIQALRNIARDGRTVISSVHQPSSEVFALFDDLFLLSSGESVYFGEAK 254

Query: 121 MAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLKSQAPTEIPMSSNSQMYLSTE 180
            AV+FFAE+GFPCP +RNPSDHFLRCINSDFD V  +   SQ   E P +S+  M L+T 
Sbjct: 255 SAVEFFAESGFPCPKKRNPSDHFLRCINSDFDTVTATLKGSQRIQETPATSDPLMNLATS 314

Query: 181 EIKAKLVEEYRNSEISMDIRQRVRELAHNEQEETVLSK-DRASWWKQLCILSHRSFLNML 239
            IKA+LVE Y+ S+ +   + R+REL++ E  E  + K   A+WWKQL  L+ RSF+NM 
Sbjct: 315 VIKARLVENYKRSKYAKSAKSRIRELSNIEGLEMEIRKGSEATWWKQLRTLTARSFINMC 374

Query: 240 RDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFI 299
           RD+GYYW RI+ Y++VSI+VG ++ +VG S  +I  R  C  FI GF+  +S+GG PSF+
Sbjct: 375 RDVGYYWTRIISYIVVSISVGTIFYDVGYSYTSILARVSCGGFITGFMTFMSIGGFPSFL 434

Query: 300 EEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFC 359
           EE K  Y+ER+S +YG +V++LSN++SSFPFLV +S+ +GTI + +V+F PGFSHY  FC
Sbjct: 435 EEMKVFYKERLSGYYGVSVYILSNYISSFPFLVAISVITGTITYNLVKFRPGFSHYAFFC 494

Query: 360 LSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPM 419
           L++F  VS++E+ MMVVA +VPN LMG+  G  LI ++MM S  FR + DLPK FW+YP+
Sbjct: 495 LNIFFSVSVIESLMMVVASVVPNFLMGLITGAGLIGIIMMTSGFFRLLPDLPKIFWRYPV 554

Query: 420 SYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFC 479
           SYI++ +WAI+G +KND +GLEF+P  PG+PK+ GEE++ K++GV++ Y KWWDLAA+  
Sbjct: 555 SYISYGSWAIQGGYKNDFLGLEFEPLFPGEPKMTGEEVIEKVFGVKVTYSKWWDLAAVVA 614

Query: 480 ILTCYKIVLFATLKYKDKASKLLHRLFARSIFRQTPQK 517
           IL CY+++ F  LK +++A   L  + A+   R   ++
Sbjct: 615 ILVCYRLLFFVVLKLRERAGPALKAIQAKRTMRNLDRR 652





Arabidopsis thaliana (taxid: 3702)
>sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 Back     alignment and function description
>sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 Back     alignment and function description
>sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 Back     alignment and function description
>sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 Back     alignment and function description
>sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=1 SV=1 Back     alignment and function description
>sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query527
224139878 687 white-brown-complex ABC transporter fami 0.971 0.745 0.614 0.0
224139880607 white-brown-complex ABC transporter fami 0.973 0.845 0.594 0.0
224106203 707 white-brown-complex ABC transporter fami 0.979 0.729 0.566 0.0
255577264 697 ATP-binding cassette transporter, putati 0.981 0.741 0.565 1e-180
356570462 630 PREDICTED: ABC transporter G family memb 0.943 0.788 0.608 1e-180
297835074 691 abc transporter family protein [Arabidop 0.981 0.748 0.546 1e-176
255544918 707 ATP-binding cassette transporter, putati 0.979 0.729 0.558 1e-176
307136071 724 white-brown-complex ABC transporter fami 0.992 0.722 0.564 1e-176
20260310 691 unknown protein [Arabidopsis thaliana] g 0.981 0.748 0.546 1e-176
297734945622 unnamed protein product [Vitis vinifera] 1.0 0.847 0.577 1e-176
>gi|224139878|ref|XP_002323321.1| white-brown-complex ABC transporter family [Populus trichocarpa] gi|222867951|gb|EEF05082.1| white-brown-complex ABC transporter family [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/513 (61%), Positives = 412/513 (80%), Gaps = 1/513 (0%)

Query: 1   MTNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDE 60
           MT DEIN ++E TI+KMGLQ CA+ K+GNWHLRG+S GEK+RLSIS+EILTQP VL LDE
Sbjct: 139 MTKDEINSVIENTIMKMGLQDCADNKVGNWHLRGLSGGEKRRLSISLEILTQPYVLFLDE 198

Query: 61  PTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAK 120
           PTSGLDSASA FVI  LK IALDGRIVVCSIHQPSS++F LFDDL LLS+GETIYFG+AK
Sbjct: 199 PTSGLDSASALFVIHALKNIALDGRIVVCSIHQPSSYIFDLFDDLCLLSSGETIYFGEAK 258

Query: 121 MAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLKSQAPTEIPMSSNSQMYLSTE 180
           +AVKFFAEAGFPCP+RRNPSDHFLRCINSDFDK+A + L+S   + + + SN +   +TE
Sbjct: 259 LAVKFFAEAGFPCPTRRNPSDHFLRCINSDFDKMASTLLRSLRDSAVSVPSNFETSFTTE 318

Query: 181 EIKAKLVEEYRNSEISMDIRQRVRELAH-NEQEETVLSKDRASWWKQLCILSHRSFLNML 239
           +IKAKL+E+YR+SE S++ R ++R++A  NE+  + L + R +WWKQL  L+ RSF+NM+
Sbjct: 319 DIKAKLIEKYRSSEYSINTRTKIRQIALINEELMSGLIEIRINWWKQLYTLTIRSFVNMI 378

Query: 240 RDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFI 299
           RD+GY+W+R +FY+L+S+  GI+Y +VGLSN A   R KC  ++Y FLICLSVGGLPSF+
Sbjct: 379 RDLGYFWVRTLFYILISLGAGIMYFDVGLSNSAFVTRAKCYTYVYDFLICLSVGGLPSFL 438

Query: 300 EEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFC 359
           EE K SY E ++ HYGEAVF+LSNF +SF FLVI+S+SSGTI+ YMV+FH GFSHYC+ C
Sbjct: 439 EEWKVSYHELLNRHYGEAVFMLSNFFASFIFLVIMSLSSGTIVFYMVKFHLGFSHYCYLC 498

Query: 360 LSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPM 419
           ++ F C +I+E+  M+VALLVPN LMG+GV    ++ + M S ++R + DLPKFFW+YPM
Sbjct: 499 MNFFFCFAIMESVAMIVALLVPNFLMGIGVSAFAVMFLSMASGLYRPLPDLPKFFWRYPM 558

Query: 420 SYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFC 479
           +YI+F +WA++GQFKNDM+GLEF+P V G+PK++G++IL   +GV++NY KWWDLAAL  
Sbjct: 559 AYISFTSWAVQGQFKNDMLGLEFEPFVQGEPKIQGKQILHDFFGVRVNYSKWWDLAALLL 618

Query: 480 ILTCYKIVLFATLKYKDKASKLLHRLFARSIFR 512
           +L C+K++  + LKYK +   LL R  A+   +
Sbjct: 619 LLLCHKLLFLSILKYKQRLVLLLRRFCAKRTLK 651




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224139880|ref|XP_002323322.1| white-brown-complex ABC transporter family [Populus trichocarpa] gi|222867952|gb|EEF05083.1| white-brown-complex ABC transporter family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106203|ref|XP_002314084.1| white-brown-complex ABC transporter family [Populus trichocarpa] gi|222850492|gb|EEE88039.1| white-brown-complex ABC transporter family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255577264|ref|XP_002529514.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223531030|gb|EEF32883.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356570462|ref|XP_003553406.1| PREDICTED: ABC transporter G family member 15-like [Glycine max] Back     alignment and taxonomy information
>gi|297835074|ref|XP_002885419.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata] gi|297331259|gb|EFH61678.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255544918|ref|XP_002513520.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223547428|gb|EEF48923.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|307136071|gb|ADN33920.1| white-brown-complex ABC transporter family protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|20260310|gb|AAM13053.1| unknown protein [Arabidopsis thaliana] gi|23198394|gb|AAN15724.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297734945|emb|CBI17179.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query527
TAIR|locus:2092960691 ABCG15 "ATP-binding cassette G 0.981 0.748 0.528 1.9e-154
TAIR|locus:2033899687 ABCG12 "ATP-binding cassette G 0.992 0.761 0.520 3.3e-150
TAIR|locus:2033939678 ABCG13 "ATP-binding cassette G 0.998 0.775 0.463 4.8e-133
TAIR|locus:2030898703 ABCG11 "ATP-binding cassette G 0.984 0.738 0.462 4.2e-127
TAIR|locus:2046203730 ABCG3 "ATP-binding cassette G3 0.922 0.665 0.316 1.5e-65
CGD|CAL0002254579 orf19.3120 [Candida albicans ( 0.273 0.248 0.413 1e-45
UNIPROTKB|Q5A0X6579 CaO19.10632 "Putative uncharac 0.273 0.248 0.413 1e-45
UNIPROTKB|Q9UNQ0655 ABCG2 "ATP-binding cassette su 0.931 0.749 0.275 1.3e-45
DICTYBASE|DDB_G0269214793 abcG1 "ABC transporter G famil 0.280 0.186 0.44 2.3e-44
WB|WBGene00015479598 wht-1 [Caenorhabditis elegans 0.886 0.780 0.288 3.1e-44
TAIR|locus:2092960 ABCG15 "ATP-binding cassette G15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1506 (535.2 bits), Expect = 1.9e-154, P = 1.9e-154
 Identities = 274/518 (52%), Positives = 381/518 (73%)

Query:     1 MTNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDE 60
             M+ +E++DIVE TI+++GLQ C++  IGNWH RG+S GE+KR+SI++EILT+P +L LDE
Sbjct:   135 MSKEEVSDIVEGTIMELGLQDCSDRVIGNWHARGVSGGERKRVSIALEILTRPQILFLDE 194

Query:    61 PTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHXXXXXXXXXXXSNGETIYFGDAK 120
             PTSGLDSASAFFVIQ L+ IA DGR V+ S+HQPSS            S+GE++YFG+AK
Sbjct:   195 PTSGLDSASAFFVIQALRNIARDGRTVISSVHQPSSEVFALFDDLFLLSSGESVYFGEAK 254

Query:   121 MAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLKSQAPTEIPMSSNSQMYLSTE 180
              AV+FFAE+GFPCP +RNPSDHFLRCINSDFD V  +   SQ   E P +S+  M L+T 
Sbjct:   255 SAVEFFAESGFPCPKKRNPSDHFLRCINSDFDTVTATLKGSQRIQETPATSDPLMNLATS 314

Query:   181 EIKAKLVEEYRNSEISMDIRQRVRELAHNEQEETVLSK-DRASWWKQLCILSHRSFLNML 239
              IKA+LVE Y+ S+ +   + R+REL++ E  E  + K   A+WWKQL  L+ RSF+NM 
Sbjct:   315 VIKARLVENYKRSKYAKSAKSRIRELSNIEGLEMEIRKGSEATWWKQLRTLTARSFINMC 374

Query:   240 RDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLSVGGLPSFI 299
             RD+GYYW RI+ Y++VSI+VG ++ +VG S  +I  R  C  FI GF+  +S+GG PSF+
Sbjct:   375 RDVGYYWTRIISYIVVSISVGTIFYDVGYSYTSILARVSCGGFITGFMTFMSIGGFPSFL 434

Query:   300 EEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFC 359
             EE K  Y+ER+S +YG +V++LSN++SSFPFLV +S+ +GTI + +V+F PGFSHY  FC
Sbjct:   435 EEMKVFYKERLSGYYGVSVYILSNYISSFPFLVAISVITGTITYNLVKFRPGFSHYAFFC 494

Query:   360 LSLFCCVSIVETCMMVVALLVPNVLMGMGVGTALIVLMMMVSPVFRGVSDLPKFFWQYPM 419
             L++F  VS++E+ MMVVA +VPN LMG+  G  LI ++MM S  FR + DLPK FW+YP+
Sbjct:   495 LNIFFSVSVIESLMMVVASVVPNFLMGLITGAGLIGIIMMTSGFFRLLPDLPKIFWRYPV 554

Query:   420 SYITFAAWAIEGQFKNDMIGLEFDPAVPGDPKLKGEEILLKLYGVQLNYCKWWDLAALFC 479
             SYI++ +WAI+G +KND +GLEF+P  PG+PK+ GEE++ K++GV++ Y KWWDLAA+  
Sbjct:   555 SYISYGSWAIQGGYKNDFLGLEFEPLFPGEPKMTGEEVIEKVFGVKVTYSKWWDLAAVVA 614

Query:   480 ILTCYKIVLFATLKYKDKASKLLHRLFARSIFRQTPQK 517
             IL CY+++ F  LK +++A   L  + A+   R   ++
Sbjct:   615 ILVCYRLLFFVVLKLRERAGPALKAIQAKRTMRNLDRR 652




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0016020 "membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=ISS
GO:0080167 "response to karrikin" evidence=IEP
GO:0009062 "fatty acid catabolic process" evidence=RCA
TAIR|locus:2033899 ABCG12 "ATP-binding cassette G12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033939 ABCG13 "ATP-binding cassette G13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030898 ABCG11 "ATP-binding cassette G11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046203 ABCG3 "ATP-binding cassette G3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0002254 orf19.3120 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A0X6 CaO19.10632 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UNQ0 ABCG2 "ATP-binding cassette sub-family G member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269214 abcG1 "ABC transporter G family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00015479 wht-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RWI9AB15G_ARATHNo assigned EC number0.54440.98100.7481yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query527
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 2e-82
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 8e-48
TIGR009561394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 1e-42
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 3e-41
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 9e-41
cd03234226 cd03234, ABCG_White, White pigment protein homolog 8e-37
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 2e-33
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 1e-26
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 2e-25
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 4e-22
pfam01061210 pfam01061, ABC2_membrane, ABC-2 type transporter 1e-20
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 3e-20
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 5e-16
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 9e-16
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 3e-12
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 5e-12
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 1e-11
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 3e-11
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 3e-11
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 4e-11
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 6e-11
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 2e-10
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 3e-10
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 4e-10
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 2e-09
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 3e-09
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 3e-09
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 4e-09
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 4e-09
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 4e-09
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 4e-09
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 8e-09
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 1e-08
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 1e-08
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 2e-08
pfam00005119 pfam00005, ABC_tran, ABC transporter 2e-08
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 4e-08
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 6e-08
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 7e-08
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 9e-08
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 1e-07
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 1e-07
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 2e-07
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 2e-07
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 2e-07
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 3e-07
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 4e-07
COG1117253 COG1117, PstB, ABC-type phosphate transport system 4e-07
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 5e-07
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 6e-07
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 6e-07
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 8e-07
COG4598256 COG4598, HisP, ABC-type histidine transport system 8e-07
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 8e-07
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 9e-07
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 1e-06
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 1e-06
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 1e-06
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 1e-06
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 1e-06
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 1e-06
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 1e-06
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 2e-06
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 2e-06
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 2e-06
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 2e-06
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 2e-06
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 2e-06
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 2e-06
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 2e-06
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 2e-06
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 2e-06
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 3e-06
COG4988559 COG4988, CydD, ABC-type transport system involved 3e-06
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 3e-06
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 3e-06
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 3e-06
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 3e-06
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 4e-06
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 4e-06
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 4e-06
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 4e-06
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 5e-06
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 5e-06
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 5e-06
COG4148352 COG4148, ModC, ABC-type molybdate transport system 6e-06
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 7e-06
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 7e-06
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 7e-06
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 8e-06
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 8e-06
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 8e-06
COG4987573 COG4987, CydC, ABC-type transport system involved 8e-06
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 9e-06
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 9e-06
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 9e-06
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 1e-05
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 1e-05
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 1e-05
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 1e-05
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 1e-05
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-05
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 2e-05
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-05
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 2e-05
COG4133209 COG4133, CcmA, ABC-type transport system involved 2e-05
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 2e-05
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 2e-05
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 2e-05
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 2e-05
COG1123539 COG1123, COG1123, ATPase components of various ABC 2e-05
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 2e-05
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 3e-05
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 3e-05
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 3e-05
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 3e-05
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 3e-05
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 3e-05
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 3e-05
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 4e-05
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 4e-05
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 4e-05
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 4e-05
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 5e-05
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 5e-05
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 6e-05
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 6e-05
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 6e-05
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 7e-05
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 7e-05
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 7e-05
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 7e-05
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 7e-05
COG0488530 COG0488, Uup, ATPase components of ABC transporter 8e-05
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 8e-05
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 8e-05
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 9e-05
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 9e-05
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 1e-04
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 1e-04
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-04
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-b 2e-04
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 2e-04
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 2e-04
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 2e-04
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 2e-04
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 2e-04
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 2e-04
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 2e-04
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 2e-04
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 2e-04
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 3e-04
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 3e-04
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 3e-04
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 3e-04
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 3e-04
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 3e-04
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 3e-04
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 3e-04
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 3e-04
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 3e-04
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 3e-04
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 4e-04
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 4e-04
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 4e-04
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 4e-04
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 4e-04
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 4e-04
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 5e-04
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 5e-04
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 5e-04
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 5e-04
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 5e-04
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 5e-04
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 6e-04
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 6e-04
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 6e-04
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 7e-04
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 7e-04
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 7e-04
COG5265497 COG5265, ATM1, ABC-type transport system involved 7e-04
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 7e-04
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 8e-04
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 8e-04
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 8e-04
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 8e-04
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 9e-04
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 9e-04
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 0.001
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 0.001
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 0.001
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 0.001
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 0.001
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 0.001
PRK00635 1809 PRK00635, PRK00635, excinuclease ABC subunit A; Pr 0.001
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 0.001
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 0.001
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 0.001
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 0.001
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 0.001
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 0.001
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 0.001
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 0.001
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 0.002
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 0.002
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 0.002
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 0.002
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 0.002
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 0.002
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 0.002
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 0.002
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 0.002
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 0.002
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 0.003
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 0.003
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 0.003
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 0.003
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 0.003
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 0.003
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 0.003
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 0.004
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 0.004
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 0.004
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 0.004
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 0.004
COG4525259 COG4525, TauB, ABC-type taurine transport system, 0.004
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 0.004
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
 Score =  268 bits (686), Expect = 2e-82
 Identities = 146/529 (27%), Positives = 244/529 (46%), Gaps = 72/529 (13%)

Query: 1   MTNDEINDIVEETIIKMGLQACAETKIGN-WHLRGISSGEKKRLSISIEILTQPTVLLLD 59
           +T  E  + V+E +  +GL+ CA T+IG    ++G+S GE+KRL+ + E+LT P +L  D
Sbjct: 132 VTKKEKRERVDEVLQALGLRKCANTRIGVPGRVKGLSGGERKRLAFASELLTDPPLLFCD 191

Query: 60  EPTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDA 119
           EPTSGLDS  A+ V+QVLK +A  G+ ++C+IHQPSS LF LFD ++L++ G   Y G  
Sbjct: 192 EPTSGLDSFMAYSVVQVLKGLAQKGKTIICTIHQPSSELFELFDKIILMAEGRVAYLGSP 251

Query: 120 KMAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLKSQAPTEIPMSSNSQMYLST 179
             AV FF++ G PCP   NP+D +++ +                   IP S N     S 
Sbjct: 252 DQAVPFFSDLGHPCPENYNPADFYVQVL-----------------AVIPGSENE----SR 290

Query: 180 EEIKAKLVEEYRNSEISMDIRQRVRELAHNEQ------EETVLSKDRASWWKQLCILSHR 233
           E I+ K+ + +  S+I  D+       +          E        ASWW Q   L  R
Sbjct: 291 ERIE-KICDSFAVSDIGRDMLVNTNLWSGKAGGLVKDSENMEGIGYNASWWTQFYALLKR 349

Query: 234 SFLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYG-------- 285
           S+L++LRD     +R++  ++ +I +G++YL  GL+        K V  I G        
Sbjct: 350 SWLSVLRDPLLLKVRLIQTMMTAILIGLIYLGQGLT-------QKGVQNINGALFLFLTN 402

Query: 286 --FLICLSV-----GGLPSFIEEHKASYRERISCHYGEAVFVLSNFLSSFPFLVILSISS 338
             F     V       LP F+ E   S   R+S ++      L+  ++  P  +IL    
Sbjct: 403 MTFQNVFPVINVFTAELPVFLRET-RSGLYRVSAYF------LAKTIAELPLFIILPALF 455

Query: 339 GTILHYMVQFHPGFSHYCHFCLSLFCC--VSIVET-CMMVVALLVPNVLMGMGVGTALIV 395
            +I ++M+    G +   HF   LF    V+ V T    +++    +  M + VG   ++
Sbjct: 456 TSITYWMIGLRSGAT---HFLTFLFLVTLVANVATSFGYLISCAFSSTSMALTVGPPFVI 512

Query: 396 LMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEG----QFKNDMIGLEFDPAVPGDPK 451
             ++    F     +P +F    +SY+++  +  EG    Q+ +            G   
Sbjct: 513 PFLLFGGFFINSDSIPVYFKW--LSYLSWFRYGNEGLLINQWSDVDNIECTSANTTGPCP 570

Query: 452 LKGEEILLKLYGVQLNYCKWWDLAALFCILTCYKIVLFATLKYKDKASK 500
             GE IL  L     +   + DL  L  ++  ++++ +  L+ + +  +
Sbjct: 571 SSGEVILETLSFRNADL--YLDLIGLVILIFFFRLLAYFALRIRIRRKR 617


[Transport and binding proteins, Other]. Length = 617

>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234806 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 527
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
KOG0061613 consensus Transporter, ABC superfamily (Breast can 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
PLN031401470 ABC transporter G family member; Provisional 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
TIGR009561394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.94
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.94
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.93
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.93
COG1127263 Ttg2A ABC-type transport system involved in resist 99.92
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.92
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.92
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.92
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.91
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.9
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.9
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.9
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.9
PRK13537306 nodulation ABC transporter NodI; Provisional 99.9
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.9
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.9
COG1123539 ATPase components of various ABC-type transport sy 99.9
COG0411250 LivG ABC-type branched-chain amino acid transport 99.89
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.89
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.89
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.89
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.89
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.88
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.88
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.88
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.88
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.88
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.88
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.88
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.88
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.88
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.88
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.88
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.88
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.88
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.88
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.88
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.88
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.88
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.87
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.87
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.87
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.87
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.87
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.87
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.87
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.87
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.87
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.87
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.87
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.87
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.87
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.87
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.87
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.87
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.87
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.87
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.87
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.87
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.87
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.87
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.87
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.87
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.87
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.87
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.87
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.86
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.86
COG1123539 ATPase components of various ABC-type transport sy 99.86
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.86
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.86
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.86
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.86
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.86
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.86
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.86
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.86
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.86
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.86
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.86
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.86
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.86
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.86
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.86
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.86
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.86
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.86
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.86
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.86
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.86
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.86
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.86
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.86
COG4172534 ABC-type uncharacterized transport system, duplica 99.86
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.86
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.86
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.86
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.86
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.86
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.85
COG4152300 ABC-type uncharacterized transport system, ATPase 99.85
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.85
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.85
PRK09984262 phosphonate/organophosphate ester transporter subu 99.85
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.85
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.85
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.85
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.85
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.85
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.85
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.85
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.85
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.85
cd03234226 ABCG_White The White subfamily represents ABC tran 99.85
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.85
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.85
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.85
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.85
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.85
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.85
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.85
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.85
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.85
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.85
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.85
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.85
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.85
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.84
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.84
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.84
PRK10908222 cell division protein FtsE; Provisional 99.84
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.84
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK13545549 tagH teichoic acids export protein ATP-binding sub 99.84
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.84
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.84
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.84
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.84
PF01061210 ABC2_membrane: ABC-2 type transporter; InterPro: I 99.84
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.84
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.84
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.84
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.84
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.84
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.84
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.84
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.84
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.84
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.84
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.84
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.84
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.84
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.84
PRK10938490 putative molybdenum transport ATP-binding protein 99.84
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.84
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.84
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.84
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.84
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.83
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.83
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.83
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.83
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.83
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.83
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.83
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.83
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.83
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.83
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.83
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.83
COG4172534 ABC-type uncharacterized transport system, duplica 99.83
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.83
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.83
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.83
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.83
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.83
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.83
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.82
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.82
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.82
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.82
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.82
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.82
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.82
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.82
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.82
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.82
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.81
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.81
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.81
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.81
COG4559259 ABC-type hemin transport system, ATPase component 99.81
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.81
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.81
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.81
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.81
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.81
COG4586325 ABC-type uncharacterized transport system, ATPase 99.8
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.8
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.8
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.8
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.8
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.8
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.8
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.8
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.8
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.8
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.8
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.8
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.79
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.79
COG4987573 CydC ABC-type transport system involved in cytochr 99.79
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.79
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.79
COG4181228 Predicted ABC-type transport system involved in ly 99.78
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.78
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.78
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.78
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.78
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.78
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.78
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.78
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.78
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.78
COG0410237 LivF ABC-type branched-chain amino acid transport 99.78
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.78
PRK10938490 putative molybdenum transport ATP-binding protein 99.77
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.77
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.77
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.77
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.77
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.77
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.77
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.77
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.77
COG4988559 CydD ABC-type transport system involved in cytochr 99.77
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.77
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.77
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.77
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.77
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.76
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.76
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.76
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.76
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.76
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.76
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.76
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.76
cd03246173 ABCC_Protease_Secretion This family represents the 99.76
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.76
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.76
PRK10535648 macrolide transporter ATP-binding /permease protei 99.76
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.76
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.75
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.75
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.75
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.75
PRK13409590 putative ATPase RIL; Provisional 99.75
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.75
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.75
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.75
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.75
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.75
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.75
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.74
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.74
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.74
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.74
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.74
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.74
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.74
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.73
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.73
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.73
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.73
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.73
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.73
PRK13409590 putative ATPase RIL; Provisional 99.73
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.72
PRK11147635 ABC transporter ATPase component; Reviewed 99.72
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.72
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.72
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.72
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.72
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.71
PLN03073718 ABC transporter F family; Provisional 99.71
PLN03073718 ABC transporter F family; Provisional 99.71
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.71
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.71
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.71
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.7
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.7
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.7
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.7
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.69
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.69
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.69
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.69
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.69
PLN032321495 ABC transporter C family member; Provisional 99.68
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.68
PLN031301622 ABC transporter C family member; Provisional 99.68
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.67
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.67
PLN03232 1495 ABC transporter C family member; Provisional 99.67
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.67
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.66
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.65
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.65
PTZ002431560 ABC transporter; Provisional 99.65
PRK11147635 ABC transporter ATPase component; Reviewed 99.65
PLN03130 1622 ABC transporter C family member; Provisional 99.65
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.64
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.64
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.64
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.64
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.63
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.63
COG0488530 Uup ATPase components of ABC transporters with dup 99.63
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.63
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.62
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.6
COG4619223 ABC-type uncharacterized transport system, ATPase 99.59
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.59
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.59
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.59
PTZ00243 1560 ABC transporter; Provisional 99.59
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.58
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.58
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.58
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.58
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.56
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.54
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.54
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.51
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.5
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.49
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.48
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.46
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.44
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.43
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.41
COG0488530 Uup ATPase components of ABC transporters with dup 99.41
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.39
COG4133209 CcmA ABC-type transport system involved in cytochr 99.39
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.34
KOG00541381 consensus Multidrug resistance-associated protein/ 99.34
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.34
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.33
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.31
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.3
TIGR01247236 drrB daunorubicin resistance ABC transporter membr 99.3
COG4136213 ABC-type uncharacterized transport system, ATPase 99.29
TIGR00634563 recN DNA repair protein RecN. All proteins in this 99.29
KOG0062582 consensus ATPase component of ABC transporters wit 99.29
KOG0062582 consensus ATPase component of ABC transporters wit 99.28
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 99.26
PRK10869553 recombination and repair protein; Provisional 99.24
PHA02562562 46 endonuclease subunit; Provisional 99.22
TIGR01291253 nodJ ABC-2 type transporter, NodJ family. Nearly a 99.22
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.21
TIGR03062208 pip_yhgE_Cterm YhgE/Pip C-terminal domain. This fa 99.16
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.14
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.14
COG4178604 ABC-type uncharacterized transport system, permeas 99.13
TIGR00025232 Mtu_efflux ABC transporter efflux protein, DrrB fa 99.1
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.09
TIGR03861253 phenyl_ABC_PedC alcohol ABC transporter, permease 99.08
PRK102461047 exonuclease subunit SbcC; Provisional 99.05
PRK03918880 chromosome segregation protein; Provisional 99.04
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.03
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.03
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 98.96
PRK01156895 chromosome segregation protein; Provisional 98.94
PRK15066257 inner membrane transport permease; Provisional 98.94
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 98.85
TIGR006061311 rad50 rad50. This family is based on the phylogeno 98.84
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 98.81
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 98.81
PRK00064361 recF recombination protein F; Reviewed 98.81
KOG2355291 consensus Predicted ABC-type transport, ATPase com 98.8
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 98.78
PRK02224880 chromosome segregation protein; Provisional 98.72
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 98.72
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 98.63
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 98.57
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 98.56
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 98.55
TIGR00611365 recf recF protein. All proteins in this family for 98.55
PRK14079349 recF recombination protein F; Provisional 98.53
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 98.48
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 98.45
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.43
COG0842286 ABC-type multidrug transport system, permease comp 98.39
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 98.36
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 98.34
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 98.32
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 98.28
TIGR026801353 conserved hypothetical protein TIGR02680. Members 98.27
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 98.23
PRK00409782 recombination and DNA strand exchange inhibitor pr 98.23
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 98.14
PF1355890 SbcCD_C: Putative exonuclease SbcCD, C subunit; PD 98.12
PRK13695174 putative NTPase; Provisional 98.01
PF06422103 PDR_CDR: CDR ABC transporter; InterPro: IPR010929 98.01
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 98.0
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.95
TIGR01248152 drrC daunorubicin resistance protein C. The model 97.94
TIGR03518240 ABC_perm_GldF gliding motility-associated ABC tran 97.89
PF12679277 ABC2_membrane_2: ABC-2 family transporter protein 97.83
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.81
PRK13830818 conjugal transfer protein TrbE; Provisional 97.73
COG1682263 TagG ABC-type polysaccharide/polyol phosphate expo 97.67
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 97.53
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 97.52
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.47
PRK06067234 flagellar accessory protein FlaH; Validated 97.37
cd01128249 rho_factor Transcription termination factor rho is 97.27
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 97.27
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.16
PRK15176264 Vi polysaccharide export inner membrane protein Ve 97.13
COG3910233 Predicted ATPase [General function prediction only 97.1
PF13175415 AAA_15: AAA ATPase domain 97.07
PF12698344 ABC2_membrane_3: ABC-2 family transporter protein; 96.96
PF0837065 PDR_assoc: Plant PDR ABC transporter associated; I 96.9
PRK13891852 conjugal transfer protein TrbE; Provisional 96.87
COG4637373 Predicted ATPase [General function prediction only 96.85
PF03379215 CcmB: CcmB protein; InterPro: IPR003544 Within mit 96.71
KOG09641200 consensus Structural maintenance of chromosome pro 96.56
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 96.3
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 96.26
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 96.2
PF13166712 AAA_13: AAA domain 96.14
COG1277278 NosY ABC-type transport system involved in multi-c 96.05
PRK13873811 conjugal transfer ATPase TrbE; Provisional 96.01
PRK07721438 fliI flagellum-specific ATP synthase; Validated 95.56
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.47
COG11961163 Smc Chromosome segregation ATPases [Cell division 95.05
PRK13898800 type IV secretion system ATPase VirB4; Provisional 94.87
TIGR00152188 dephospho-CoA kinase. This model produces scores i 94.81
PRK05399854 DNA mismatch repair protein MutS; Provisional 94.79
TIGR01190211 ccmB heme exporter protein CcmB. This model descri 94.43
KOG09621294 consensus DNA repair protein RAD50, ABC-type ATPas 94.43
PRK14088440 dnaA chromosomal replication initiation protein; P 94.37
KOG09961293 consensus Structural maintenance of chromosome pro 94.31
PRK06793432 fliI flagellum-specific ATP synthase; Validated 94.29
PF12051382 DUF3533: Protein of unknown function (DUF3533); In 94.17
COG4587268 ABC-type uncharacterized transport system, permeas 94.09
COG1511780 Predicted membrane protein [Function unknown] 93.76
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 93.52
COG1195363 RecF Recombinational DNA repair ATPase (RecF pathw 93.27
PRK08699325 DNA polymerase III subunit delta'; Validated 93.14
KOG09331174 consensus Structural maintenance of chromosome pro 92.68
COG4694758 Uncharacterized protein conserved in bacteria [Fun 92.59
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
Probab=100.00  E-value=1.5e-81  Score=696.29  Aligned_cols=471  Identities=27%  Similarity=0.506  Sum_probs=412.4

Q ss_pred             CHHHHHHHHHHHHHHcCCcccccccccCc-ccCCCCHHHHHHHHHHHHHHhCCCEEEEeCCCCCCCHHHHHHHHHHHHHH
Q 009738            2 TNDEINDIVEETIIKMGLQACAETKIGNW-HLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCI   80 (527)
Q Consensus         2 ~~~~~~~~v~~~l~~l~L~~~~~~~i~~~-~~~~lSgGer~Rl~ia~~l~~~p~llllDEPtsgLD~~~~~~i~~~l~~l   80 (527)
                      ++++++++++++++.+||.+++|+++|+. ..++||||||||++||++|+.+|++++|||||+|||+.++.++++.|+++
T Consensus       133 ~~~~~~~~v~~~l~~lgL~~~~~t~vg~~~~~~~LSgGqrkRvsia~aL~~~p~vlllDEPtsgLD~~~~~~l~~~L~~l  212 (617)
T TIGR00955       133 TKKEKRERVDEVLQALGLRKCANTRIGVPGRVKGLSGGERKRLAFASELLTDPPLLFCDEPTSGLDSFMAYSVVQVLKGL  212 (617)
T ss_pred             CHHHHHHHHHHHHHHcCchhcCcCccCCCCCCCCcCcchhhHHHHHHHHHcCCCEEEeeCCCcchhHHHHHHHHHHHHHH
Confidence            34667788999999999999999999985 36899999999999999999999999999999999999999999999999


Q ss_pred             HhCCCEEEEEecCChhHHHhhcCeEEEEeCCeEEEEeChhhHHHHHhhcCCCCCCCCCchHHHHHhhccCcccccccccc
Q 009738           81 ALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDKVAGSSLK  160 (527)
Q Consensus        81 ~~~~~tvi~~~H~~~~~i~~~~d~v~~l~~G~~~~~G~~~~~~~~f~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (527)
                      +++|+|+|+++|||+.+++++||++++|++|+++|.|+++++.+||++.|++||++.||+|+++++++.+.+.       
T Consensus       213 ~~~g~tvi~~~hq~~~~i~~~~D~i~ll~~G~~v~~G~~~~~~~~f~~~g~~~p~~~n~ad~~~~~~~~~~~~-------  285 (617)
T TIGR00955       213 AQKGKTIICTIHQPSSELFELFDKIILMAEGRVAYLGSPDQAVPFFSDLGHPCPENYNPADFYVQVLAVIPGS-------  285 (617)
T ss_pred             HhCCCEEEEEeCCCCHHHHHHhceEEEeeCCeEEEECCHHHHHHHHHHcCCCCCCCCChHHHHHHHhhcCccc-------
Confidence            9889999999999988999999999999999999999999999999999999999999999999987643210       


Q ss_pred             CCCCCCCCCCCCccccccHHHHHHHHHHHHhcchhhHHHHHHHHHhhccC-----ccc-cccCCCCCCHHHHHHHHHHHH
Q 009738          161 SQAPTEIPMSSNSQMYLSTEEIKAKLVEEYRNSEISMDIRQRVRELAHNE-----QEE-TVLSKDRASWWKQLCILSHRS  234 (527)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~-----~~~-~~~~~~~~s~~~Q~~~L~~R~  234 (527)
                           +          ....+..+++.+.|+.++..++..+........+     ... .....+..+|++|+.+|++|+
T Consensus       286 -----~----------~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~l~~R~  350 (617)
T TIGR00955       286 -----E----------NESRERIEKICDSFAVSDIGRDMLVNTNLWSGKAGGLVKDSENMEGIGYNASWWTQFYALLKRS  350 (617)
T ss_pred             -----c----------cchHHHHHHHHHHHhcchhhHHHHHHhhhhhccccccccccccccccccCCCHHHHHHHHHHHH
Confidence                 0          0012234556777777766555444332211110     001 112345789999999999999


Q ss_pred             HHHHHhChHHHHHHHHHHHHHHHHHHHHhccCCCChhhhhhhhHHHHHHHHHHHHHH-hhhHHHHHHHHHHHHHhhcCCC
Q 009738          235 FLNMLRDMGYYWLRIVFYVLVSITVGILYLNVGLSNPAIYGRPKCVAFIYGFLICLS-VGGLPSFIEEHKASYRERISCH  313 (527)
Q Consensus       235 ~~~~~Rd~~~~~~r~~~~~~~~li~G~lf~~l~~~~~~i~~r~~~l~f~~~~~~~~~-~~~~~~f~~er~v~~rE~~~g~  313 (527)
                      +++.+|||.++..|+++.+++|+++|++|++++++++++++|.|++|++.+++.+.+ ...++.|+.||++|+||+.+|+
T Consensus       351 ~~~~~R~~~~~~~~~~~~i~~~li~G~~f~~~~~~~~~~~~~~g~lf~~~~~~~f~~~~~~~~~f~~er~v~~rE~~~~~  430 (617)
T TIGR00955       351 WLSVLRDPLLLKVRLIQTMMTAILIGLIYLGQGLTQKGVQNINGALFLFLTNMTFQNVFPVINVFTAELPVFLRETRSGL  430 (617)
T ss_pred             HHHHhcCHHHHHHHHHHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCc
Confidence            999999999999999999999999999999999999999999999999888877765 4668899999999999999999


Q ss_pred             CChhHHHHHHHHHHHHHHHHHHhhhhhhhhccccccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhhHHHHHHHHHH
Q 009738          314 YGEAVFVLSNFLSSFPFLVILSISSGTILHYMVQFHPGFSHYCHFCLSLFCCVSIVETCMMVVALLVPNVLMGMGVGTAL  393 (527)
Q Consensus       314 Y~~~~y~la~~l~~lP~~~~~~~if~~i~Y~m~gl~~~~~~f~~f~l~~~~~~~~~~~~~~~v~~~~~~~~~a~~~~~~~  393 (527)
                      |++++|++|++++|+|+.++.+++|.+|+|||+|+++++.+|++|++++++..+++.++++++++++|+..+|+.+++++
T Consensus       431 Y~~~~y~la~~l~~lp~~~~~~~if~~i~Y~~~gl~~~~~~f~~f~l~~~l~~~~~~s~~~~i~~~~~~~~~a~~~~~~~  510 (617)
T TIGR00955       431 YRVSAYFLAKTIAELPLFIILPALFTSITYWMIGLRSGATHFLTFLFLVTLVANVATSFGYLISCAFSSTSMALTVGPPF  510 (617)
T ss_pred             cCHHHHHHHHHHHHHHHHHHHHHHHHhhhheeccCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhccccCCCCCCcccccccccccCHHHHHHHHHHHhhhcCCcc-CCCC---CCCCCCcHHHHHHHhhCCcCcch
Q 009738          394 IVLMMMVSPVFRGVSDLPKFFWQYPMSYITFAAWAIEGQFKNDMIGLEF-DPAV---PGDPKLKGEEILLKLYGVQLNYC  469 (527)
Q Consensus       394 ~~~~~lf~Gf~i~~~~ip~~~w~w~~~yiSp~~Y~~~~l~~nef~g~~~-~~~~---~~~~~~~G~~~L~~~~~~~~~~~  469 (527)
                      +.++++|+||+++.++||.| |+| ++|+||++|++||++.|||.|.++ +|..   .+.|..+|+++|+. +|++.+ +
T Consensus       511 ~~~~~lf~G~~i~~~~ip~~-~~W-~~~isp~~ya~~al~~nef~~~~~~~c~~~~~~~~c~~~g~~~l~~-~g~~~~-~  586 (617)
T TIGR00955       511 VIPFLLFGGFFINSDSIPVY-FKW-LSYLSWFRYGNEGLLINQWSDVDNIECTSANTTGPCPSSGEVILET-LSFRNA-D  586 (617)
T ss_pred             HHHHHHHhhcccChhhccHH-HHH-HHHcCHHHHHHHHHHHHHhCCCccccccCcCcCCCCCcChHHHHHh-cCCCcc-c
Confidence            99999999999999999985 899 999999999999999999999775 4432   12244689999985 788754 4


Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHhhcch
Q 009738          470 KWWDLAALFCILTCYKIVLFATLKYKDKA  498 (527)
Q Consensus       470 ~w~~~~iL~~~~v~f~~~~~~~L~~~~~~  498 (527)
                      .|.|+++|++++++|++++|++|+++.+.
T Consensus       587 ~~~~~~il~~~~~~~~~l~~~~L~~~~~~  615 (617)
T TIGR00955       587 LYLDLIGLVILIFFFRLLAYFALRIRIRR  615 (617)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            79999999999999999999999987653



>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF01061 ABC2_membrane: ABC-2 type transporter; InterPro: IPR013525 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>TIGR01247 drrB daunorubicin resistance ABC transporter membrane protein Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR01291 nodJ ABC-2 type transporter, NodJ family Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03062 pip_yhgE_Cterm YhgE/Pip C-terminal domain Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>TIGR00025 Mtu_efflux ABC transporter efflux protein, DrrB family Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>TIGR03861 phenyl_ABC_PedC alcohol ABC transporter, permease protein Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK15066 inner membrane transport permease; Provisional Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG0842 ABC-type multidrug transport system, permease component [Defense mechanisms] Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PF06422 PDR_CDR: CDR ABC transporter; InterPro: IPR010929 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>TIGR01248 drrC daunorubicin resistance protein C Back     alignment and domain information
>TIGR03518 ABC_perm_GldF gliding motility-associated ABC transporter permease protein GldF Back     alignment and domain information
>PF12679 ABC2_membrane_2: ABC-2 family transporter protein Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>COG1682 TagG ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK15176 Vi polysaccharide export inner membrane protein VexB; Provisional Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF13175 AAA_15: AAA ATPase domain Back     alignment and domain information
>PF12698 ABC2_membrane_3: ABC-2 family transporter protein; PDB: 2P0S_B 3CNI_A Back     alignment and domain information
>PF08370 PDR_assoc: Plant PDR ABC transporter associated; InterPro: IPR013581 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK13891 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>COG4637 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF03379 CcmB: CcmB protein; InterPro: IPR003544 Within mitochondria and bacteria, a family of related proteins is involved in the assembly of periplasmic c-type cytochromes: these include CycK [], CcmF [,], NrfE [] and CcbS [] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>COG1277 NosY ABC-type transport system involved in multi-copper enzyme maturation, permease component [General function prediction only] Back     alignment and domain information
>PRK13873 conjugal transfer ATPase TrbE; Provisional Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13898 type IV secretion system ATPase VirB4; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>TIGR01190 ccmB heme exporter protein CcmB Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF12051 DUF3533: Protein of unknown function (DUF3533); InterPro: IPR022703 This transmembrane domain is functionally uncharacterised Back     alignment and domain information
>COG4587 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG1511 Predicted membrane protein [Function unknown] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4694 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query527
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 3e-06
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 4e-06
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 8e-06
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 2e-05
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 3e-05
2ihy_A279 Structure Of The Staphylococcus Aureus Putative Atp 3e-05
3g5u_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 3e-05
3g60_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 3e-05
4f4c_A1321 The Crystal Structure Of The Multi-Drug Transporter 4e-05
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 6e-05
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 9e-05
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 9e-05
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 1e-04
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 1e-04
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 1e-04
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 2e-04
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 7e-04
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 8e-04
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 8e-04
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 8e-04
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 8e-04
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/62 (38%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Query: 35 ISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIALDGRIVVCSIHQP 94 +S G+K+R++I+ +L P +LLLDE TS LD+ + + V + L + +DGR V+ H+ Sbjct: 484 LSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRL-MDGRTVLVIAHRL 542 Query: 95 SS 96 S+ Sbjct: 543 ST 544
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query527
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 9e-13
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 1e-12
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 5e-11
1sgw_A214 Putative ABC transporter; structural genomics, P p 3e-10
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 1e-08
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 6e-06
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 3e-08
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 5e-08
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 2e-07
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 6e-07
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 3e-07
2ghi_A260 Transport protein; multidrug resistance protein, M 4e-07
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 6e-07
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 8e-07
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-05
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 1e-06
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-06
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 3e-06
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 2e-06
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 4e-06
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 5e-06
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 2e-05
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-05
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 5e-05
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 3e-05
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 2e-04
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 2e-04
1g6h_A257 High-affinity branched-chain amino acid transport 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 3e-04
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 3e-04
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 6e-04
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
 Score = 67.2 bits (165), Expect = 9e-13
 Identities = 30/114 (26%), Positives = 59/114 (51%), Gaps = 8/114 (7%)

Query: 8   DIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDS 67
            +  + +  + L   A+ +  +     +S G+++ + I+  I ++  ++LLDEPTS LD 
Sbjct: 107 QVAMQALDYLNLTHLAKREFTS-----LSGGQRQLILIARAIASECKLILLDEPTSALDL 161

Query: 68  ASAFFVIQVLKCIALD-GRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAK 120
           A+   V+ +L  +A      VV + HQP + +  + +  LLL N +   FG+ +
Sbjct: 162 ANQDIVLSLLIDLAQSQNMTVVFTTHQP-NQVVAIANKTLLL-NKQNFKFGETR 213


>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query527
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.93
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.92
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.92
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.92
1g6h_A257 High-affinity branched-chain amino acid transport 99.92
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 99.91
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.91
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.91
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.91
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.91
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.91
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 99.91
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.91
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 99.9
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 99.9
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 99.9
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.9
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 99.9
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.9
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 99.9
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.9
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.9
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.9
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.89
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.89
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.89
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.87
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.87
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.87
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.86
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.86
2ghi_A260 Transport protein; multidrug resistance protein, M 99.86
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 99.84
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.83
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.83
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.82
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.82
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.82
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.82
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.81
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.81
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.81
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.81
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.8
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.8
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.79
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.79
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.79
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.78
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.78
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.78
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.78
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.78
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.77
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.77
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.77
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.75
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.75
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.75
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.74
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.74
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.74
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.73
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.72
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.72
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.72
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.71
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.7
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.7
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.65
3kta_B173 Chromosome segregation protein SMC; structural mai 99.54
1e69_A322 Chromosome segregation SMC protein; structural mai 99.53
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.53
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.53
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.52
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.43
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.42
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.39
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.34
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.32
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.13
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.12
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.95
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 98.92
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 98.89
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 98.63
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.62
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.62
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 98.61
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.56
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 98.51
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 98.51
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.43
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.37
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 98.3
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 98.28
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 98.16
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.15
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.12
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.11
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.1
2og2_A359 Putative signal recognition particle receptor; nuc 98.08
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 98.02
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.01
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 97.98
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.91
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.9
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.9
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.76
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.72
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.72
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.61
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 97.36
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.35
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.13
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.12
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 97.09
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.97
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.89
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 96.82
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 96.39
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 96.26
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 96.15
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.12
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.11
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.95
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 95.79
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 95.65
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 95.59
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 95.57
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.56
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 95.49
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 94.37
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 94.16
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 94.15
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 93.76
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 92.93
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 92.91
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 92.57
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 92.44
1vma_A306 Cell division protein FTSY; TM0570, structural gen 91.57
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 91.38
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.14
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 89.86
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 89.46
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 89.31
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 88.55
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 88.17
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 87.93
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 83.79
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 83.25
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 83.01
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 82.97
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 81.91
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
Probab=99.93  E-value=2.9e-25  Score=221.40  Aligned_cols=116  Identities=26%  Similarity=0.448  Sum_probs=106.5

Q ss_pred             CHHHHHHHHHHHHHHcCCcccccccccCcccCCCCHHHHHHHHHHHHHHhCCCEEEEeCCCCCCCHHHHHHHHHHHHHHH
Q 009738            2 TNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIA   81 (527)
Q Consensus         2 ~~~~~~~~v~~~l~~l~L~~~~~~~i~~~~~~~lSgGer~Rl~ia~~l~~~p~llllDEPtsgLD~~~~~~i~~~l~~l~   81 (527)
                      ++++.+++++++++.+||++.++++++     +|||||||||+||++|+.+|++|||||||+|||+.++..+++.|++++
T Consensus       116 ~~~~~~~~~~~~l~~~~L~~~~~~~~~-----~LSgGqkQRv~iAraL~~~P~lLlLDEPts~LD~~~~~~i~~~l~~l~  190 (275)
T 3gfo_A          116 PEDEIRKRVDNALKRTGIEHLKDKPTH-----CLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQ  190 (275)
T ss_dssp             CHHHHHHHHHHHHHHTTCGGGTTSBGG-----GSCHHHHHHHHHHHHHTTCCSEEEEECTTTTCCHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHcCCchhhcCCcc-----cCCHHHHHHHHHHHHHHcCCCEEEEECccccCCHHHHHHHHHHHHHHH
Confidence            356677889999999999988887665     599999999999999999999999999999999999999999999998


Q ss_pred             -hCCCEEEEEecCChhHHHhhcCeEEEEeCCeEEEEeChhhHH
Q 009738           82 -LDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAV  123 (527)
Q Consensus        82 -~~~~tvi~~~H~~~~~i~~~~d~v~~l~~G~~~~~G~~~~~~  123 (527)
                       ++|+|||+++|++ +++.++|||+++|++|++++.|+++++.
T Consensus       191 ~~~g~tvi~vtHdl-~~~~~~~drv~~l~~G~i~~~g~~~~~~  232 (275)
T 3gfo_A          191 KELGITIIIATHDI-DIVPLYCDNVFVMKEGRVILQGNPKEVF  232 (275)
T ss_dssp             HHHCCEEEEEESCC-SSGGGGCSEEEEEETTEEEEEECHHHHT
T ss_pred             hhCCCEEEEEecCH-HHHHHhCCEEEEEECCEEEEECCHHHHh
Confidence             5699999999997 4688899999999999999999998764



>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 527
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 1e-13
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 3e-11
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 3e-11
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 3e-10
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 5e-10
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 9e-10
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 1e-09
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 3e-09
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 8e-09
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 2e-08
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 2e-08
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 1e-07
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 2e-07
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 2e-07
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 5e-07
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 9e-07
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-05
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 3e-05
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 1e-04
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 1e-04
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 2e-04
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 0.003
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 69.2 bits (169), Expect = 1e-13
 Identities = 19/114 (16%), Positives = 42/114 (36%), Gaps = 3/114 (2%)

Query: 4   DEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTS 63
             +    +             T +G   +  +S G++ R+S++  +     + LLD P  
Sbjct: 129 KSVVKACQLQQDITKFAEQDNTVLGEGGVT-LSGGQRARISLARAVYKDADLYLLDSPFG 187

Query: 64  GLDSASAFFVIQVLKCIALDGRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFG 117
            LD  +   V +   C  +  +  +    +         D +L+L  G + ++G
Sbjct: 188 YLDVFTEEQVFESCVCKLMANKTRILVTSKMEH--LRKADKILILHQGSSYFYG 239


>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query527
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.95
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.95
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.95
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.95
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.95
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.95
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.94
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.94
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.94
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.94
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.94
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.93
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.91
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.9
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.89
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.89
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.89
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.88
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.86
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.73
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.49
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.18
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.72
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.04
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.97
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 97.25
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 92.96
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 90.9
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Archaeon Thermococcus litoralis [TaxId: 2265]
Probab=99.95  E-value=4.4e-28  Score=233.11  Aligned_cols=117  Identities=24%  Similarity=0.367  Sum_probs=108.9

Q ss_pred             CHHHHHHHHHHHHHHcCCcccccccccCcccCCCCHHHHHHHHHHHHHHhCCCEEEEeCCCCCCCHHHHHHHHHHHHHHH
Q 009738            2 TNDEINDIVEETIIKMGLQACAETKIGNWHLRGISSGEKKRLSISIEILTQPTVLLLDEPTSGLDSASAFFVIQVLKCIA   81 (527)
Q Consensus         2 ~~~~~~~~v~~~l~~l~L~~~~~~~i~~~~~~~lSgGer~Rl~ia~~l~~~p~llllDEPtsgLD~~~~~~i~~~l~~l~   81 (527)
                      ++++.+++++++++.+||++.+|++.     ++|||||||||+|||||+.+|++|||||||+|||+.++.++++.|+++.
T Consensus       112 ~~~e~~~~v~~~l~~~~l~~~~~~~p-----~~LSGGqkQRv~IAraL~~~P~iLllDEPt~~LD~~~~~~i~~~l~~l~  186 (240)
T d1g2912         112 PRQEIDQRVREVAELLGLTELLNRKP-----RELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQ  186 (240)
T ss_dssp             CHHHHHHHHHHHHHHHTCGGGTTCCG-----GGSCHHHHHHHHHHHHHHTCCSEEEEECTTTTSCHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHcCChhHhcCCh-----hhCCHHHHHHHHHHHHHhcCCCEEEecCCCcccCHHHHHHHHHHHHHHH
Confidence            57888999999999999998877665     4699999999999999999999999999999999999999999999998


Q ss_pred             hC-CCEEEEEecCChhHHHhhcCeEEEEeCCeEEEEeChhhHHH
Q 009738           82 LD-GRIVVCSIHQPSSHLFYLFDDLLLLSNGETIYFGDAKMAVK  124 (527)
Q Consensus        82 ~~-~~tvi~~~H~~~~~i~~~~d~v~~l~~G~~~~~G~~~~~~~  124 (527)
                      ++ |.|+|+++|++ +++.++|||+++|++|++++.|+++++.+
T Consensus       187 ~~~g~tvi~vTHd~-~~~~~~~drv~vm~~G~iv~~G~~~el~~  229 (240)
T d1g2912         187 RQLGVTTIYVTHDQ-VEAMTMGDRIAVMNRGVLQQVGSPDEVYD  229 (240)
T ss_dssp             HHHTCEEEEEESCH-HHHHHHCSEEEEEETTEEEEEECHHHHHH
T ss_pred             hccCCEEEEEcCCH-HHHHHhCCEEEEEECCEEEEEcCHHHHHh
Confidence            76 99999999995 68999999999999999999999998753



>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure