Citrus Sinensis ID: 009799

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-----
MADEAKAKGNAAFSSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKKTVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKKGLDIDPNNEALKSGLADAKAAASASFRSRSPPADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMKDIQRNPNNLNLYLKDQRVMQALGVLLNVKFKGPTGGDDVEMQDEDAPKGPETSKEETRKPESEPEPEPMELTEEEKEAKERKEKALKEKEAGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKALTEHRNPDTLKKLNEAEKAKKELEQQEIFDPKIADEEREKGNEFFKQQKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKALETYQEGLKHDPQNQELLDGVRRCVQQINKAGRGELSPEELKERQVSLF
cHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccHHHHccccHHHHHHHccHHHHHHccHHHHHHHHHHHHHccHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHccccccccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccc
cHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHccccccHHHHHHHHHccHHHHHHHccHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHccccccccccccHHHHccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHc
MADEAKAKgnaafssgDYEAAVRHFTEAislspdnhvlysnrsaAHASLHNYADALADAKKtvelkpdwskgysrlgaAHLGLQDYIEAVNSYKkgldidpnneaLKSGLADAKAAAsasfrsrsppadnpfgsafagpeMWAKLtadpttrsyldqddfRNMMKDIQrnpnnlnlylKDQRVMQALGVLLNvkfkgptggddvemqdedapkgpetskeetrkpesepepepmeltEEEKEAKERKEKALKEKEAGNAAYKKKEFEKAIEHYSSalelddediSYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKALtehrnpdtLKKLNEAEKAKKELEQqeifdpkiaDEEREKGneffkqqkyPEAIQHYTESlrrnpkdprtysnrAACYTKlgampeglkdadkcieldptfskgytrkGAIQFFLKEYDKALETYQEglkhdpqnqelLDGVRRCVQQINkagrgelspeELKERQVSLF
madeakakgnaafssgDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKKTVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKKGLDIDPNNEALKSGLADAKAAASAsfrsrsppadNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMKDIQRNPNNLNLYLKDQRVMQALGVLLNVKFKgptggddvemqdedapkgpetskeetrkpesepepepmelteeeKEAKERKEKalkekeagnaaykkkeFEKAIEHYSSalelddedisYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKaltehrnpdtLKKLNEAEKAKkeleqqeifdpkiaDEEREKGneffkqqkypeAIQHYTeslrrnpkdprtySNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKALETYQEGLkhdpqnqellDGVRRCVQQINkagrgelspeelkerqvslf
MADEAKAKGNAAFSSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKKTVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKKGLDIDPNNEalksgladakaaasasfrsrsppadNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMKDIQRNPNNLNLYLKDQRVMQALGVLLNVKFKGPTGGDDVEMQDEDAPKGpetskeetrkpesepepepmelteeekeakerkekalkekeAGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKALTEHRNPDTlkklneaekakkeleqqeIFDPKIADEEREKGNEFFKQQKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKALETYQEGLKHDPQNQELLDGVRRCVQQINKAGRGELSPEELKERQVSLF
*******************AAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKKTVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKKGLD*******************************************W****************************PNNLNLYLKDQRVMQALGVLLNVKFK*************************************************************************IEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIET******************************************************************************AACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKALETYQEG**********LDGVRRCV************************
MADEAKAKGNAAFSSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKKTVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKKGLDIDPNNEALKSGLADAKAAASASFRSRSPPADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMKDIQRNPNNLNLYLKDQRVMQALGVLLNVKFKGPTGGDDVEMQDEDAPKGPETSKEETRKPE****PEPMELTEEEKEAKERKEKALKEKEAGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKALTEHRNPDTLKKLNEAEKAKKELEQQEIFDPKIADEEREKGNEFFKQQKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKALETYQEGLKHDPQNQELLDGVRRCVQ**************LKERQVSLF
*************SSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKKTVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKKGLDIDPNNEALKS******************PADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMKDIQRNPNNLNLYLKDQRVMQALGVLLNVKFKGPTGGDDVE**************************************************AGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKALTEHRNPDTLKKLNEAEKAKKELEQQEIFDPKIADEEREKGNEFFKQQKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKALETYQEGLKHDPQNQELLDGVRRCVQQINKAGR****************
MADEAKAKGNAAFSSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKKTVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKKGLDIDPNNEALKSGLADAKAAASASFRSRSPPADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMKDIQRNPNNLNLYLKDQRVMQALGVLLNVKFKGPTGGDDVEM******KG**********P*SEPEPEPMELTEEEKEAKERKEKALKEKEAGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKALTEHRNPDTLKKLNEAEKAKKELEQQEIFDPKIADEEREKGNEFFKQQKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKALETYQEGLKHDPQNQELLDGVRRCVQQINKAGRGELSPEELKERQVSLF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADEAKAKGNAAFSSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKKTVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKKGLDIDPNNEALKSGLADAKAAASASFRSRSPPADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMKDIQRNPNNLNLYLKDQRVMQALGVLLNVKFKGPTGGDDVEMQDEDAPKGPETSKEETRKPESEPEPEPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKALTEHRxxxxxxxxxxxxxxxxxxxxxEIFDPKIADEEREKGNEFFKQQKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKALETYQEGLKHDPQNQELLDGVRRCVQQINKAGRGELSPEELKERQVSLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query525 2.2.26 [Sep-21-2011]
Q43468569 Heat shock protein STI OS no no 0.961 0.887 0.659 0.0
Q4R8N7543 Stress-induced-phosphopro N/A no 0.927 0.896 0.434 1e-105
O54981543 Stress-induced-phosphopro yes no 0.927 0.896 0.428 1e-105
P31948543 Stress-induced-phosphopro yes no 0.927 0.896 0.434 1e-105
Q60864543 Stress-induced-phosphopro yes no 0.927 0.896 0.437 1e-105
O35814543 Stress-induced-phosphopro yes no 0.927 0.896 0.434 1e-104
Q3ZBZ8543 Stress-induced-phosphopro yes no 0.927 0.896 0.430 1e-104
Q9USI5591 Heat shock protein sti1 h yes no 0.952 0.846 0.421 1e-102
P15705589 Heat shock protein STI1 O yes no 0.952 0.848 0.394 4e-93
Q54DA8564 Protein STIP1 homolog OS= yes no 0.910 0.847 0.403 8e-93
>sp|Q43468|STIP_SOYBN Heat shock protein STI OS=Glycine max GN=STI PE=2 SV=1 Back     alignment and function desciption
 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/531 (65%), Positives = 408/531 (76%), Gaps = 26/531 (4%)

Query: 1   MADEAKAKGNAAFSSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAK 60
           MA+EAKAKGNAAFS+GD+ AAVRHF++AI+LSP NHVLYSNRSAA           +  +
Sbjct: 1   MAEEAKAKGNAAFSAGDFAAAVRHFSDAIALSPSNHVLYSNRSAATLP-PELRGGPSRRQ 59

Query: 61  KTVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKKGLDIDPNNEALKSGLADAKAAASAS 120
           KTV+LKPDW K YSRLGAAHLGL+ + +A    K   + +P+N ALKSGLADA+AAAS  
Sbjct: 60  KTVDLKPDWPKAYSRLGAAHLGLRRHRDASPPTKPASNSNPDNAALKSGLADAQAAAS-- 117

Query: 121 FRSRSPPADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMKDIQRNPNNLNLYLKD 180
                PP  +PF +AF+GP+MWA+ +              R         P  +    + 
Sbjct: 118 ----RPPPTSPFATAFSGPDMWAR-SPPTPPHVQPPGPRVRQDHAGHPEGPQQVQPAFEY 172

Query: 181 QRVMQALGVLLNVKFKGPTGGDDVEMQDEDAPKGPETSKEETRKPESEPEPE-------- 232
           QRVM A+GVLLNVK + P   ++    D+      + S++E     S+PEPE        
Sbjct: 173 QRVMHAIGVLLNVKIQTPNHDENDHDADD------DVSEDEVV---SQPEPEHEPEAAVE 223

Query: 233 -PMELTEEEKEAKERKEKALKEKEAGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRA 291
              E  EEEKE ++RK +A KEKEAGNAAYKKK+FE AI HYS ALELDDEDISYLTNRA
Sbjct: 224 VAEEEEEEEKETRDRKGQAQKEKEAGNAAYKKKDFETAIGHYSKALELDDEDISYLTNRA 283

Query: 292 AVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIET 351
           AVYLEMGK+E+CIKDC+KAVERG+ELRSD+KMIARALTRKGTAL KMAKCSKD+EPAIE 
Sbjct: 284 AVYLEMGKFEDCIKDCEKAVERGKELRSDYKMIARALTRKGTALAKMAKCSKDFEPAIEI 343

Query: 352 FQKALTEHRNPDTLKKLNEAEKAKKELEQQEIFDPKIADEEREKGNEFFKQQKYPEAIQH 411
           FQKALTE+RNPDTLKKLNEAEKAKKELEQQE FDPK+ADE REKGNE FKQQKYPEA +H
Sbjct: 344 FQKALTENRNPDTLKKLNEAEKAKKELEQQEYFDPKLADEAREKGNELFKQQKYPEATKH 403

Query: 412 YTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLK 471
           YTE+++RNPKD + YSNRAACYTKLGAMPEGLKDA+KCIELDPTFSKGYTRKGA+QF +K
Sbjct: 404 YTEAIKRNPKDAKAYSNRAACYTKLGAMPEGLKDAEKCIELDPTFSKGYTRKGAVQFSMK 463

Query: 472 EYDKALETYQEGLKHDPQNQELLDGVRRCVQQINKAGRGELSPEELKERQV 522
           EYDKALETY+EGLKHDP NQELLDG+RRCV+QINKA RG+ +PEELKERQ 
Sbjct: 464 EYDKALETYREGLKHDPNNQELLDGIRRCVEQINKASRGDFTPEELKERQA 514

Glycine max (taxid: 3847)
>sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 Back     alignment and function description
>sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 Back     alignment and function description
>sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 Back     alignment and function description
>sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 Back     alignment and function description
>sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9USI5|STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sti1 PE=3 SV=1 Back     alignment and function description
>sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 Back     alignment and function description
>sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query525
356540381585 PREDICTED: heat shock protein STI-like [ 0.988 0.887 0.778 0.0
255537027578 heat shock protein 70 (HSP70)-interactin 0.982 0.892 0.788 0.0
224125136577 predicted protein [Populus trichocarpa] 0.984 0.896 0.797 0.0
356497161585 PREDICTED: heat shock protein STI-like [ 0.992 0.890 0.779 0.0
224071575581 predicted protein [Populus trichocarpa] 0.982 0.888 0.786 0.0
357481949581 Stress-induced-phosphoprotein [Medicago 0.973 0.879 0.771 0.0
79325071558 putative stress-inducible protein [Arabi 0.954 0.897 0.752 0.0
30682109530 putative stress-inducible protein [Arabi 0.954 0.945 0.752 0.0
222423527558 AT4G12400 [Arabidopsis thaliana] 0.954 0.897 0.752 0.0
22655105530 stress-induced protein sti1-like protein 0.954 0.945 0.750 0.0
>gi|356540381|ref|XP_003538668.1| PREDICTED: heat shock protein STI-like [Glycine max] Back     alignment and taxonomy information
 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/532 (77%), Positives = 465/532 (87%), Gaps = 13/532 (2%)

Query: 1   MADEAKAKGNAAFSSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAK 60
           MADEAKAKGNAAFSSGDY AA+ HF++AI+L+P NHVLYSNRSAA+ASL NY DALADAK
Sbjct: 1   MADEAKAKGNAAFSSGDYPAAIHHFSDAIALAPTNHVLYSNRSAAYASLQNYTDALADAK 60

Query: 61  KTVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKKGLDIDPNNEALKSGLADAKAAASAS 120
           KTVELKPDWSKGYSRLGAAHLGL  Y +AV++Y+KGL IDPNNE LKSGLADA+ A +A+
Sbjct: 61  KTVELKPDWSKGYSRLGAAHLGLSQYGDAVSAYEKGLKIDPNNEPLKSGLADAQKALAAA 120

Query: 121 FRSRSPPADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMKDIQRNPNNLNLYLKD 180
            R RS  A NPFG AF+GPEMWA+LTADPTTR+YL Q DF  MM+DIQR+PNNLNL+LKD
Sbjct: 121 SRPRSSAA-NPFGDAFSGPEMWARLTADPTTRAYLQQPDFVKMMQDIQRDPNNLNLHLKD 179

Query: 181 QRVMQALGVLLNVKFKGPTGGDDVEMQDEDAPKGPETSKEETRKPESEPEPEP------- 233
           QR+MQALGVLLNVK + P  G D +M D  +P     + E  R  E+EP  +P       
Sbjct: 180 QRIMQALGVLLNVKIQTPPTGADTDMPDSPSPSA--AASERKRAAEAEPAKQPESEPEPE 237

Query: 234 ---MELTEEEKEAKERKEKALKEKEAGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNR 290
              MELT EEK AK+RK +ALKEK+AGNAAYKKK+F+ AI+HY+ ALELDDEDISYLTNR
Sbjct: 238 PESMELTGEEKGAKQRKAEALKEKDAGNAAYKKKDFDTAIQHYTKALELDDEDISYLTNR 297

Query: 291 AAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIE 350
           AAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKG ALVK+AKCSKDYEPAIE
Sbjct: 298 AAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGNALVKLAKCSKDYEPAIE 357

Query: 351 TFQKALTEHRNPDTLKKLNEAEKAKKELEQQEIFDPKIADEEREKGNEFFKQQKYPEAIQ 410
           T+QKALTEHRNPDTLKKLNEAEKAKKELEQQE FDPK+ADEEREKGNEFFKQQKYPEA++
Sbjct: 358 TYQKALTEHRNPDTLKKLNEAEKAKKELEQQEYFDPKLADEEREKGNEFFKQQKYPEAVK 417

Query: 411 HYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFL 470
           HYTES+RRNPKDPR YSNRAACYTKLGAMPEGLKDA+KCIELDPTF KGYTRKGA+Q+F+
Sbjct: 418 HYTESIRRNPKDPRAYSNRAACYTKLGAMPEGLKDAEKCIELDPTFVKGYTRKGAVQYFM 477

Query: 471 KEYDKALETYQEGLKHDPQNQELLDGVRRCVQQINKAGRGELSPEELKERQV 522
           KEY+K+LETY+EGLK+D  NQELL+G+R C+QQINKA RG+LSPEELKERQ 
Sbjct: 478 KEYEKSLETYREGLKYDSNNQELLEGIRTCIQQINKASRGDLSPEELKERQA 529

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255537027|ref|XP_002509580.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223549479|gb|EEF50967.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224125136|ref|XP_002329902.1| predicted protein [Populus trichocarpa] gi|118487408|gb|ABK95532.1| unknown [Populus trichocarpa] gi|222871139|gb|EEF08270.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356497161|ref|XP_003517431.1| PREDICTED: heat shock protein STI-like [Glycine max] Back     alignment and taxonomy information
>gi|224071575|ref|XP_002303523.1| predicted protein [Populus trichocarpa] gi|222840955|gb|EEE78502.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357481949|ref|XP_003611260.1| Stress-induced-phosphoprotein [Medicago truncatula] gi|355512595|gb|AES94218.1| Stress-induced-phosphoprotein [Medicago truncatula] Back     alignment and taxonomy information
>gi|79325071|ref|NP_001031620.1| putative stress-inducible protein [Arabidopsis thaliana] gi|5281051|emb|CAB45987.1| stress-induced protein sti1-like protein [Arabidopsis thaliana] gi|7267942|emb|CAB78283.1| stress-induced protein sti1-like protein [Arabidopsis thaliana] gi|332657726|gb|AEE83126.1| putative stress-inducible protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30682109|ref|NP_192977.2| putative stress-inducible protein [Arabidopsis thaliana] gi|332657725|gb|AEE83125.1| putative stress-inducible protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|222423527|dbj|BAH19733.1| AT4G12400 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22655105|gb|AAM98143.1| stress-induced protein sti1-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query525
TAIR|locus:2139109558 Hop3 "AT4G12400" [Arabidopsis 0.504 0.474 0.784 4.1e-186
TAIR|locus:2026197571 Hop2 "Hop2" [Arabidopsis thali 0.504 0.464 0.762 5.2e-186
TAIR|locus:2034620572 Hop1 "Hop1" [Arabidopsis thali 0.504 0.463 0.781 4.2e-184
UNIPROTKB|Q43468569 STI "Heat shock protein STI" [ 0.506 0.467 0.793 4.5e-152
MGI|MGI:109130543 Stip1 "stress-induced phosphop 0.493 0.476 0.444 3e-91
UNIPROTKB|P31948543 STIP1 "Stress-induced-phosphop 0.493 0.476 0.447 1e-90
RGD|621599543 Stip1 "stress-induced phosphop 0.493 0.476 0.440 1e-90
UNIPROTKB|Q3ZBZ8543 STIP1 "Stress-induced-phosphop 0.493 0.476 0.447 1.3e-90
ZFIN|ZDB-GENE-041121-17542 stip1 "stress-induced-phosphop 0.495 0.479 0.423 1.3e-88
POMBASE|SPCC645.14c591 sti1 "chaperone activator Sti1 0.466 0.414 0.416 2.4e-87
TAIR|locus:2139109 Hop3 "AT4G12400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1133 (403.9 bits), Expect = 4.1e-186, Sum P(2) = 4.1e-186
 Identities = 208/265 (78%), Positives = 236/265 (89%)

Query:   257 GNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRE 316
             GN AYKKK+F +A+EHY+ A+ELDDEDISYLTNRAAVYLEMGKYEECI+DCDKAVERGRE
Sbjct:   237 GNVAYKKKDFGRAVEHYTKAMELDDEDISYLTNRAAVYLEMGKYEECIEDCDKAVERGRE 296

Query:   317 LRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKALTEHRNPDTXXXXXXXXXXXX 376
             LRSDFKMIARALTRKG+ALVKMA+CSKD+EPAIETFQKALTEHRNPDT            
Sbjct:   297 LRSDFKMIARALTRKGSALVKMARCSKDFEPAIETFQKALTEHRNPDTLKKLNDAEKVKK 356

Query:   377 XXXXXXIFDPKIADEEREKGNEFFKQQKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKL 436
                    FDP IA+EEREKGN FFK+QKYPEA++HY+E+++RNP D R YSNRAACYTKL
Sbjct:   357 ELEQQEYFDPTIAEEEREKGNGFFKEQKYPEAVKHYSEAIKRNPNDVRAYSNRAACYTKL 416

Query:   437 GAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKALETYQEGLKHDPQNQELLDG 496
             GA+PEGLKDA+KCIELDP+F+KGY+RKGAIQFF+KEYDKA+ETYQEGLKHDP+NQE LDG
Sbjct:   417 GALPEGLKDAEKCIELDPSFTKGYSRKGAIQFFMKEYDKAMETYQEGLKHDPKNQEFLDG 476

Query:   497 VRRCVQQINKAGRGELSPEELKERQ 521
             VRRCV+QINKA RG+L+PEELKERQ
Sbjct:   477 VRRCVEQINKASRGDLTPEELKERQ 501
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0009644 "response to high light intensity" evidence=IEP;RCA
GO:0042542 "response to hydrogen peroxide" evidence=IEP;RCA
GO:0006457 "protein folding" evidence=RCA
GO:0010286 "heat acclimation" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
TAIR|locus:2026197 Hop2 "Hop2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034620 Hop1 "Hop1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q43468 STI "Heat shock protein STI" [Glycine max (taxid:3847)] Back     alignment and assigned GO terms
MGI|MGI:109130 Stip1 "stress-induced phosphoprotein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P31948 STIP1 "Stress-induced-phosphoprotein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|621599 Stip1 "stress-induced phosphoprotein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBZ8 STIP1 "Stress-induced-phosphoprotein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041121-17 stip1 "stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPCC645.14c sti1 "chaperone activator Sti1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3ZBZ8STIP1_BOVINNo assigned EC number0.43020.92760.8968yesno
Q60864STIP1_MOUSENo assigned EC number0.43780.92760.8968yesno
P15705STI1_YEASTNo assigned EC number0.39410.95230.8488yesno
O54981STIP1_CRIGRNo assigned EC number0.42820.92760.8968yesno
P31948STIP1_HUMANNo assigned EC number0.43400.92760.8968yesno
Q9USI5STI1_SCHPONo assigned EC number0.42170.95230.8460yesno
Q54DA8STIP1_DICDINo assigned EC number0.40310.91040.8475yesno
Q8ILC1STI1L_PLAF7No assigned EC number0.35960.94090.8758yesno
O35814STIP1_RATNo assigned EC number0.43400.92760.8968yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_1270023
SubName- Full=Putative uncharacterized protein; (577 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00061196
hypothetical protein (346 aa)
   •  • 0.416
estExt_Genewise1_v1.C_LG_XVI1879
hypothetical protein (355 aa)
   •  • 0.407

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-21
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-19
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-17
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-16
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 4e-15
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-13
pfam1341469 pfam13414, TPR_11, TPR repeat 9e-13
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-12
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 1e-10
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-10
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 6e-09
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-08
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-07
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-06
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-06
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-05
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-05
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 2e-04
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 5e-04
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 6e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 7e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.001
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.001
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 0.001
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.001
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.001
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.001
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.002
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.002
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.002
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.002
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.003
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.003
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.003
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information 
 Score = 89.0 bits (221), Expect = 2e-21
 Identities = 37/96 (38%), Positives = 57/96 (59%)

Query: 394 EKGNEFFKQQKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELD 453
             GN ++K   Y EA+++Y ++L  +P +   Y N AA Y KLG   E L+D +K +ELD
Sbjct: 5   NLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKALELD 64

Query: 454 PTFSKGYTRKGAIQFFLKEYDKALETYQEGLKHDPQ 489
           P  +K Y   G   + L +Y++ALE Y++ L+ DP 
Sbjct: 65  PDNAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100

Length = 100
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 525
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
KOG0547606 consensus Translocase of outer mitochondrial membr 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 100.0
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 100.0
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.97
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.97
KOG1126638 consensus DNA-binding cell division cycle control 99.97
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.97
KOG1126638 consensus DNA-binding cell division cycle control 99.97
PRK11788389 tetratricopeptide repeat protein; Provisional 99.96
PRK14574 822 hmsH outer membrane protein; Provisional 99.96
PRK11788389 tetratricopeptide repeat protein; Provisional 99.96
KOG0547606 consensus Translocase of outer mitochondrial membr 99.96
KOG2076 895 consensus RNA polymerase III transcription factor 99.96
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.96
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.96
KOG2003 840 consensus TPR repeat-containing protein [General f 99.95
PRK14574 822 hmsH outer membrane protein; Provisional 99.94
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.94
KOG2076 895 consensus RNA polymerase III transcription factor 99.93
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.93
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.92
KOG2003840 consensus TPR repeat-containing protein [General f 99.92
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.92
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.92
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.91
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.91
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.91
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.91
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.9
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.9
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.9
KOG1125579 consensus TPR repeat-containing protein [General f 99.9
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.9
PRK12370553 invasion protein regulator; Provisional 99.9
PRK12370553 invasion protein regulator; Provisional 99.9
KOG1125579 consensus TPR repeat-containing protein [General f 99.9
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.89
KOG1129478 consensus TPR repeat-containing protein [General f 99.89
KOG1129478 consensus TPR repeat-containing protein [General f 99.89
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.88
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.88
PRK11189296 lipoprotein NlpI; Provisional 99.88
PRK11189296 lipoprotein NlpI; Provisional 99.88
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.88
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.88
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.87
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.87
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.87
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.87
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.86
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.86
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.85
PLN03218 1060 maturation of RBCL 1; Provisional 99.85
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.85
PLN03077 857 Protein ECB2; Provisional 99.84
PLN02789320 farnesyltranstransferase 99.84
PLN03218 1060 maturation of RBCL 1; Provisional 99.83
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.83
PLN02789320 farnesyltranstransferase 99.82
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.82
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.81
PLN03077857 Protein ECB2; Provisional 99.81
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.81
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.8
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.8
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.79
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.79
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.78
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.77
PRK15359144 type III secretion system chaperone protein SscB; 99.76
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.75
KOG0553304 consensus TPR repeat-containing protein [General f 99.74
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.73
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.72
KOG0553304 consensus TPR repeat-containing protein [General f 99.7
PRK15359144 type III secretion system chaperone protein SscB; 99.69
PRK10370198 formate-dependent nitrite reductase complex subuni 99.68
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.68
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.67
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.66
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.66
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.66
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.65
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.65
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.63
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.62
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.61
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.61
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.61
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.6
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.59
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.59
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.58
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.58
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.58
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.58
PRK10370198 formate-dependent nitrite reductase complex subuni 99.58
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.58
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.56
PRK04841 903 transcriptional regulator MalT; Provisional 99.53
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.52
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.52
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.51
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.5
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.5
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.49
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.49
PRK04841 903 transcriptional regulator MalT; Provisional 99.48
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.48
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.43
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.42
KOG4648536 consensus Uncharacterized conserved protein, conta 99.42
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.38
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.38
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.38
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.36
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.36
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.36
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.36
PRK15331165 chaperone protein SicA; Provisional 99.36
KOG4234271 consensus TPR repeat-containing protein [General f 99.34
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.33
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.32
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.32
PRK15331165 chaperone protein SicA; Provisional 99.31
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.31
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.31
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.31
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 99.29
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.28
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.27
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.27
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.27
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.26
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.26
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.26
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.24
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.23
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 99.23
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.22
COG4105254 ComL DNA uptake lipoprotein [General function pred 99.22
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.21
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.2
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.2
PRK10803263 tol-pal system protein YbgF; Provisional 99.18
KOG1941 518 consensus Acetylcholine receptor-associated protei 99.18
PRK10803263 tol-pal system protein YbgF; Provisional 99.16
KOG4234271 consensus TPR repeat-containing protein [General f 99.16
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.13
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.12
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.12
PF13512142 TPR_18: Tetratricopeptide repeat 99.1
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.07
PRK11906458 transcriptional regulator; Provisional 99.07
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.05
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 99.04
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.04
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.02
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.02
PRK11906458 transcriptional regulator; Provisional 99.01
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.0
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.99
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.99
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.98
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.97
PF1337173 TPR_9: Tetratricopeptide repeat 98.97
PF12688120 TPR_5: Tetratrico peptide repeat 98.96
PF1337173 TPR_9: Tetratricopeptide repeat 98.96
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.95
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.95
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.95
PF12688120 TPR_5: Tetratrico peptide repeat 98.93
KOG2471696 consensus TPR repeat-containing protein [General f 98.93
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.93
PF13512142 TPR_18: Tetratricopeptide repeat 98.9
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.86
COG3898531 Uncharacterized membrane-bound protein [Function u 98.85
KOG4555175 consensus TPR repeat-containing protein [Function 98.82
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 98.82
COG4700251 Uncharacterized protein conserved in bacteria cont 98.82
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.81
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.8
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.79
KOG4555175 consensus TPR repeat-containing protein [Function 98.76
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.73
COG3898531 Uncharacterized membrane-bound protein [Function u 98.73
KOG1586288 consensus Protein required for fusion of vesicles 98.72
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.72
KOG2471696 consensus TPR repeat-containing protein [General f 98.72
COG4700251 Uncharacterized protein conserved in bacteria cont 98.72
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.71
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.69
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.69
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.68
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.65
KOG4507 886 consensus Uncharacterized conserved protein, conta 98.64
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.6
KOG1586288 consensus Protein required for fusion of vesicles 98.58
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 98.58
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.58
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.57
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.56
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.49
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.48
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.44
KOG1585308 consensus Protein required for fusion of vesicles 98.43
PF1342844 TPR_14: Tetratricopeptide repeat 98.4
PF1342844 TPR_14: Tetratricopeptide repeat 98.39
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.36
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.35
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.31
KOG1258577 consensus mRNA processing protein [RNA processing 98.28
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.27
PF1343134 TPR_17: Tetratricopeptide repeat 98.25
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.24
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.23
PF1343134 TPR_17: Tetratricopeptide repeat 98.21
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.2
KOG1585308 consensus Protein required for fusion of vesicles 98.16
KOG1550552 consensus Extracellular protein SEL-1 and related 98.16
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.15
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.14
KOG1258577 consensus mRNA processing protein [RNA processing 98.13
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.11
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.07
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 98.01
KOG1550552 consensus Extracellular protein SEL-1 and related 98.01
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.01
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.98
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.98
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.97
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.96
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.94
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.94
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.93
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.93
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.9
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.89
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 97.88
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.87
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.87
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.82
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.82
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.81
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.77
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.74
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.71
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.71
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.69
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.67
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.64
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.58
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.54
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.52
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.51
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.49
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.43
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.37
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.36
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.31
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 97.28
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.26
KOG4507886 consensus Uncharacterized conserved protein, conta 97.25
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.23
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.21
PRK10941269 hypothetical protein; Provisional 97.21
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 97.2
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.2
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.19
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.18
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.15
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.15
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.14
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.13
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.12
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.11
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.1
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.08
KOG1310758 consensus WD40 repeat protein [General function pr 97.07
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.05
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.99
PRK10941269 hypothetical protein; Provisional 96.99
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.95
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.94
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.91
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.9
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.89
KOG3364149 consensus Membrane protein involved in organellar 96.88
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.86
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.84
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.78
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.76
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.73
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.73
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.68
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.58
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.54
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.54
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.49
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.45
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.44
KOG1310 758 consensus WD40 repeat protein [General function pr 96.43
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.43
KOG3364149 consensus Membrane protein involved in organellar 96.39
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.38
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.33
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.31
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.29
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 96.19
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.17
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.17
COG5191 435 Uncharacterized conserved protein, contains HAT (H 96.11
KOG4814872 consensus Uncharacterized conserved protein [Funct 96.11
COG5191435 Uncharacterized conserved protein, contains HAT (H 96.1
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.0
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 95.92
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 95.89
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 95.87
KOG1463411 consensus 26S proteasome regulatory complex, subun 95.79
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.77
COG5159421 RPN6 26S proteasome regulatory complex component [ 95.67
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.53
KOG2422 665 consensus Uncharacterized conserved protein [Funct 95.33
KOG0529 421 consensus Protein geranylgeranyltransferase type I 95.27
KOG0529 421 consensus Protein geranylgeranyltransferase type I 95.23
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 95.07
COG2912269 Uncharacterized conserved protein [Function unknow 95.01
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.94
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.83
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 94.62
COG2912269 Uncharacterized conserved protein [Function unknow 94.52
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 94.51
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 94.42
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 94.05
COG4941415 Predicted RNA polymerase sigma factor containing a 94.02
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 93.96
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 93.93
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 93.91
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.84
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.73
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 93.72
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 93.68
COG3629280 DnrI DNA-binding transcriptional activator of the 93.67
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 93.62
KOG2422 665 consensus Uncharacterized conserved protein [Funct 93.6
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 93.59
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.56
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 93.28
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.27
KOG2581 493 consensus 26S proteasome regulatory complex, subun 93.12
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.07
COG3629280 DnrI DNA-binding transcriptional activator of the 92.96
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 92.7
COG1747 711 Uncharacterized N-terminal domain of the transcrip 92.63
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 92.55
KOG15381081 consensus Uncharacterized conserved protein WDR10, 92.19
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 92.06
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 91.9
PF1286294 Apc5: Anaphase-promoting complex subunit 5 91.76
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 91.49
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.48
KOG2581493 consensus 26S proteasome regulatory complex, subun 91.01
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 90.46
COG3947361 Response regulator containing CheY-like receiver a 90.34
PRK11619 644 lytic murein transglycosylase; Provisional 90.11
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 89.98
COG3947361 Response regulator containing CheY-like receiver a 89.97
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 89.86
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 89.05
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 88.88
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 88.7
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 88.7
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 88.43
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 88.35
smart00299140 CLH Clathrin heavy chain repeat homology. 88.3
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 88.22
KOG4014248 consensus Uncharacterized conserved protein (conta 88.09
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.04
COG5159421 RPN6 26S proteasome regulatory complex component [ 87.98
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 87.91
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.84
KOG1463411 consensus 26S proteasome regulatory complex, subun 87.43
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 86.84
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 86.39
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 86.14
COG4455273 ImpE Protein of avirulence locus involved in tempe 86.03
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 85.34
COG4455273 ImpE Protein of avirulence locus involved in tempe 85.28
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 84.21
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 84.05
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 84.03
PF1285434 PPR_1: PPR repeat 83.88
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 83.75
PF1285434 PPR_1: PPR repeat 82.05
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 81.54
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 80.94
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 80.32
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 80.06
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-48  Score=347.18  Aligned_cols=385  Identities=21%  Similarity=0.261  Sum_probs=284.1

Q ss_pred             chHHHHHHHHHHhcCCHHHHHHHHHHHhccCCchhHHHHHHHHHHhhcccHHHHHHHHHHhhccCCCCHHHHHHHHHHHh
Q 009799            2 ADEAKAKGNAAFSSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKKTVELKPDWSKGYSRLGAAHL   81 (525)
Q Consensus         2 a~~~~~~g~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~   81 (525)
                      +++|-+.|+.+-..|++++|+..|+.+++++|+..++|.++|.++...|+.+.|..+|..+++++|+...+...+|.++.
T Consensus       116 ae~ysn~aN~~kerg~~~~al~~y~~aiel~p~fida~inla~al~~~~~~~~a~~~~~~alqlnP~l~ca~s~lgnLlk  195 (966)
T KOG4626|consen  116 AEAYSNLANILKERGQLQDALALYRAAIELKPKFIDAYINLAAALVTQGDLELAVQCFFEALQLNPDLYCARSDLGNLLK  195 (966)
T ss_pred             HHHHHHHHHHHHHhchHHHHHHHHHHHHhcCchhhHHHhhHHHHHHhcCCCcccHHHHHHHHhcCcchhhhhcchhHHHH
Confidence            46666777777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             hhhhHHHHHHHHHHhhccCCCcHHHHhhHHhHHHHHhhcccCCCCCCCCcccccccCchhhhhcccCCCcccccchHHHH
Q 009799           82 GLQDYIEAVNSYKKGLDIDPNNEALKSGLADAKAAASASFRSRSPPADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFR  161 (525)
Q Consensus        82 ~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (525)
                      .+|+..+|..+|.++++..|...-+|..|+.++...|+.                                    ..++.
T Consensus       196 a~Grl~ea~~cYlkAi~~qp~fAiawsnLg~~f~~~Gei------------------------------------~~aiq  239 (966)
T KOG4626|consen  196 AEGRLEEAKACYLKAIETQPCFAIAWSNLGCVFNAQGEI------------------------------------WLAIQ  239 (966)
T ss_pred             hhcccchhHHHHHHHHhhCCceeeeehhcchHHhhcchH------------------------------------HHHHH
Confidence            777777777777777777777777777777776666654                                    34455


Q ss_pred             HHHHHHhhCCCchhHHhhHHHHHHHHHHHHhhhccCCCCCCccccccccCCCCCCCchhhccCCCCCCCCCChhhhHHHH
Q 009799          162 NMMKDIQRNPNNLNLYLKDQRVMQALGVLLNVKFKGPTGGDDVEMQDEDAPKGPETSKEETRKPESEPEPEPMELTEEEK  241 (525)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  241 (525)
                      .+.+++..+|+...                                                                  
T Consensus       240 ~y~eAvkldP~f~d------------------------------------------------------------------  253 (966)
T KOG4626|consen  240 HYEEAVKLDPNFLD------------------------------------------------------------------  253 (966)
T ss_pred             HHHHhhcCCCcchH------------------------------------------------------------------
Confidence            55555555555544                                                                  


Q ss_pred             HHHHhHHHHHHHHHHHHHHHhcccHHHHHHHHHHHhhcCCCCHHHHHHHHHHHHHhcCHHHHHHHHHHHHHccccChhhH
Q 009799          242 EAKERKEKALKEKEAGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDF  321 (525)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~~l~~~~~~~~~~  321 (525)
                                +|+++|.+|...+.+++|+.+|.+++...|++..++.++|.+|..+|..+-|+.+|++++++.|..    
T Consensus       254 ----------AYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~F----  319 (966)
T KOG4626|consen  254 ----------AYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQPNF----  319 (966)
T ss_pred             ----------HHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHhcCCCc----
Confidence                      455555555555555555555555555555555555555555555555555555555555555555    


Q ss_pred             HHHHHHHHHhhhhHHHhhhcccchHHHHHHHHHHHhcCCC--------hhHHHHhchHHHHHHHHHHHhhcCCCcHHHHH
Q 009799          322 KMIARALTRKGTALVKMAKCSKDYEPAIETFQKALTEHRN--------PDTLKKLNEAEKAKKELEQQEIFDPKIADEER  393 (525)
Q Consensus       322 ~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~--------~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~  393 (525)
                         ..++.+++.++...|+    ..+|..+|++++...|.        +.++...|.+++|...|.++++..|..+.+..
T Consensus       320 ---~~Ay~NlanALkd~G~----V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~n  392 (966)
T KOG4626|consen  320 ---PDAYNNLANALKDKGS----VTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHN  392 (966)
T ss_pred             ---hHHHhHHHHHHHhccc----hHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhh
Confidence               2333333333333333    55555555555555444        12334445555555555555559999999999


Q ss_pred             HhhhHHHhcCChhHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCchHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhcCH
Q 009799          394 EKGNEFFKQQKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEY  473 (525)
Q Consensus       394 ~l~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~  473 (525)
                      ++|.+|.++|++++|+.+|++++.+.|..++++.++|..|..+|+.+.|+.+|.+|+.++|..++++.+||.+|...|+.
T Consensus       393 NLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni  472 (966)
T KOG4626|consen  393 NLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNI  472 (966)
T ss_pred             hHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhccCCCCHHHHHHHHHHHHHhhhhcc
Q 009799          474 DKALETYQEGLKHDPQNQELLDGVRRCVQQINKAGR  509 (525)
Q Consensus       474 ~~A~~~~~~a~~~~p~~~~~~~~l~~~~~~~~~~~~  509 (525)
                      .+|+..|+.++++.|+.+++..++..++.-+..+..
T Consensus       473 ~~AI~sY~~aLklkPDfpdA~cNllh~lq~vcdw~D  508 (966)
T KOG4626|consen  473 PEAIQSYRTALKLKPDFPDAYCNLLHCLQIVCDWTD  508 (966)
T ss_pred             HHHHHHHHHHHccCCCCchhhhHHHHHHHHHhcccc
Confidence            999999999999999999999999999988876544

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 8e-46
3uq3_A 258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 1e-05
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 8e-30
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 2e-28
4gcn_A127 N-Terminal Domain Of Stress-Induced Protein-1 (Sti- 3e-24
3esk_A129 Structure Of Hop Tpr2a Domain In Complex With The N 3e-22
1elr_A131 Crystal Structure Of The Tpr2a Domain Of Hop In Com 3e-22
3fwv_A128 Crystal Structure Of A Redesigned Tpr Protein, T-Mo 3e-21
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 2e-20
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 5e-16
3upv_A126 Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 3e-19
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 1e-17
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 1e-11
1wao_1477 Pp5 Structure Length = 477 4e-13
1wao_1 477 Pp5 Structure Length = 477 8e-11
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 5e-13
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 7e-11
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 1e-12
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 4e-11
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-12
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 3e-10
3sz7_A164 Crystal Structure Of The Sgt2 Tpr Domain From Asper 1e-12
3sz7_A164 Crystal Structure Of The Sgt2 Tpr Domain From Asper 1e-11
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-11
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 7e-11
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-11
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-11
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 2e-10
2c2l_A 281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 2e-10
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 5e-10
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 2e-08
2gw1_A 514 Crystal Structure Of The Yeast Tom70 Length = 514 6e-09
3lca_A 533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 7e-08
3fp2_A 537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 7e-08
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 1e-06
1w3b_A 388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 4e-04
2c0m_A319 Apo Form Of The Tpr Domain Of The Pex5p Receptor Le 7e-06
3r9a_B328 Human Alanine-Glyoxylate Aminotransferase In Comple 8e-06
2j9q_A328 A Novel Conformation For The Tpr Domain Of Pex5p Le 8e-06
1fch_A368 Crystal Structure Of The Pts1 Complexed To The Tpr 8e-06
2c0l_A305 Tpr Domain Of Human Pex5p In Complex With Human Msc 9e-06
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 1e-05
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 2e-05
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 2e-05
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 3e-05
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 5e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-05
2fbn_A198 Plasmodium Falciparum Putative Fk506-Binding Protei 5e-05
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 8e-05
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 2e-04
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 1e-04
2l6j_A111 Tah1 Complexed By Meevd Length = 111 2e-04
3rkv_A162 C-Terminal Domain Of Protein C56c10.10, A Putative 2e-04
3pe3_A 723 Structure Of Human O-Glcnac Transferase And Its Com 3e-04
3cvq_A327 Structure Of Peroxisomal Targeting Signal 1 (pts1) 4e-04
3cv0_A327 Structure Of Peroxisomal Targeting Signal 1 (Pts1) 4e-04
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 7e-04
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure 
Iteration: 1

 Score =  181 bits (459), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 95/223 (42%), Positives = 133/223 (59%), Gaps = 5/223 (2%)
Query: 257 GNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRE 316
           GN  YK ++F++AIEHY+ A EL  +DI+YL NRAA   E G+YE  I   + AVE+GRE
Sbjct: 12  GNKFYKARQFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGEYETAISTLNDAVEQGRE 70
Query: 317 LRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKALTEHRNPDTXXXXXXXXXXXX 376
           +R+D+K+I+++  R G A  K+     D +  IE +QK+LTEHR  D             
Sbjct: 71  MRADYKVISKSFARIGNAYHKLG----DLKKTIEYYQKSLTEHRTADILTKLRNAEKELK 126
Query: 377 XXXXXXIFDPKIADEEREKGNEFFKQQKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKL 436
                   +P+ A+E R +G E+F +  +P A++ YTE ++R P+D R YSNRAA   KL
Sbjct: 127 KAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKL 186
Query: 437 GAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKALET 479
            + PE + D +K IE DP F + Y RK   Q  +KEY  ALET
Sbjct: 187 MSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALET 229
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|4GCN|A Chain A, N-Terminal Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 127 Back     alignment and structure
>pdb|3ESK|A Chain A, Structure Of Hop Tpr2a Domain In Complex With The Non-Cognate Hsc70 Peptide Ligand Length = 129 Back     alignment and structure
>pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex With The Hsp90 Peptide Meevd Length = 131 Back     alignment and structure
>pdb|3FWV|A Chain A, Crystal Structure Of A Redesigned Tpr Protein, T-Mod(Vmy), In Complex With Meevf Peptide Length = 128 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure
>pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 Back     alignment and structure
>pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor Length = 319 Back     alignment and structure
>pdb|3R9A|B Chain B, Human Alanine-Glyoxylate Aminotransferase In Complex With The Tpr Domain Of Human Pex5p Length = 328 Back     alignment and structure
>pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p Length = 328 Back     alignment and structure
>pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5 Length = 368 Back     alignment and structure
>pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 Length = 305 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|2L6J|A Chain A, Tah1 Complexed By Meevd Length = 111 Back     alignment and structure
>pdb|3RKV|A Chain A, C-Terminal Domain Of Protein C56c10.10, A Putative Peptidylprolyl Isomerase, From Caenorhabditis Elegans Length = 162 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|3CVQ|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (tbpex5)complexed To Pts1 Peptide (7- Skl) Length = 327 Back     alignment and structure
>pdb|3CV0|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (Pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (Tbpex5)complexed To T. Brucei Phosphoglucoisomerase (Pgi) Pts1 Peptide Length = 327 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-97
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-39
2gw1_A 514 Mitochondrial precursor proteins import receptor; 8e-28
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-18
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-16
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-82
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-26
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-22
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-20
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 8e-19
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-17
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-15
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-13
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-71
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-26
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-21
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-18
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-07
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-48
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-41
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-30
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-47
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-42
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 3e-30
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 8e-47
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-42
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-28
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-46
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 9e-31
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-28
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-45
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-40
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-24
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-23
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-19
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-13
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-12
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-12
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-10
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-06
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-44
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-30
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-27
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 3e-44
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 6e-41
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 7e-29
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-44
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-40
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-25
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-19
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-19
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-19
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-13
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-12
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-12
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-43
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-42
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-27
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 5e-41
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-35
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-28
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 7e-41
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 2e-39
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 8e-30
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-39
3q49_B137 STIP1 homology and U box-containing protein 1; E3 7e-36
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-26
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-38
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-37
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-26
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 4e-37
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 5e-33
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-29
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-36
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-35
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-24
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-22
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-06
2l6j_A111 TPR repeat-containing protein associated with HSP; 8e-35
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-28
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-22
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-30
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-29
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-29
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-29
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-24
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 5e-22
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-20
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-15
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-14
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-14
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-14
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-07
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 8e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-29
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-25
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-20
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-17
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-16
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-15
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-14
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-14
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-29
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-28
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-16
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-16
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-16
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-16
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-13
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-10
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 4e-28
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 7e-21
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-27
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-27
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-24
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-21
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-21
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-20
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-15
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-14
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-04
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 3e-26
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 7e-26
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 2e-18
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-26
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-21
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-17
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-14
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-13
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-26
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-25
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-25
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-15
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-11
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-10
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 8e-26
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-20
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-16
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-13
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-25
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-14
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-14
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-10
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-09
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-07
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 9e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-24
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-17
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-16
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 6e-16
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-13
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-12
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-12
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-11
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-10
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-23
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 8e-21
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-16
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-16
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-16
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 9e-23
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-16
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 8e-15
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-14
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-11
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 7e-08
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-22
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-12
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-10
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-10
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-08
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-08
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 4e-22
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 8e-19
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-18
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-22
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-22
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-21
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-21
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-20
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-20
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-20
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-19
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-17
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-13
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-13
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-13
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-13
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-12
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-09
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 1e-21
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-21
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 9e-20
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-16
4g1t_A 472 Interferon-induced protein with tetratricopeptide 3e-21
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-21
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-20
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-17
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-14
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-11
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-09
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-08
4g1t_A 472 Interferon-induced protein with tetratricopeptide 8e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-21
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-18
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-10
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 9e-10
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-09
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-20
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-18
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 9e-18
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-15
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-15
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-14
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-13
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-18
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-15
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-15
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-14
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-14
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-11
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-06
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-17
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 2e-16
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 3e-15
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-17
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 9e-17
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-15
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-14
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-14
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 5e-09
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 6e-12
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-10
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-10
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-10
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-16
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-15
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-15
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-10
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 8e-09
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-08
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-16
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-16
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-14
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-13
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-13
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-12
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 9e-11
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 4e-16
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 6e-15
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-12
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-11
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-09
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-06
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-16
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 6e-13
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-10
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 4e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 6e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 4e-08
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-06
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-05
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-15
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-15
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-15
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-11
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-10
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-06
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-15
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 5e-15
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 6e-12
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-15
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-12
2kat_A115 Uncharacterized protein; NESG, structure, structur 6e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-06
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 4e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-14
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-10
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 4e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-14
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-09
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 6e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-13
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 7e-09
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-08
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 4e-06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-12
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 9e-13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-12
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-09
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-09
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 5e-12
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 5e-12
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-10
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-08
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-08
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-11
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-05
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 6e-11
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 7e-07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 6e-06
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 1e-10
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 4e-09
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 7e-07
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 7e-07
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-05
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 7e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-10
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-09
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-10
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-10
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-07
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-07
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 6e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 7e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-08
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 8e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 6e-09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 7e-07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 7e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 9e-09
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 7e-08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 4e-04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 2e-08
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 2e-07
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 4e-08
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 5e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 5e-07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 4e-07
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 5e-04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 1e-06
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-05
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 2e-05
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 1e-04
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 3e-04
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 8e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 8e-05
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
 Score =  303 bits (777), Expect = 3e-97
 Identities = 88/515 (17%), Positives = 179/515 (34%), Gaps = 52/515 (10%)

Query: 2   ADEAKAKGNAAFSSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKK 61
           A   K KGN  F +  Y+ A++++  A+ L   + V YSN SA + S+ +    +  + K
Sbjct: 6   ALALKDKGNQFFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLKKVVEMSTK 64

Query: 62  TVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKK-GLDIDPNNEALKSGLADAKAAASAS 120
            +ELKPD+SK   R  +A+ GL  + +A+       L+ D N+ +++  L       +  
Sbjct: 65  ALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQA-- 122

Query: 121 FRSRSPPADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMKDIQRNPNNLNLYLKD 180
             S+         +A A P   +   A        +     +M          L     D
Sbjct: 123 -MSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLPSVTSMASFFGIFKPELTFANYD 181

Query: 181 QRVMQALGVLLNVKFKGPTGGDDVEMQDEDAPKGPETSKEETRKPESEPEPEPMELTEEE 240
           +       ++  +        +  +  DE   K     +E+              L +  
Sbjct: 182 ESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFEEQ--------------LDKNN 227

Query: 241 KEAKERKEKALKEKEAGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKY 300
           ++ K +++ A+  +  G   + K +   A E    A+EL     SY    A +  +    
Sbjct: 228 EDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSY-IYMALIMADRNDS 286

Query: 301 EECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKALTEHR 360
            E     DKA++            +     +G     +    ++Y+ A + F KA     
Sbjct: 287 TEYYNYFDKALKLDSNN-------SSVYYHRGQMNFIL----QNYDQAGKDFDKAKE--L 333

Query: 361 NPD----------TLKKLNEAEKAKKELEQQEIFDPKIADEEREKGNEFFKQQKYPEAIQ 410
           +P+             + N+ +  +    + +   P+  +           +  + +A++
Sbjct: 334 DPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALK 393

Query: 411 HYTESLRRNPKDPRTYSNRAACYTKLGAM---------PEGLKDADKCIELDPTFSKGYT 461
            Y  ++    K    Y   A    K   +          E     +K  +LDP   +   
Sbjct: 394 QYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKI 453

Query: 462 RKGAIQFFLKEYDKALETYQEGLKHDPQNQELLDG 496
               ++   ++ D+A+  ++E        +E L  
Sbjct: 454 GLAQMKLQQEDIDEAITLFEESADLARTMEEKLQA 488
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query525
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 100.0
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 100.0
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
4eqf_A365 PEX5-related protein; accessory protein, tetratric 100.0
4eqf_A365 PEX5-related protein; accessory protein, tetratric 100.0
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.98
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.98
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.98
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.97
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.97
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.97
3u4t_A272 TPR repeat-containing protein; structural genomics 99.97
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.97
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.96
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.96
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.96
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.96
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.96
3u4t_A272 TPR repeat-containing protein; structural genomics 99.96
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.96
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.96
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.96
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.95
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.95
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.95
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.95
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.95
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.95
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.94
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.94
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.94
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.94
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.93
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.93
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.93
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.93
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.93
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.93
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.93
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.93
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.92
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.92
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.92
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.92
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.92
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.92
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.91
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.91
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.91
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.9
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.9
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.9
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.9
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.89
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.89
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.88
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.88
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.88
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.88
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.88
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.88
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.87
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.87
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.87
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.87
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.87
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.87
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.86
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.86
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.86
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.86
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.85
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.85
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.84
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.84
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.84
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.83
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.83
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.83
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.82
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.82
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.8
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.8
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.79
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.79
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.79
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.79
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.78
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.77
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.77
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.77
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.77
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.76
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.76
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.76
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.76
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.76
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.75
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.75
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.74
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.74
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.74
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.73
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.73
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.72
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.72
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.71
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.7
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.7
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.7
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.7
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.7
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.7
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.69
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.69
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.69
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.69
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.69
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.69
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.69
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.68
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.68
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.68
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.67
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.67
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.67
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.67
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.66
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.65
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.65
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.65
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.65
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.65
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.64
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.64
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.64
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.64
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.63
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.63
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.63
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.63
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.63
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.62
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.62
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.62
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.61
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.6
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.6
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.59
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.58
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.58
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.58
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.58
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.58
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.58
3k9i_A117 BH0479 protein; putative protein binding protein, 99.56
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.56
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.55
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.55
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.54
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.54
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.54
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.53
3k9i_A117 BH0479 protein; putative protein binding protein, 99.53
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.53
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.53
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.52
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.51
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.51
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.47
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.46
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.42
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.42
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.4
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.38
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.37
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.34
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.31
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.3
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.3
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.27
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.22
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.19
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.17
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.15
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.04
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.01
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.01
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.0
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.98
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.98
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.97
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.95
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.93
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.9
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.83
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.82
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.71
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.65
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.65
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.58
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.57
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.5
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.3
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.14
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.1
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.08
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.08
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.07
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.06
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.79
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.79
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.79
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 97.1
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.79
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.77
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.7
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.68
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 96.59
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.54
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 96.54
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 96.34
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.13
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.96
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 95.96
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 95.8
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 95.66
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 95.43
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.28
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.07
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.02
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.87
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.74
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 94.6
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 94.27
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 93.44
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.2
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 93.08
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 93.02
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 92.76
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.64
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 92.61
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 92.11
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.99
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.93
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 86.67
2lnm_A62 Protein TIC 40, chloroplastic; translocon, import, 86.62
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 84.19
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 83.24
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=1.4e-45  Score=347.61  Aligned_cols=378  Identities=20%  Similarity=0.247  Sum_probs=345.8

Q ss_pred             HHHHHHHHhcCCHHHHHHHHHHHhccCCchhHHHHHHHHHHhhcccHHHHHHHHHHhhccCCCCHHHHHHHHHHHhhhhh
Q 009799            6 KAKGNAAFSSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKKTVELKPDWSKGYSRLGAAHLGLQD   85 (525)
Q Consensus         6 ~~~g~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~   85 (525)
                      +.+|..++..|++++|+..|++++..+|+++.++..+|.++...|++++|+..++++++.+|.++.++..+|.++...|+
T Consensus         3 ~~~a~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~   82 (388)
T 1w3b_A            3 MELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQ   82 (388)
T ss_dssp             CTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTC
T ss_pred             hhHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHCCC
Confidence            45789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhccCCCcHHHHhhHHhHHHHHhhcccCCCCCCCCcccccccCchhhhhcccCCCcccccchHHHHHHHH
Q 009799           86 YIEAVNSYKKGLDIDPNNEALKSGLADAKAAASASFRSRSPPADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMK  165 (525)
Q Consensus        86 ~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (525)
                      +++|+..|+++++.+|++..++..++.++...|+.                                    +.+...+.+
T Consensus        83 ~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~------------------------------------~~A~~~~~~  126 (388)
T 1w3b_A           83 LQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDM------------------------------------EGAVQAYVS  126 (388)
T ss_dssp             HHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCS------------------------------------SHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCH------------------------------------HHHHHHHHH
Confidence            99999999999999999999999999999998876                                    445555555


Q ss_pred             HHhhCCCchhHHhhHHHHHHHHHHHHhhhccCCCCCCccccccccCCCCCCCchhhccCCCCCCCCCChhhhHHHHHHHH
Q 009799          166 DIQRNPNNLNLYLKDQRVMQALGVLLNVKFKGPTGGDDVEMQDEDAPKGPETSKEETRKPESEPEPEPMELTEEEKEAKE  245 (525)
Q Consensus       166 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (525)
                      .+..+|+                                                                         
T Consensus       127 al~~~p~-------------------------------------------------------------------------  133 (388)
T 1w3b_A          127 ALQYNPD-------------------------------------------------------------------------  133 (388)
T ss_dssp             HHHHCTT-------------------------------------------------------------------------
T ss_pred             HHHhCCC-------------------------------------------------------------------------
Confidence            5555555                                                                         


Q ss_pred             hHHHHHHHHHHHHHHHhcccHHHHHHHHHHHhhcCCCCHHHHHHHHHHHHHhcCHHHHHHHHHHHHHccccChhhHHHHH
Q 009799          246 RKEKALKEKEAGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIA  325 (525)
Q Consensus       246 ~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~~l~~~~~~~~~~~~~~  325 (525)
                         ...++..+|.++...|++++|+..|++++..+|++..++..+|.++...|++++|+..|++++..+|++       .
T Consensus       134 ---~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~-------~  203 (388)
T 1w3b_A          134 ---LYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF-------L  203 (388)
T ss_dssp             ---CTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTC-------H
T ss_pred             ---cHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCc-------H
Confidence               444566778888889999999999999999999999999999999999999999999999999998887       5


Q ss_pred             HHHHHhhhhHHHhhhcccchHHHHHHHHHHHhcCCCh--------hHHHHhchHHHHHHHHHHHhhcCCCcHHHHHHhhh
Q 009799          326 RALTRKGTALVKMAKCSKDYEPAIETFQKALTEHRNP--------DTLKKLNEAEKAKKELEQQEIFDPKIADEEREKGN  397 (525)
Q Consensus       326 ~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~~--------~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~l~~  397 (525)
                      .++..+|.++...++    +++|+..|++++...|..        ..+...|++++|+..+++++..+|.++.++..+|.
T Consensus       204 ~~~~~lg~~~~~~~~----~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~  279 (388)
T 1w3b_A          204 DAYINLGNVLKEARI----FDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLAN  279 (388)
T ss_dssp             HHHHHHHHHHHTTTC----TTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCC----HHHHHHHHHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHH
Confidence            667777777777777    999999999999888863        24566788999999999999999999999999999


Q ss_pred             HHHhcCChhHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCchHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhcCHHHHH
Q 009799          398 EFFKQQKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKAL  477 (525)
Q Consensus       398 ~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~  477 (525)
                      ++...|++++|+..|+++++..|+++.++..+|.++...|++++|+..++++++.+|+++.++..+|.++...|++++|+
T Consensus       280 ~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~  359 (388)
T 1w3b_A          280 ALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEAL  359 (388)
T ss_dssp             HHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHH
T ss_pred             HHHHcCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhccCCCCHHHHHHHHHHHHHhhh
Q 009799          478 ETYQEGLKHDPQNQELLDGVRRCVQQINK  506 (525)
Q Consensus       478 ~~~~~a~~~~p~~~~~~~~l~~~~~~~~~  506 (525)
                      ..|+++++++|+++.++..++.++..+|+
T Consensus       360 ~~~~~a~~~~p~~~~a~~~lg~~~~~~~~  388 (388)
T 1w3b_A          360 MHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHhhCCCCHHHHHhHHHHHHHccC
Confidence            99999999999999999999999988763
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 525
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-29
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-28
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-22
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-15
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-08
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-22
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-12
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-12
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 5e-17
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-08
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-08
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-06
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-14
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-14
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-10
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-13
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 8e-12
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.004
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 8e-13
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 3e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 5e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-12
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-10
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 7e-08
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 2e-07
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 6e-04
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 6e-12
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 3e-07
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 3e-06
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-11
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-04
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 0.003
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-11
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-09
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-05
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-10
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-10
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-09
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-08
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.001
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.003
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 8e-09
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-07
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 0.003
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 1e-10
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 2e-10
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-07
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-05
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 0.002
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 8e-10
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 5e-09
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 1e-07
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 0.002
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 5e-09
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-08
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-06
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 5e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.001
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-08
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 3e-07
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 3e-06
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 8e-07
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 2e-06
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 5e-06
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-06
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 9e-06
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 5e-05
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 1e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 3e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 0.004
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  116 bits (290), Expect = 6e-29
 Identities = 55/429 (12%), Positives = 112/429 (26%), Gaps = 63/429 (14%)

Query: 51  NYADALADAKKTVELKPDWSKGYSRLGAAHLGLQDYIEAVNSYKKGLDIDPNNEALKSGL 110
           ++  A     +    +PD +     L + H   +    + +     +  +P      S L
Sbjct: 14  DFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNL 73

Query: 111 ADAKAAASASFRSRSPPADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMMKDIQRN 170
            +          +                       A                      +
Sbjct: 74  GNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPD 133

Query: 171 PNNLNLYLKDQRVMQALGVLLNVKFKGPTGGDDVEMQDEDAPKGPETSKEETRKPESEPE 230
              +   L +                                                  
Sbjct: 134 LYCVRSDLGNLLKAL--------------------------------------------G 149

Query: 231 PEPMELTEEEKEAKERKEKALKEKEAGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNR 290
                     K  + +   A+     G     + E   AI H+  A+ LD   +    N 
Sbjct: 150 RLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINL 209

Query: 291 AAVYLEMGKYEECIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIE 350
             V  E   ++  +    +A+            +A     +G             + AI+
Sbjct: 210 GNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQG-----------LIDLAID 258

Query: 351 TFQKALTEHRNP--------DTLKKLNEAEKAKKELEQQEIFDPKIADEEREKGNEFFKQ 402
           T+++A+    +         + LK+     +A+          P  AD      N   +Q
Sbjct: 259 TYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQ 318

Query: 403 QKYPEAIQHYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTR 462
               EA++ Y ++L   P+    +SN A+   + G + E L    + I + PTF+  Y+ 
Sbjct: 319 GNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSN 378

Query: 463 KGAIQFFLK 471
            G     ++
Sbjct: 379 MGNTLKEMQ 387
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query525
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.98
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.97
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.93
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.93
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.93
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.93
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.9
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.89
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.89
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.89
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.78
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.75
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.75
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.75
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.74
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.73
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.72
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.69
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.69
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.69
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.69
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.68
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.68
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.67
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.65
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.65
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.65
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.64
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.63
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.62
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.57
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.57
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.54
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.51
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.4
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.38
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.37
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.36
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.16
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.11
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.02
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.02
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.74
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.62
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.38
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.09
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.57
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.21
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.38
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.07
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 82.83
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 82.43
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9.2e-44  Score=333.09  Aligned_cols=387  Identities=19%  Similarity=0.240  Sum_probs=326.5

Q ss_pred             HHHHHHHHHhcCCHHHHHHHHHHHhccCCchhHHHHHHHHHHhhcccHHHHHHHHHHhhccCCCCHHHHHHHHHHHhhhh
Q 009799            5 AKAKGNAAFSSGDYEAAVRHFTEAISLSPDNHVLYSNRSAAHASLHNYADALADAKKTVELKPDWSKGYSRLGAAHLGLQ   84 (525)
Q Consensus         5 ~~~~g~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g   84 (525)
                      ++++|..+++.|+|++|+..|+++++.+|+++.++..+|.++..+|++++|+..|+++++.+|+++.++..+|.++..+|
T Consensus         2 ll~la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           2 PMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERG   81 (388)
T ss_dssp             CCTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhc
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHhhccCCCcHHHHhhHHhHHHHHhhcccCCCCCCCCcccccccCchhhhhcccCCCcccccchHHHHHHH
Q 009799           85 DYIEAVNSYKKGLDIDPNNEALKSGLADAKAAASASFRSRSPPADNPFGSAFAGPEMWAKLTADPTTRSYLDQDDFRNMM  164 (525)
Q Consensus        85 ~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (525)
                      ++++|+..+..+...+|...................                                    ........
T Consensus        82 ~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------------------------------~~~~~~~~  125 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDM------------------------------------EGAVQAYV  125 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCS------------------------------------SHHHHHHH
T ss_pred             cccccccccccccccccccccccccccccccccccc------------------------------------cccccccc
Confidence            999999999999999999988877776666555332                                    11222222


Q ss_pred             HHHhhCCCchhHHhhHHHHHHHHHHHHhhhccCCCCCCccccccccCCCCCCCchhhccCCCCCCCCCChhhhHHHHHHH
Q 009799          165 KDIQRNPNNLNLYLKDQRVMQALGVLLNVKFKGPTGGDDVEMQDEDAPKGPETSKEETRKPESEPEPEPMELTEEEKEAK  244 (525)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  244 (525)
                      ......+.................                                          ..............
T Consensus       126 ~~~~~~~~~~~~~~~~~~~~~~~~------------------------------------------~~~~~~~~~~~~~~  163 (388)
T d1w3ba_         126 SALQYNPDLYCVRSDLGNLLKALG------------------------------------------RLEEAKACYLKAIE  163 (388)
T ss_dssp             HHHHHCTTCTHHHHHHHHHHHTTS------------------------------------------CHHHHHHHHHHHHH
T ss_pred             cccccccccccccccccccccccc------------------------------------------hhhhhHHHHHHhhc
Confidence            222333332222221111111100                                          11122233444455


Q ss_pred             HhHHHHHHHHHHHHHHHhcccHHHHHHHHHHHhhcCCCCHHHHHHHHHHHHHhcCHHHHHHHHHHHHHccccChhhHHHH
Q 009799          245 ERKEKALKEKEAGNAAYKKKEFEKAIEHYSSALELDDEDISYLTNRAAVYLEMGKYEECIKDCDKAVERGRELRSDFKMI  324 (525)
Q Consensus       245 ~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~~l~~~~~~~~~~~~~  324 (525)
                      ..|..+..+..+|..+...|++++|...+++++..+|+++.++..+|.++...|++++|+..++++....|..       
T Consensus       164 ~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~-------  236 (388)
T d1w3ba_         164 TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH-------  236 (388)
T ss_dssp             HCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTC-------
T ss_pred             cCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhH-------
Confidence            5666778888889999999999999999999999999999999999999999999999999999998888877       


Q ss_pred             HHHHHHhhhhHHHhhhcccchHHHHHHHHHHHhcCCChhHHHHhchHHHHHHHHHHHhhcCCCcHHHHHHhhhHHHhcCC
Q 009799          325 ARALTRKGTALVKMAKCSKDYEPAIETFQKALTEHRNPDTLKKLNEAEKAKKELEQQEIFDPKIADEEREKGNEFFKQQK  404 (525)
Q Consensus       325 ~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  404 (525)
                      ...+..+|.++...++    +++|+..|+++++                          .+|+++.++..+|.++...|+
T Consensus       237 ~~~~~~l~~~~~~~~~----~~~A~~~~~~al~--------------------------~~p~~~~~~~~l~~~~~~~~~  286 (388)
T d1w3ba_         237 AVVHGNLACVYYEQGL----IDLAIDTYRRAIE--------------------------LQPHFPDAYCNLANALKEKGS  286 (388)
T ss_dssp             HHHHHHHHHHHHHTTC----HHHHHHHHHHHHH--------------------------TCSSCHHHHHHHHHHHHHHSC
T ss_pred             HHHHHHHHHHHHHCCC----HHHHHHHHHHHHH--------------------------hCCCCHHHHHHHHHHHHHcCC
Confidence            5566667777777777    8888888888888                          899999999999999999999


Q ss_pred             hhHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCchHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhcCHHHHHHHHHHHh
Q 009799          405 YPEAIQHYTESLRRNPKDPRTYSNRAACYTKLGAMPEGLKDADKCIELDPTFSKGYTRKGAIQFFLKEYDKALETYQEGL  484 (525)
Q Consensus       405 ~~~A~~~~~~al~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~a~  484 (525)
                      +++|+..++.++...|.++..+..+|.++...|++++|+.+|+++++++|+++.+++.+|.++..+|++++|+.+|++++
T Consensus       287 ~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al  366 (388)
T d1w3ba_         287 VAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI  366 (388)
T ss_dssp             HHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCHHHHHHHHHHHHHhhh
Q 009799          485 KHDPQNQELLDGVRRCVQQINK  506 (525)
Q Consensus       485 ~~~p~~~~~~~~l~~~~~~~~~  506 (525)
                      +++|++++++..++.++.++|+
T Consensus       367 ~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         367 RISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             TTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HhCCCCHHHHHHHHHHHHHcCC
Confidence            9999999999999999998874
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure