Citrus Sinensis ID: 009749
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 527 | 2.2.26 [Sep-21-2011] | |||||||
| Q08E13 | 810 | RING finger protein 10 OS | yes | no | 0.444 | 0.288 | 0.317 | 1e-29 | |
| Q3UIW5 | 804 | RING finger protein 10 OS | yes | no | 0.368 | 0.241 | 0.359 | 2e-29 | |
| Q32NQ8 | 756 | RING finger protein 10 OS | N/A | no | 0.320 | 0.223 | 0.382 | 3e-29 | |
| Q5XI59 | 802 | RING finger protein 10 OS | yes | no | 0.368 | 0.241 | 0.349 | 9e-29 | |
| Q8N5U6 | 811 | RING finger protein 10 OS | yes | no | 0.445 | 0.289 | 0.312 | 2e-28 | |
| O94271 | 673 | Uncharacterized RING fing | yes | no | 0.273 | 0.213 | 0.323 | 7e-18 | |
| Q06436 | 670 | RING-finger protein MAG2 | yes | no | 0.328 | 0.258 | 0.290 | 9e-12 | |
| Q6CHI1 | 344 | Postreplication repair E3 | no | no | 0.144 | 0.220 | 0.282 | 0.0002 | |
| P40072 | 274 | E3 ubiquitin-protein liga | no | no | 0.108 | 0.208 | 0.366 | 0.0004 | |
| Q14527 | 1009 | Helicase-like transcripti | no | no | 0.079 | 0.041 | 0.395 | 0.0006 |
| >sp|Q08E13|RNF10_BOVIN RING finger protein 10 OS=Bos taurus GN=RNF10 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 131 bits (330), Expect = 1e-29, Method: Compositional matrix adjust.
Identities = 86/271 (31%), Positives = 133/271 (49%), Gaps = 37/271 (13%)
Query: 28 QTISGNHLLNFQYDPISRPQYRMPPPPA----RRQRKIRPYNKDLFLQANYKFVVLDTGD 83
+ I+ NHLLNF ++P + + R + +P+NK+LFLQAN +FVV + D
Sbjct: 136 KKINLNHLLNFTFEPRGQAGHFEGSGHGSWGKRNKWGHKPFNKELFLQANCQFVVSEDQD 195
Query: 84 HAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLM 143
+ DPD ++ W+ + VR + CPICL P +IT CGHIFC+ CIL YL +
Sbjct: 196 YTVHFADPDTLVNWDFVEQVRICSHEVPSCPICLYPPTAAKITRCGHIFCWACILHYLSL 255
Query: 144 GDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHAVGDTIEFMLLIREKDSFVPSRKN 203
++ + +CP+C+ + K+L ++ RQ+ VGDTI L+ REK V K+
Sbjct: 256 SEKTW-----SKCPICYSSVHKKDLKSVVATESRQYVVGDTITMQLMKREKGVLVALPKS 310
Query: 204 KQESTTGSI---DETYDPFSKFTFTSDVDL---SVRKAMSDLDGWLA------------- 244
K + I DE + +SK S + V++ + L+ LA
Sbjct: 311 KWMNVDHPIHLGDEQHSQYSKLLLASKEQVLRRVVQEEKAALERQLAEEKHTPESCFIEA 370
Query: 245 ---------KADSGLVDDLEKLPYVCAAMEQ 266
+A SGL + ++P V AA+EQ
Sbjct: 371 AIQELKAREEALSGLAESRGEVPGVVAALEQ 401
|
Bos taurus (taxid: 9913) |
| >sp|Q3UIW5|RNF10_MOUSE RING finger protein 10 OS=Mus musculus GN=Rnf10 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q32NQ8|RNF10_XENLA RING finger protein 10 OS=Xenopus laevis GN=rnf10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5XI59|RNF10_RAT RING finger protein 10 OS=Rattus norvegicus GN=Rnf10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8N5U6|RNF10_HUMAN RING finger protein 10 OS=Homo sapiens GN=RNF10 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O94271|YORN_SCHPO Uncharacterized RING finger protein P8B7.23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.23 PE=4 SV=1 | Back alignment and function description |
|---|
| >sp|Q06436|MAG2_YEAST RING-finger protein MAG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAG2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6CHI1|RAD18_YARLI Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD18 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P40072|SLX8_YEAST E3 ubiquitin-protein ligase complex SLX5-SLX8 subunit SLX8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLX8 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 527 | ||||||
| 356571636 | 747 | PREDICTED: RING finger protein 10-like [ | 0.834 | 0.589 | 0.588 | 1e-162 | |
| 224128814 | 622 | predicted protein [Populus trichocarpa] | 0.825 | 0.699 | 0.612 | 1e-162 | |
| 359488431 | 765 | PREDICTED: RING finger protein 10-like [ | 0.850 | 0.585 | 0.591 | 1e-161 | |
| 357508423 | 744 | RING finger protein [Medicago truncatula | 0.853 | 0.604 | 0.586 | 1e-159 | |
| 255543557 | 746 | conserved hypothetical protein [Ricinus | 0.829 | 0.585 | 0.588 | 1e-158 | |
| 297814906 | 760 | hypothetical protein ARALYDRAFT_484446 [ | 0.836 | 0.580 | 0.570 | 1e-155 | |
| 356560432 | 838 | PREDICTED: RING finger protein 10-like [ | 0.831 | 0.522 | 0.580 | 1e-155 | |
| 22331355 | 772 | RING/U-box domain-containing protein [Ar | 0.853 | 0.582 | 0.563 | 1e-155 | |
| 449492935 | 654 | PREDICTED: RING finger protein 10-like [ | 0.827 | 0.666 | 0.559 | 1e-144 | |
| 449455928 | 742 | PREDICTED: RING finger protein 10-like [ | 0.825 | 0.586 | 0.550 | 1e-143 |
| >gi|356571636|ref|XP_003553982.1| PREDICTED: RING finger protein 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 579 bits (1493), Expect = e-162, Method: Compositional matrix adjust.
Identities = 297/505 (58%), Positives = 359/505 (71%), Gaps = 65/505 (12%)
Query: 9 RSQQRAGPVASQGSS---GRRAQTISGNHLLNFQYDPISRPQYRMPPP--PARRQRKIRP 63
R+QQ G V+S GS+ GR+AQT++GN+LLNFQYDPISR Q R PPP RR RK +P
Sbjct: 115 RNQQTPGSVSSHGSAPLPGRKAQTVNGNYLLNFQYDPISRSQPRGPPPSPTTRRHRKRKP 174
Query: 64 YNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYPLCP 123
Y+KDLFLQANYKF VL +G+++PESMDPDKMLQWEDIICV Y P SVQCPICLEYPLCP
Sbjct: 175 YSKDLFLQANYKFTVLGSGNYSPESMDPDKMLQWEDIICVTYLTPFSVQCPICLEYPLCP 234
Query: 124 QITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHAVGD 183
QITSCGHIFCFPCILQYLLMG+ED+KGD +KRCPLCFVMIS+K+LYT+HI NV+Q+ V D
Sbjct: 235 QITSCGHIFCFPCILQYLLMGEEDHKGDSWKRCPLCFVMISAKDLYTVHITNVKQYQVRD 294
Query: 184 TIEFMLLIREKDSFVPSRKNKQES--TTGSIDETYDPFSKFTFTSDVDLSVRKAMSDLDG 241
EF L R+KDSF S KNKQE+ T+ + ++ DPFSKFT TSDVDLSVR A+SDLDG
Sbjct: 295 NAEFTFLTRKKDSFTLSLKNKQETNITSRANEDICDPFSKFTLTSDVDLSVRHAISDLDG 354
Query: 242 WLAKADSGLVDDLEKLPYVCAAMEQLEQRKKYWNERRASGSDKASNNADGQTGFHGLQST 301
WLA+ADSGLVDDLEKLPYVCAAM+QLEQRK+YW+E R+ S+K+S D + H +
Sbjct: 355 WLARADSGLVDDLEKLPYVCAAMQQLEQRKRYWSELRSHDSEKSSKLNDYE---HQI--- 408
Query: 302 KIASNPSHLLNTLSPDISEQNQKLTKLTLNKPDSGSASGQNSALGELSDCDETSLSSSYD 361
PS + N++ D D ++G TS S D
Sbjct: 409 -----PSTVANSVDSD----------------DENCSNG-----------SRTSSSDFLD 436
Query: 362 ESKSMQANETS----LSSSYDESKSLQANETSLSSSYDESKSMQANETSLSSSYDESKSL 417
++K M ++++ L D K L E +LSSSY+E +Q + + +
Sbjct: 437 QNKVMMLDKSTAGICLDQKLDVEKELIEQEMNLSSSYEEKNDIQRHSSGVVG-------- 488
Query: 418 QANFTGSTEIKDKDSYNFYQAIDGQHLILHPLNLKCLLHHYGSYDMLPHRISGRILQLES 477
++K+ DSY+FYQA DGQHLILHPLN+KCLLHHYGSYDMLPHRISGRILQLES
Sbjct: 489 --------DVKENDSYSFYQAADGQHLILHPLNMKCLLHHYGSYDMLPHRISGRILQLES 540
Query: 478 VTQSEAMRRRYRYLSHFSLTTTFQM 502
VTQSEA+RRRYR+LSHF LTTTFQ+
Sbjct: 541 VTQSEAIRRRYRFLSHFPLTTTFQL 565
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224128814|ref|XP_002320428.1| predicted protein [Populus trichocarpa] gi|222861201|gb|EEE98743.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359488431|ref|XP_002275712.2| PREDICTED: RING finger protein 10-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357508423|ref|XP_003624500.1| RING finger protein [Medicago truncatula] gi|355499515|gb|AES80718.1| RING finger protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255543557|ref|XP_002512841.1| conserved hypothetical protein [Ricinus communis] gi|223547852|gb|EEF49344.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297814906|ref|XP_002875336.1| hypothetical protein ARALYDRAFT_484446 [Arabidopsis lyrata subsp. lyrata] gi|297321174|gb|EFH51595.1| hypothetical protein ARALYDRAFT_484446 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356560432|ref|XP_003548496.1| PREDICTED: RING finger protein 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|22331355|ref|NP_189307.2| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|11994306|dbj|BAB01736.1| unnamed protein product [Arabidopsis thaliana] gi|18377743|gb|AAL67021.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|27754738|gb|AAO22812.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|332643684|gb|AEE77205.1| RING/U-box domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449492935|ref|XP_004159146.1| PREDICTED: RING finger protein 10-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449455928|ref|XP_004145702.1| PREDICTED: RING finger protein 10-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 527 | ||||||
| TAIR|locus:2090827 | 772 | AT3G26730 "AT3G26730" [Arabido | 0.688 | 0.470 | 0.592 | 4.9e-142 | |
| UNIPROTKB|Q32NQ8 | 756 | rnf10 "RING finger protein 10" | 0.351 | 0.244 | 0.382 | 4e-44 | |
| MGI|MGI:1859162 | 804 | Rnf10 "ring finger protein 10" | 0.392 | 0.257 | 0.355 | 2.7e-43 | |
| UNIPROTKB|Q08E13 | 810 | RNF10 "RING finger protein 10" | 0.470 | 0.306 | 0.317 | 4.7e-43 | |
| RGD|1309282 | 802 | Rnf10 "ring finger protein 10" | 0.392 | 0.258 | 0.346 | 1.5e-42 | |
| UNIPROTKB|Q5XI59 | 802 | Rnf10 "RING finger protein 10" | 0.392 | 0.258 | 0.346 | 1.5e-42 | |
| UNIPROTKB|Q8N5U6 | 811 | RNF10 "RING finger protein 10" | 0.470 | 0.305 | 0.309 | 4.5e-42 | |
| UNIPROTKB|J9PBL6 | 749 | RNF10 "Uncharacterized protein | 0.392 | 0.276 | 0.342 | 6.7e-42 | |
| UNIPROTKB|E2RE56 | 961 | RNF10 "Uncharacterized protein | 0.392 | 0.215 | 0.342 | 1.8e-41 | |
| ZFIN|ZDB-GENE-030131-2969 | 778 | rnf10 "ring finger protein 10" | 0.468 | 0.317 | 0.330 | 4.2e-39 |
| TAIR|locus:2090827 AT3G26730 "AT3G26730" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1082 (385.9 bits), Expect = 4.9e-142, Sum P(2) = 4.9e-142
Identities = 224/378 (59%), Positives = 271/378 (71%)
Query: 2 SGDSVSPRSQQRAGPVASQGSSGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQR-K 60
SG SPR G V+ +GRRA ISGNHLLNFQYDPIS+PQ R PPPP RRQ+ K
Sbjct: 138 SGPFNSPR-----GGVSHHNPTGRRANMISGNHLLNFQYDPISQPQSRGPPPPQRRQQYK 192
Query: 61 IRPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYP 120
RP+NKDLFL+ANYKFVVLDTGDH+P+SMDPDKMLQW+DIICVRYS P VQCPICLEYP
Sbjct: 193 GRPFNKDLFLKANYKFVVLDTGDHSPDSMDPDKMLQWDDIICVRYSTPSPVQCPICLEYP 252
Query: 121 LCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHA 180
LCPQITSCGHIFCFPCILQYLL G +++K DCFKRCPLCFVMIS +ELYT++IENV+Q++
Sbjct: 253 LCPQITSCGHIFCFPCILQYLLTGVDNHKVDCFKRCPLCFVMISPRELYTVYIENVKQYS 312
Query: 181 VGDTIEFMLLIREKDSFVPSRKNKQE-STTGSIDETYDPFSKFTFTSDVDLSVRKAMSDL 239
VGD IEF+LL R+KDSF P+RKN+ + + +E YDPFSKFTFT DVDLSVR+A+S+L
Sbjct: 313 VGDPIEFVLLTRKKDSFAPTRKNEHDLAVPNGENEIYDPFSKFTFTQDVDLSVRQAVSEL 372
Query: 240 DGWLAKADSGLVDDLEKLPYVCAAMEQLEQRKKYWNERRASGSDKASNNADGQTGFHGLQ 299
D W+A+AD LV+DLEK YV AA+E+LEQRK YWNE + S K A QT
Sbjct: 373 DSWIARADPQLVEDLEKHLYVNAALERLEQRKLYWNEHKLSIYSKVCTTARNQTQSLSPP 432
Query: 300 STKIASNPSHLLNTLSPDISEQNQ-KLTK-LTLNKPDSGSAS----GQNSALGE-LSDCD 352
+ + +PD +Q K T+ + +K D S S G ++ LG L D D
Sbjct: 433 DVSRVGYQAPMGGHGAPDSGSNDQDKSTEDSSADKSDGESQSSLEKGCDNDLGHPLEDQD 492
Query: 353 ETSLSSSYDESKSMQANE 370
S SSS + SK +++
Sbjct: 493 APS-SSSCNGSKGFLSHQ 509
|
|
| UNIPROTKB|Q32NQ8 rnf10 "RING finger protein 10" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1859162 Rnf10 "ring finger protein 10" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q08E13 RNF10 "RING finger protein 10" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1309282 Rnf10 "ring finger protein 10" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5XI59 Rnf10 "RING finger protein 10" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8N5U6 RNF10 "RING finger protein 10" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9PBL6 RNF10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RE56 RNF10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-2969 rnf10 "ring finger protein 10" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.3.2 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 527 | |||
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 5e-11 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 7e-11 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 5e-10 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 8e-09 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 9e-08 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 4e-06 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 2e-04 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 6e-04 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 7e-04 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 0.002 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
Score = 57.5 bits (139), Expect = 5e-11
Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 9/49 (18%)
Query: 112 QCPICLEYPLCP-QITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLC 159
+CPICLE P + CGH+FC CI ++L G CPLC
Sbjct: 1 ECPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGK--------NTCPLC 41
|
Length = 45 |
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 527 | |||
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.26 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.24 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 99.1 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.05 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.01 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.92 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.87 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.74 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.73 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.71 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.69 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.68 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.65 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.64 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.63 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.61 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.59 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.54 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.5 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.45 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.38 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.36 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.33 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.32 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.15 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.11 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.05 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.95 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.91 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.9 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 97.78 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.73 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.72 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.69 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.68 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.53 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.46 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.33 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 97.28 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.07 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.06 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.97 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 96.78 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.71 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.64 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 96.62 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.59 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.58 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.54 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 96.5 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.34 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 96.26 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.23 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 96.22 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.22 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.18 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.15 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.13 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 96.13 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 95.81 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 95.55 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 95.47 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 95.22 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.46 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 94.16 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 94.14 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 94.12 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.08 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 94.01 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 93.63 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 93.43 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 93.26 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.11 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 92.69 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 92.65 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 92.62 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 92.61 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 92.27 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 92.21 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 92.21 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 91.25 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 89.98 | |
| PHA03096 | 284 | p28-like protein; Provisional | 89.96 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 89.67 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.25 | |
| KOG1815 | 444 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.64 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 87.77 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 87.55 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 87.53 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 87.23 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 87.14 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 86.61 | |
| KOG3579 | 352 | consensus Predicted E3 ubiquitin ligase [Posttrans | 86.6 | |
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 86.39 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 84.05 | |
| PF10377 | 129 | ATG11: Autophagy-related protein 11; InterPro: IPR | 83.38 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.24 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 81.69 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 80.4 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 80.23 |
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-52 Score=439.52 Aligned_cols=144 Identities=45% Similarity=0.760 Sum_probs=120.7
Q ss_pred CCCccccCCcccccCcccCCCCCCCCCCCCCCcCCCCCCCCCCccccccccceEeecCCCCCCCCCCCccccCcchhhhh
Q 009749 23 SGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQRKIRPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIIC 102 (527)
Q Consensus 23 ~grk~q~~s~nHLLnF~~~~~~~~~~~~~~~~~r~~~~~~~~~ke~flqaN~rFvV~~~~dy~~~~~dpd~~v~w~~I~~ 102 (527)
.|+++|+ |+||||||+|.+++ +..+...+ +++.+..+.+.+ +|++|||+|||+ .|+|..+..|||.+++|++|.+
T Consensus 106 ~~~a~~v-s~nhllnf~~~~~~-~~~q~~~p-~~~~~~~~~~~q-~f~~any~fvv~-~gd~~~qn~dpD~p~~~e~i~q 180 (513)
T KOG2164|consen 106 VNLANQV-SLNHLLNFQYAPIE-NSHQSSSP-PRRNRRRDEREQ-TFLNANYRFVVD-EGDYVLQNTDPDAPVDWEDIFQ 180 (513)
T ss_pred hhhhhhh-hhhhhhheeecccc-hhhccCCC-ccccccccccch-hhhccchheeec-ccchhhhccCCccccchHHhhh
Confidence 3678876 99999999999987 44433332 232222222222 999999999999 9999999999999999999999
Q ss_pred hhcCCCCcccccccCcCCCCceEcCCCCcccHHHHHHHHHcCCCCCCCCCcCCCCCCcccccCCCceeEEeeccc
Q 009749 103 VRYSNPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVR 177 (527)
Q Consensus 103 v~~~~~e~~~CPICle~~~~P~it~CGHiFC~~CI~~~l~~~~~~~k~~~~~~CPlCr~~i~~~~L~~v~~~~~~ 177 (527)
+.+.+ ...|||||+++..|++|.|||+||++||++||..+. ..++..||+|+..|..++|++|.+++.+
T Consensus 181 v~~~t--~~~CPICL~~~~~p~~t~CGHiFC~~CiLqy~~~s~----~~~~~~CPiC~s~I~~kdl~pv~~e~~q 249 (513)
T KOG2164|consen 181 VYGST--DMQCPICLEPPSVPVRTNCGHIFCGPCILQYWNYSA----IKGPCSCPICRSTITLKDLLPVFIEDDQ 249 (513)
T ss_pred hhcCc--CCcCCcccCCCCcccccccCceeeHHHHHHHHhhhc----ccCCccCCchhhhccccceeeeeecccc
Confidence 87766 899999999999999999999999999999999872 2368999999999999999999988753
|
|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10377 ATG11: Autophagy-related protein 11; InterPro: IPR019460 This family consists of proteins involved in telomere maintenance | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 527 | ||||
| 2ysj_A | 63 | Solution Structure Of The Ring Domain (1-56) From T | 7e-04 | ||
| 2ysl_A | 73 | Solution Structure Of The Ring Domain (1-66) From T | 8e-04 | ||
| 1jm7_A | 112 | Solution Structure Of The Brca1/bard1 Ring-domain H | 8e-04 |
| >pdb|2YSJ|A Chain A, Solution Structure Of The Ring Domain (1-56) From Tripartite Motif-containing Protein 31 Length = 63 | Back alignment and structure |
|
| >pdb|2YSL|A Chain A, Solution Structure Of The Ring Domain (1-66) From Tripartite Motif-containing Protein 31 Length = 73 | Back alignment and structure |
| >pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
Score = 60.2 bits (146), Expect = 7e-12
Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 9/48 (18%)
Query: 112 QCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLC 159
+C ICL+ + P C H+FC+ C+ KRC LC
Sbjct: 17 ECAICLQTCVHPVSLPCKHVFCYLCVKGAS---------WLGKRCALC 55
|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 527 | |||
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.24 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.22 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.22 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.2 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.2 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.18 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.17 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.16 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.15 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.14 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.14 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.13 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.13 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.12 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.12 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.11 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.11 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.1 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.1 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.09 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.09 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.09 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.08 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.08 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.04 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.03 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.03 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.01 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.01 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.0 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.0 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.0 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.99 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.98 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.97 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.97 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.96 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.94 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.94 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.94 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.94 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.93 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.92 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.9 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.9 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.89 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.88 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.88 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.87 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.85 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.84 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.82 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.79 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.75 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.7 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.69 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.67 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.64 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.62 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.6 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.52 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.49 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.44 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.41 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.24 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.22 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.13 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.71 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.66 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.38 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.25 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 94.92 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 94.65 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 91.52 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 89.45 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 85.21 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 83.07 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 80.09 |
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
Probab=99.24 E-value=5.4e-12 Score=102.51 Aligned_cols=56 Identities=30% Similarity=0.437 Sum_probs=48.9
Q ss_pred CCCcccccccCcCCCCceEcCCCCcccHHHHHHHHHcCCCCCCCCCcCCCCCCcccccCCCcee
Q 009749 107 NPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYT 170 (527)
Q Consensus 107 ~~e~~~CPICle~~~~P~it~CGHiFC~~CI~~~l~~~~~~~k~~~~~~CPlCr~~i~~~~L~~ 170 (527)
.++.+.||||++.+.+|++++|||+||..||.+|+..+ ...||+|+..+...++.+
T Consensus 5 ~~~~~~C~IC~~~~~~Pv~~~CgH~fc~~Ci~~~~~~~--------~~~CP~C~~~~~~~~l~~ 60 (78)
T 1t1h_A 5 FPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAG--------HKTCPKSQETLLHAGLTP 60 (78)
T ss_dssp CSSSSSCTTTSCCCSSEEEETTTEEEEHHHHHHHHTTT--------CCBCTTTCCBCSSCCCEE
T ss_pred CcccCCCCCccccccCCEEcCCCCeecHHHHHHHHHHC--------cCCCCCCcCCCChhhCcc
Confidence 34678999999999999999999999999999999742 378999999998777655
|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 527 | ||||
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 1e-11 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 1e-10 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 2e-09 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 2e-08 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 3e-08 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 1e-07 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 6e-07 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 2e-06 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 2e-06 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 5e-06 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 3e-05 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 3e-05 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 3e-05 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 4e-04 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 8e-04 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 0.002 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Score = 58.5 bits (141), Expect = 1e-11
Identities = 15/60 (25%), Positives = 21/60 (35%), Gaps = 8/60 (13%)
Query: 113 CPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIH 172
C IC E +I CGH+ C C+ + + CP C I E +
Sbjct: 26 CKICAENDKDVKIEPCGHLMCTSCLTSWQESEG--------QGCPFCRCEIKGTEPIVVD 77
|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 527 | |||
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.32 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.27 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.23 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.22 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.21 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.18 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.1 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.01 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.99 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.93 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.91 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.91 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.82 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.56 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.46 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.15 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 92.86 |
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.32 E-value=3.6e-13 Score=110.96 Aligned_cols=54 Identities=35% Similarity=0.637 Sum_probs=47.5
Q ss_pred CcccccccCcCCCCceEcCCCCcccHHHHHHHHHcCCCCCCCCCcCCCCCCcccccCCCcee
Q 009749 109 LSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYT 170 (527)
Q Consensus 109 e~~~CPICle~~~~P~it~CGHiFC~~CI~~~l~~~~~~~k~~~~~~CPlCr~~i~~~~L~~ 170 (527)
+.+.||||++.+.+|++++|||+||+.||.+|++... .+||+||.++...++.+
T Consensus 22 ~~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~--------~~CP~Cr~p~~~~~l~~ 75 (86)
T d1rmda2 22 KSISCQICEHILADPVETSCKHLFCRICILRCLKVMG--------SYCPSCRYPCFPTDLES 75 (86)
T ss_dssp HHTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTC--------SBCTTTCCBCCGGGCBC
T ss_pred cCcCCccCCcchhcceecCCCChhhHHHHHHHHhhCC--------CcCcccCCCCChhhccC
Confidence 3578999999999999999999999999999997532 68999999998877653
|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|