Citrus Sinensis ID: 009801


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-----
MPELTSTPKLIICLLILSLYPISLKARPFILVLSQDDIKDSAASTDDESAADWDDFGDSESMTEENLDPGSWSPVFEPSIDPGAINGSYYITISKMMSAVTNGDVRVMEEATSEVESAAMEGDPHARSVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIRIHNGAEENKGALRKSRGEDDEAFQILEYQAQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSMEFLGEIYARGAGVERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYKLVAERGPWSSLSRWALESYLKGDVGKAFLLYSRMAELGYEVAQSNAAWILDKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQGNEHAALLIGDAYYYGRVRHSEGL
ccccccHHHHHHHHHHHHHcccccccHHHHHccccHHHHHHcccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHcHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccHHcHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccc
cccccccHHHHHHHHHHHHccHHHccccEEEEEccccccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccc
MPELTSTPKLIICLLILSlypislkarpFILVLSqddikdsaastddesaadwddfgdsesmteenldpgswspvfepsidpgaingsYYITISKMMSAVTNGDVRVMEEATSEVESaamegdpharSVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDMHDKAVKLYAELAEIAVNSFliskdspviepirihngaeenkgalrksrgeddEAFQILEYQAQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSkaadkgepqsMEFLGEIYARGAGVERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAadneeagghyNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYKLVAergpwsslSRWALESYLKGDVGKAFLLYSRMAELGYEVAQSNAAWILDKygegsmcmgesgfctdaerHQCAHSLWWQASEQGNEHAALLIGDAYYYGRVRHSEGL
MPELTSTPKLIICLLILSLYPISLKARPFILVLSQDDIKDSaastddesaadwddfGDSESMTEENLDPGSWSPVFEPSIDPGAINGSYYITISKMMSAVTNGDVRVMEEATSEVesaamegdphaRSVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIrihngaeenkgalrksrgeDDEAFQILEYQaqkgnagamYKIGLFYYFGLRGLRRDRTKALMWFSkaadkgepqsMEFLGEIYARGAGVERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAadneeagghyNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYKLVAERGPWSSLSRWALESYLKGDVGKAFLLYSRMAELGYEVAQSNAAWILDKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQGNEHAALLIGDAYYYGRVRHSEGL
MPELTSTPKLIICLLILSLYPISLKARPFILVLSQDDIKdsaastddesaadwddfgdSESMTEENLDPGSWSPVFEPSIDPGAINGSYYITISKMMSAVTNGDVRVMEEATSEVESAAMEGDPHARSVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIRIHNGAEENKGALRKSRGEDDEAFQILEYQAQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSMEFLGEIYARGAGVERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYKLVAERGPWSSLSRWALESYLKGDVGKAFLLYSRMAELGYEVAQSNAAWILDKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQGNEHAALLIGDAYYYGRVRHSEGL
********KLIICLLILSLYPISLKARPFILVLS*********************************************IDPGAINGSYYITISKMMSAVTNG************************SVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIRI*********************FQILEYQAQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAA*******MEFLGEIYARGAGVERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYKLVAERGPWSSLSRWALESYLKGDVGKAFLLYSRMAELGYEVAQSNAAWILDKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQGNEHAALLIGDAYYYGRV******
*****STPKLIICLLILSLYPISLKARPFILVL*******************WDDF*************GSWSPVFEPSIDPGAINGSYYITISKMMSAVTNGDVRVMEEATSEVESAAMEGDPHARSVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIRIHNGAEENKGALRKSRGEDDEAFQILEYQAQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSMEFLGEIYARGAGVERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYKLVAERGPWSSLSRWALESYLKGDVGKAFLLYSRMAELGYEVAQSNAAWILDKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQGNEHAALLIGDAYYYGRVRHS***
MPELTSTPKLIICLLILSLYPISLKARPFILVLSQDDIK************DWDDFGD************SWSPVFEPSIDPGAINGSYYITISKMMSAVTNGDVRVMEE***********GDPHARSVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIRIHNGAEE***********DDEAFQILEYQAQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSMEFLGEIYARGAGVERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYKLVAERGPWSSLSRWALESYLKGDVGKAFLLYSRMAELGYEVAQSNAAWILDKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQGNEHAALLIGDAYYYGRVRHSEGL
***LTSTPKLIICLLILSLYPISLKARPFILVLSQDDIKD************WD*FGDSESMTEENLDPGSWSPVFEPSIDPGAINGSYYITISKMMSAVTNGDVRVMEEATSEVESAAMEGDPHARSVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIRIHNGAEENKGALRKSRGEDDEAFQILEYQAQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSMEFLGEIYARGAGVERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYKLVAERGPWSSLSRWALESYLKGDVGKAFLLYSRMAELGYEVAQSNAAWILDKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQGNEHAALLIGDAYYYGR*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPELTSTPKLIICLLILSLYPISLKARPFILVLSQDDIKDSAASTDDESAADWDDFGDSESMTEENLDPGSWSPVFEPSIDPGAINGSYYITISKMMSAVTNGDVRVMEEATSEVESAAMEGDPHARSVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIRIHNGAEENKGALRKSRGEDDEAFQILEYQAQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSMEFLGEIYARGAGVERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYKLVAERGPWSSLSRWALESYLKGDVGKAFLLYSRMAELGYEVAQSNAAWILDKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQGNEHAALLIGDAYYYGRVRHSEGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query525 2.2.26 [Sep-21-2011]
Q5TEA6 688 Protein sel-1 homolog 2 O yes no 0.779 0.594 0.351 1e-55
Q9UBV2 794 Protein sel-1 homolog 1 O no no 0.748 0.494 0.348 5e-54
Q9ESM7 794 Protein sel-1 homolog 1 O N/A no 0.752 0.497 0.345 2e-53
Q80Z70 794 Protein sel-1 homolog 1 O yes no 0.777 0.513 0.339 1e-52
Q9Z2G6 790 Protein sel-1 homolog 1 O yes no 0.777 0.516 0.339 2e-52
Q3V172 688 Protein sel-1 homolog 2 O no no 0.752 0.574 0.35 3e-52
Q5XI05 688 Protein sel-1 homolog 2 O no no 0.777 0.593 0.346 6e-52
Q80TS8 1137 Protein sel-1 homolog 3 O no no 0.704 0.325 0.293 1e-27
Q68CR1 1132 Protein sel-1 homolog 3 O no no 0.704 0.326 0.293 3e-27
P77234325 Uncharacterized protein Y N/A no 0.563 0.910 0.287 4e-19
>sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 Back     alignment and function desciption
 Score =  217 bits (553), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 153/435 (35%), Positives = 237/435 (54%), Gaps = 26/435 (5%)

Query: 93  ISKMMSAVTNGD--VRVMEEATSEVESAAMEGDPHARSVLGFL--YGMGMMRERNKGKAF 148
           + KM  A+  G+  V+ +  A    ES A EG   A++ LGFL  YG+GM  E ++ KA 
Sbjct: 146 MEKMADALLFGNFGVQNITAAIQLYESLAKEGSCKAQNALGFLSSYGIGM--EYDQAKAL 203

Query: 149 LYHHFAAEGGNIQSKMAVAYTYLR-----QDMHDKAVKLYAELAEIAVNSFLISKDSPVI 203
           +Y+ F + GGN+ S+M + Y YL      Q+  + A+  Y ++A+   ++F  S+  PV 
Sbjct: 204 IYYTFGSAGGNMMSQMILGYRYLSGINVLQNC-EVALSYYKKVADYIADTFEKSEGVPV- 261

Query: 204 EPIRIHNGAEENKGALRKSRGEDDEAFQILEYQAQKGNAGAMYKIGLFYYFGLRGLRRDR 263
           E +R+    E  +     S   D + +Q  ++ A++G+      +G  +  G +GL +D 
Sbjct: 262 EKVRL---TERPENLSSNSEILDWDIYQYYKFLAERGDVQIQVSLGQLHLIGRKGLDQDY 318

Query: 264 TKALMWFSKAADKGEPQSMEFLGEIYARG-AGVERNYTKALEWLTHAARQQLYSAYNGIG 322
            KAL +F KAA  G   +M F+G++Y  G A V +N   A ++ + AA +      +G+G
Sbjct: 319 YKALHYFLKAAKAGSANAMAFIGKMYLEGNAAVPQNNATAFKYFSMAASKGNAIGLHGLG 378

Query: 323 YLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVA 382
            LY  G GV   NY +A +YF+KAA+       + LG MYY G G+ +D KLA KYF +A
Sbjct: 379 LLYFHGKGVPL-NYAEALKYFQKAAEKGWPDAQFQLGFMYYSGSGIWKDYKLAFKYFYLA 437

Query: 383 ANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYKLVAERGPWSSLSRWALESYLKGDVGK 442
           + +G   A Y LAKM+ TG G+ ++   A  LYK V E G W+     A  +Y  GD+  
Sbjct: 438 SQSGQPLAIYYLAKMYATGTGVVRSCRTAVELYKGVCELGHWAEKFLTAYFAYKDGDIDS 497

Query: 443 AFLLYSRMAELGYEVAQSNAAWILDKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQG 502
           + + Y+ +AE+GYEVAQSN+A+IL+          ++      + +  A  LW +A+ QG
Sbjct: 498 SLVQYALLAEMGYEVAQSNSAFILES--------KKANILEKEKMYPMALLLWNRAAIQG 549

Query: 503 NEHAALLIGDAYYYG 517
           N  A + IGD +YYG
Sbjct: 550 NAFARVKIGDYHYYG 564





Homo sapiens (taxid: 9606)
>sp|Q9UBV2|SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L PE=1 SV=3 Back     alignment and function description
>sp|Q9ESM7|SE1L1_MESAU Protein sel-1 homolog 1 OS=Mesocricetus auratus GN=Sel1l PE=2 SV=1 Back     alignment and function description
>sp|Q80Z70|SE1L1_RAT Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Sel1l PE=2 SV=2 Back     alignment and function description
>sp|Q9Z2G6|SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus GN=Sel1l PE=2 SV=2 Back     alignment and function description
>sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 Back     alignment and function description
>sp|Q5XI05|SE1L2_RAT Protein sel-1 homolog 2 OS=Rattus norvegicus GN=Sel1l2 PE=2 SV=1 Back     alignment and function description
>sp|Q80TS8|SE1L3_MOUSE Protein sel-1 homolog 3 OS=Mus musculus GN=Sel1l3 PE=2 SV=3 Back     alignment and function description
>sp|Q68CR1|SE1L3_HUMAN Protein sel-1 homolog 3 OS=Homo sapiens GN=SEL1L3 PE=1 SV=2 Back     alignment and function description
>sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query525
255579265 681 conserved hypothetical protein [Ricinus 0.973 0.750 0.793 0.0
118489046 683 unknown [Populus trichocarpa x Populus d 0.961 0.739 0.761 0.0
224135581 683 predicted protein [Populus trichocarpa] 0.961 0.739 0.761 0.0
224118634 682 predicted protein [Populus trichocarpa] 0.971 0.747 0.751 0.0
297850220 678 hypothetical protein ARALYDRAFT_889238 [ 0.969 0.750 0.745 0.0
18394588 678 Hr.3 like protein [Arabidopsis thaliana] 0.969 0.750 0.743 0.0
14532716 678 unknown protein [Arabidopsis thaliana] 0.969 0.750 0.741 0.0
449439463 678 PREDICTED: protein sel-1 homolog 1-like 0.971 0.752 0.738 0.0
449503099 679 PREDICTED: LOW QUALITY PROTEIN: protein 0.973 0.752 0.729 0.0
225456173 674 PREDICTED: protein sel-1 homolog 2 [Viti 0.942 0.734 0.767 0.0
>gi|255579265|ref|XP_002530478.1| conserved hypothetical protein [Ricinus communis] gi|223529975|gb|EEF31901.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/523 (79%), Positives = 462/523 (88%), Gaps = 12/523 (2%)

Query: 7   TPKLIICLLILSLYPISLKARPFILVLSQDDIKDSAASTDDESAA-----DWDDFGDSES 61
           T +    L+I+SL P+SL ARPF+L+LSQDD+KD+ A+ DD S+A     +WD+FGDS+S
Sbjct: 7   TYRFTFSLIIVSLLPLSLTARPFVLLLSQDDLKDAPATVDDSSSATDSPPEWDEFGDSDS 66

Query: 62  MTEENLDPGSWSPVFEPSIDPGAIN------GSYYITISKMMSAVTNGDVRVMEEATSEV 115
             E  LDPGSW P+FEP     + +        YY  + KM+++V++G VR+MEEA +E+
Sbjct: 67  KPEHELDPGSWRPIFEPDSSSSSSSVEDSEMAEYYSGVEKMLASVSDGKVRLMEEAAAEI 126

Query: 116 ESAAMEGDPHARSVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDM 175
           ESAA+ G+PHA+SVLGFLYG+G M+ER+K KAFLYHHFAAE GN+QSKMA+A+TY RQDM
Sbjct: 127 ESAAVSGNPHAQSVLGFLYGLGQMKERDKAKAFLYHHFAAESGNMQSKMALAFTYSRQDM 186

Query: 176 HDKAVKLYAELAEIAVNSFLISKDSPVIEPIRIHNGAEENKGALRKSRGEDDEAFQILEY 235
           HDKAVKLYAELAE+AVNSFLISKDSPVIEP+RIHNGAEENK ALRKSRGE+DE FQILEY
Sbjct: 187 HDKAVKLYAELAEVAVNSFLISKDSPVIEPVRIHNGAEENKEALRKSRGEEDEDFQILEY 246

Query: 236 QAQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSMEFLGEIYARGAGV 295
           QAQKGNAGAMYKIGLFYYFGLRGLRRD  KAL WFSKA  KGEP+SME LGEIYARGAGV
Sbjct: 247 QAQKGNAGAMYKIGLFYYFGLRGLRRDHAKALSWFSKAVKKGEPRSMELLGEIYARGAGV 306

Query: 296 ERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGH 355
           ERNYTKALEWLT A++QQLYSAYNG+GYLYVKGYGVE KNYTKAKEYFEKAA NEEAGGH
Sbjct: 307 ERNYTKALEWLTLASKQQLYSAYNGMGYLYVKGYGVE-KNYTKAKEYFEKAAHNEEAGGH 365

Query: 356 YNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALY 415
           YNLGVMY KGIGVKRDVKLACKYF+VAANAG  KAFYQLAKMFHTGVGLKK+L MATALY
Sbjct: 366 YNLGVMYLKGIGVKRDVKLACKYFIVAANAGQPKAFYQLAKMFHTGVGLKKDLVMATALY 425

Query: 416 KLVAERGPWSSLSRWALESYLKGDVGKAFLLYSRMAELGYEVAQSNAAWILDKYGEGSMC 475
           KLVAERGPWS+LSRWALESYLKGDVGKAFLLY+RMAE+GYE+AQSNAAWILDKYGE SMC
Sbjct: 426 KLVAERGPWSTLSRWALESYLKGDVGKAFLLYARMAEMGYEIAQSNAAWILDKYGERSMC 485

Query: 476 MGESGFCTDAERHQCAHSLWWQASEQGNEHAALLIGDAYYYGR 518
           MGESGFCTDAERHQ AHSLWWQASEQGNEHAALLIGDAYYYGR
Sbjct: 486 MGESGFCTDAERHQRAHSLWWQASEQGNEHAALLIGDAYYYGR 528




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118489046|gb|ABK96330.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|224135581|ref|XP_002322109.1| predicted protein [Populus trichocarpa] gi|222869105|gb|EEF06236.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224118634|ref|XP_002317869.1| predicted protein [Populus trichocarpa] gi|222858542|gb|EEE96089.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297850220|ref|XP_002892991.1| hypothetical protein ARALYDRAFT_889238 [Arabidopsis lyrata subsp. lyrata] gi|297338833|gb|EFH69250.1| hypothetical protein ARALYDRAFT_889238 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18394588|ref|NP_564049.1| Hr.3 like protein [Arabidopsis thaliana] gi|8671775|gb|AAF78381.1|AC069551_14 T10O22.22 [Arabidopsis thaliana] gi|51848591|dbj|BAD42326.1| Hrd3p like protein [Arabidopsis thaliana] gi|332191571|gb|AEE29692.1| Hr.3 like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|14532716|gb|AAK64159.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449439463|ref|XP_004137505.1| PREDICTED: protein sel-1 homolog 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449503099|ref|XP_004161833.1| PREDICTED: LOW QUALITY PROTEIN: protein sel-1 homolog 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225456173|ref|XP_002282611.1| PREDICTED: protein sel-1 homolog 2 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query525
TAIR|locus:2014109 678 EBS5 "AT1G18260" [Arabidopsis 0.969 0.750 0.735 4.7e-206
TAIR|locus:2035047604 AT1G73570 "AT1G73570" [Arabido 0.944 0.821 0.431 2.4e-99
UNIPROTKB|Q5TEA6 688 SEL1L2 "Protein sel-1 homolog 0.779 0.594 0.351 4.5e-59
UNIPROTKB|E1C6X2 791 SEL1L "Uncharacterized protein 0.782 0.519 0.357 5.1e-58
UNIPROTKB|Q9UBV2 794 SEL1L "Protein sel-1 homolog 1 0.780 0.516 0.357 1.7e-57
UNIPROTKB|F1PVX5 794 SEL1L "Uncharacterized protein 0.780 0.516 0.354 1.7e-57
UNIPROTKB|F1MGJ5 840 SEL1L "Uncharacterized protein 0.780 0.488 0.354 2.7e-57
RGD|1311278 688 Sel1l2 "sel-1 suppressor of li 0.779 0.594 0.347 4.6e-57
MGI|MGI:2684964 688 Sel1l2 "sel-1 suppressor of li 0.779 0.594 0.347 5.9e-57
RGD|620147 794 Sel1l "sel-1 suppressor of lin 0.780 0.516 0.352 2.5e-56
TAIR|locus:2014109 EBS5 "AT1G18260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1993 (706.6 bits), Expect = 4.7e-206, P = 4.7e-206
 Identities = 375/510 (73%), Positives = 425/510 (83%)

Query:    10 LIICLLILSLYPISLKARPFILVLSQDDIKXXXXXXXXXXXXXXXXXXXSESMTEENLDP 69
             +I+ LL+ S     + ARP +LVLS DD+                    SE  +EE LDP
Sbjct:     9 VILSLLVFSFIEFGVHARPVVLVLSNDDLNSGGDDNGVGESSDFDEFGESEPKSEEELDP 68

Query:    70 GSWSPVFEPSIDP-GAINGSYYITISKMMSAVTNGDVRVMEEATSEVESAAMEGDPHARS 128
             GSW  +FEP      A +  YY  + K++SA + G+ R+MEEA  E+E+A+  GDPHA+S
Sbjct:    69 GSWRSIFEPDDSTVQAASPQYYSGLKKILSAASEGNFRLMEEAVDEIEAASSAGDPHAQS 128

Query:   129 VLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDMHDKAVKLYAELAE 188
             ++GF+YG+GMMRE++K K+FL+H+FAA GGN+QSKMA+A+TYLRQDMHDKAV+LYAELAE
Sbjct:   129 IMGFVYGIGMMREKSKSKSFLHHNFAAAGGNMQSKMALAFTYLRQDMHDKAVQLYAELAE 188

Query:   189 IAVNSFLISKDSPVIEPIRIHNGAEENKGALRKSRGEDDEAFQILEYQAQKGNAGAMYKI 248
              AVNSFLISKDSPV+EP RIH+G EENKGALRKSRGE+DE FQILEYQAQKGNA AMYKI
Sbjct:   189 TAVNSFLISKDSPVVEPTRIHSGTEENKGALRKSRGEEDEDFQILEYQAQKGNANAMYKI 248

Query:   249 GLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSMEFLGEIYARGAGVERNYTKALEWLTH 308
             GLFYYFGLRGLRRD TKAL WF KA DKGEP+SME LGEIYARGAGVERNYTKALEWLT 
Sbjct:   249 GLFYYFGLRGLRRDHTKALHWFLKAVDKGEPRSMELLGEIYARGAGVERNYTKALEWLTL 308

Query:   309 AARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHYNLGVMYYKGIGV 368
             AA++ LYSA+NGIGYLYVKGYGV+KKNYTKA+EYFEKA DNE+  GHYNLGV+Y KGIGV
Sbjct:   309 AAKEGLYSAFNGIGYLYVKGYGVDKKNYTKAREYFEKAVDNEDPSGHYNLGVLYLKGIGV 368

Query:   369 KRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYKLVAERGPWSSLS 428
              RDV+ A KYF VAANAG  KAFYQLAKMFHTGVGLKKNL MAT+ YKLVAERGPWSSLS
Sbjct:   369 NRDVRQATKYFFVAANAGQPKAFYQLAKMFHTGVGLKKNLEMATSFYKLVAERGPWSSLS 428

Query:   429 RWALESYLKGDVGKAFLLYSRMAELGYEVAQSNAAWILDKYGEGSMCMGESGFCTDAERH 488
             RWALE+YLKGDVGKA +LYSRMAE+GYEVAQSNAAWILDKYGE SMCMG SGFCTD ERH
Sbjct:   429 RWALEAYLKGDVGKALILYSRMAEMGYEVAQSNAAWILDKYGERSMCMGVSGFCTDKERH 488

Query:   489 QCAHSLWWQASEQGNEHAALLIGDAYYYGR 518
             + AHSLWW+ASEQGNEHAALLIGDAYYYGR
Sbjct:   489 ERAHSLWWRASEQGNEHAALLIGDAYYYGR 518


GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0030433 "ER-associated protein catabolic process" evidence=IMP
GO:0042538 "hyperosmotic salinity response" evidence=IMP
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=RCA
TAIR|locus:2035047 AT1G73570 "AT1G73570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TEA6 SEL1L2 "Protein sel-1 homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6X2 SEL1L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBV2 SEL1L "Protein sel-1 homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PVX5 SEL1L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MGJ5 SEL1L "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1311278 Sel1l2 "sel-1 suppressor of lin-12-like 2 (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2684964 Sel1l2 "sel-1 suppressor of lin-12-like 2 (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620147 Sel1l "sel-1 suppressor of lin-12-like (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00150407
hypothetical protein (683 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_scaffold_16186000001
hypothetical protein (119 aa)
       0.505
gw1.I.701.1
hypothetical protein (247 aa)
       0.501

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 2e-29
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 2e-25
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 2e-20
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 2e-12
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 2e-07
smart0067136 smart00671, SEL1, Sel1-like repeats 2e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 9e-05
smart0067136 smart00671, SEL1, Sel1-like repeats 1e-04
smart0067136 smart00671, SEL1, Sel1-like repeats 3e-04
pfam0823838 pfam08238, Sel1, Sel1 repeat 7e-04
smart0067136 smart00671, SEL1, Sel1-like repeats 0.002
pfam0823838 pfam08238, Sel1, Sel1 repeat 0.002
pfam0823838 pfam08238, Sel1, Sel1 repeat 0.004
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
 Score =  117 bits (293), Expect = 2e-29
 Identities = 71/270 (26%), Positives = 108/270 (40%), Gaps = 24/270 (8%)

Query: 226 DDEAFQILEYQ---AQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSM 282
           ++ A   L             A+                D  KAL  + KAA+ G+  ++
Sbjct: 17  EENAVSTLGKLLSEGGDPLMAAVALKSALLNGAGSAYPPDYAKALKSYEKAAELGDAAAL 76

Query: 283 EFLGEIYARGAGVERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEY 342
             LG++Y  G GV R+ TKA +W   AA   L  A   +G +Y  G GV   +  KA +Y
Sbjct: 77  ALLGQMYGAGKGVSRDKTKAADWYRCAAADGLAEALFNLGLMYANGRGV-PLDLVKALKY 135

Query: 343 FEKAADN---EEAGGHYNLGVMYYKG---IGVKRDVKLACKYFLVAANAGHQKAFYQLAK 396
           +EKAA     E A   Y LG+ Y  G   + V  D K A   +  AA  G+  A   L +
Sbjct: 136 YEKAAKLGNVEAALAMYRLGLAYLSGLQALAVAYDDKKALYLYRKAAELGNPDAQLLLGR 195

Query: 397 MFHTGVGLKKNLHMATALYKLVAERGPWSSL--------------SRWALESYLKGDVGK 442
           M+  G+G+ ++L  A   YK  AE+G  ++                   L +  + D  +
Sbjct: 196 MYEKGLGVPRDLKKAFRWYKKAAEQGDGAACYNLGLMYLNGEGVKKAAFLTAAKEEDKKQ 255

Query: 443 AFLLYSRMAELGYEVAQSNAAWILDKYGEG 472
           A     +  ELG++ A      +       
Sbjct: 256 ALEWLQKACELGFDNACEALRALKIGLSAR 285


Length = 292

>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|214772 smart00671, SEL1, Sel1-like repeats Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|214772 smart00671, SEL1, Sel1-like repeats Back     alignment and domain information
>gnl|CDD|214772 smart00671, SEL1, Sel1-like repeats Back     alignment and domain information
>gnl|CDD|219757 pfam08238, Sel1, Sel1 repeat Back     alignment and domain information
>gnl|CDD|214772 smart00671, SEL1, Sel1-like repeats Back     alignment and domain information
>gnl|CDD|219757 pfam08238, Sel1, Sel1 repeat Back     alignment and domain information
>gnl|CDD|219757 pfam08238, Sel1, Sel1 repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 525
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG1550552 consensus Extracellular protein SEL-1 and related 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.95
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.95
KOG1550552 consensus Extracellular protein SEL-1 and related 99.94
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.94
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.93
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.91
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.91
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.91
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.88
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.87
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 99.85
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 99.84
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.84
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.83
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.81
PRK11788389 tetratricopeptide repeat protein; Provisional 99.81
KOG2003 840 consensus TPR repeat-containing protein [General f 99.78
KOG0547606 consensus Translocase of outer mitochondrial membr 99.78
KOG1126638 consensus DNA-binding cell division cycle control 99.77
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.77
KOG1126638 consensus DNA-binding cell division cycle control 99.75
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.72
KOG2003 840 consensus TPR repeat-containing protein [General f 99.72
PLN03218 1060 maturation of RBCL 1; Provisional 99.71
KOG0547606 consensus Translocase of outer mitochondrial membr 99.71
PRK14574 822 hmsH outer membrane protein; Provisional 99.71
PRK14574 822 hmsH outer membrane protein; Provisional 99.7
PLN03218 1060 maturation of RBCL 1; Provisional 99.69
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.67
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.66
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.66
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.65
KOG2076 895 consensus RNA polymerase III transcription factor 99.65
PRK12370553 invasion protein regulator; Provisional 99.65
PRK12370553 invasion protein regulator; Provisional 99.65
KOG4014248 consensus Uncharacterized conserved protein (conta 99.63
KOG1129478 consensus TPR repeat-containing protein [General f 99.61
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.61
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.6
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.59
PRK11189296 lipoprotein NlpI; Provisional 99.59
PRK11189296 lipoprotein NlpI; Provisional 99.59
KOG1129478 consensus TPR repeat-containing protein [General f 99.58
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.57
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.57
PLN03077 857 Protein ECB2; Provisional 99.57
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.56
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.55
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.54
PLN03077 857 Protein ECB2; Provisional 99.54
KOG2076 895 consensus RNA polymerase III transcription factor 99.54
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.53
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.52
KOG1125579 consensus TPR repeat-containing protein [General f 99.51
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.49
KOG1125579 consensus TPR repeat-containing protein [General f 99.49
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.48
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.47
KOG4014248 consensus Uncharacterized conserved protein (conta 99.47
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.45
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.43
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.43
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.43
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.42
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.41
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.35
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.3
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.3
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.29
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.28
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.27
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.25
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.25
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.24
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.24
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.24
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.22
PLN02789320 farnesyltranstransferase 99.2
PLN02789320 farnesyltranstransferase 99.17
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.14
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.14
PRK15359144 type III secretion system chaperone protein SscB; 99.08
PRK15359144 type III secretion system chaperone protein SscB; 99.07
PRK04841 903 transcriptional regulator MalT; Provisional 99.06
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.03
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.0
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.96
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.96
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.96
PRK10370198 formate-dependent nitrite reductase complex subuni 98.94
PRK10370198 formate-dependent nitrite reductase complex subuni 98.91
PRK04841903 transcriptional regulator MalT; Provisional 98.91
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.9
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.9
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.89
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.87
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.86
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.85
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.83
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.81
KOG2376652 consensus Signal recognition particle, subunit Srp 98.8
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.8
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.8
KOG1128777 consensus Uncharacterized conserved protein, conta 98.79
KOG1128777 consensus Uncharacterized conserved protein, conta 98.79
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.78
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.71
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.7
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.69
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.65
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.64
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.62
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.61
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.59
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.54
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.53
PF12688120 TPR_5: Tetratrico peptide repeat 98.52
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.51
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.5
KOG1941518 consensus Acetylcholine receptor-associated protei 98.48
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.47
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.45
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.45
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.44
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.44
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.39
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.38
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.38
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.36
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.35
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.34
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.34
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.34
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.31
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.31
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.31
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.3
KOG0553304 consensus TPR repeat-containing protein [General f 98.29
KOG0553304 consensus TPR repeat-containing protein [General f 98.28
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.27
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.25
PF12688120 TPR_5: Tetratrico peptide repeat 98.25
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.25
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.22
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.21
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.21
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.2
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.19
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.14
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.12
PRK11906458 transcriptional regulator; Provisional 98.12
PRK10803263 tol-pal system protein YbgF; Provisional 98.1
PRK11906458 transcriptional regulator; Provisional 98.1
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.08
KOG1586288 consensus Protein required for fusion of vesicles 98.06
PRK10803263 tol-pal system protein YbgF; Provisional 98.05
KOG1586288 consensus Protein required for fusion of vesicles 98.05
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.03
PRK15331165 chaperone protein SicA; Provisional 98.03
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.03
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.99
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.98
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.98
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.93
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.93
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.9
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.89
KOG4555175 consensus TPR repeat-containing protein [Function 97.87
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.86
PRK15331165 chaperone protein SicA; Provisional 97.85
KOG4555175 consensus TPR repeat-containing protein [Function 97.79
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.76
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.73
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.73
KOG2471696 consensus TPR repeat-containing protein [General f 97.7
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.66
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.66
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.65
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.64
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.63
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.61
COG4700251 Uncharacterized protein conserved in bacteria cont 97.6
KOG2471696 consensus TPR repeat-containing protein [General f 97.59
smart0067136 SEL1 Sel1-like repeats. These represent a subfamil 97.58
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.57
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.52
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.42
PF0823839 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r 97.42
PF13512142 TPR_18: Tetratricopeptide repeat 97.31
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.3
PF1337173 TPR_9: Tetratricopeptide repeat 97.29
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.24
COG4700251 Uncharacterized protein conserved in bacteria cont 97.23
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.21
smart0067136 SEL1 Sel1-like repeats. These represent a subfamil 97.21
PF1337173 TPR_9: Tetratricopeptide repeat 97.12
PF13512142 TPR_18: Tetratricopeptide repeat 97.03
KOG1585308 consensus Protein required for fusion of vesicles 97.01
PF0823839 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r 97.01
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.97
KOG1585308 consensus Protein required for fusion of vesicles 96.97
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.96
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.96
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.86
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.83
PF1342844 TPR_14: Tetratricopeptide repeat 96.78
PF1343134 TPR_17: Tetratricopeptide repeat 96.62
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.56
PF1342844 TPR_14: Tetratricopeptide repeat 96.48
KOG4234271 consensus TPR repeat-containing protein [General f 96.46
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.4
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.39
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.33
KOG2300 629 consensus Uncharacterized conserved protein [Funct 96.33
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.31
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.28
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.27
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.23
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.2
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.18
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.0
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.99
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.92
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.79
PF1343134 TPR_17: Tetratricopeptide repeat 95.71
KOG4648 536 consensus Uncharacterized conserved protein, conta 95.6
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.58
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.54
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.47
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.39
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.36
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.3
KOG4234271 consensus TPR repeat-containing protein [General f 95.3
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.18
KOG4648 536 consensus Uncharacterized conserved protein, conta 95.01
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.97
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.77
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.58
KOG2300629 consensus Uncharacterized conserved protein [Funct 94.06
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.91
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.89
COG3898531 Uncharacterized membrane-bound protein [Function u 93.59
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 93.59
PF03704146 BTAD: Bacterial transcriptional activator domain; 93.07
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 93.03
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.95
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 92.79
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 92.42
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.35
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.96
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.93
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 91.93
KOG2041 1189 consensus WD40 repeat protein [General function pr 91.5
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 91.34
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 90.87
COG3118304 Thioredoxin domain-containing protein [Posttransla 90.69
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.54
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 90.4
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 90.25
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 89.69
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 89.5
KOG4507 886 consensus Uncharacterized conserved protein, conta 88.72
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.63
COG4649221 Uncharacterized protein conserved in bacteria [Fun 88.23
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 88.0
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.88
KOG4507886 consensus Uncharacterized conserved protein, conta 87.65
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.65
COG3898531 Uncharacterized membrane-bound protein [Function u 87.65
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 87.54
COG4649221 Uncharacterized protein conserved in bacteria [Fun 87.53
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 87.09
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 86.87
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 86.87
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 85.96
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 85.92
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 85.36
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 85.15
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 84.52
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 84.29
COG3118304 Thioredoxin domain-containing protein [Posttransla 84.02
KOG2041 1189 consensus WD40 repeat protein [General function pr 83.61
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 83.25
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 81.56
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 81.51
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 81.3
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 80.73
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 80.57
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 80.1
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3e-34  Score=273.89  Aligned_cols=365  Identities=19%  Similarity=0.120  Sum_probs=321.2

Q ss_pred             CcccHHHHHHHHHHHhhcCChHhHHHHHHHHHHHH--hcCChHHHHHHHHhhhcCCCccCCHHHHHHHHHHHHcCC--CH
Q 009801           85 INGSYYITISKMMSAVTNGDVRVMEEATSEVESAA--MEGDPHARSVLGFLYGMGMMRERNKGKAFLYHHFAAEGG--NI  160 (525)
Q Consensus        85 ~~a~~~l~~~~~~~~~~~~~~~~~~~A~~~~~~a~--~~~~~~a~~~lg~~y~~g~g~~~d~~~A~~~~~~a~~~~--~~  160 (525)
                      ++++-.+|.++-.       .++++.|+.+|+.+.  ++.+.+++.++|..+..    .++.+.|...|..|++.+  ..
T Consensus       116 ae~ysn~aN~~ke-------rg~~~~al~~y~~aiel~p~fida~inla~al~~----~~~~~~a~~~~~~alqlnP~l~  184 (966)
T KOG4626|consen  116 AEAYSNLANILKE-------RGQLQDALALYRAAIELKPKFIDAYINLAAALVT----QGDLELAVQCFFEALQLNPDLY  184 (966)
T ss_pred             HHHHHHHHHHHHH-------hchHHHHHHHHHHHHhcCchhhHHHhhHHHHHHh----cCCCcccHHHHHHHHhcCcchh
Confidence            4455555655443       788899999998875  66788999999998888    788889999999988764  57


Q ss_pred             HHHHHHHHHHhccccHHHHHHHHHHHHHHHHhhhhccCCCCCchhhhhcccchhhhhHhhhccCCcHHHHHHHHHHH--H
Q 009801          161 QSKMAVAYTYLRQDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIRIHNGAEENKGALRKSRGEDDEAFQILEYQA--Q  238 (525)
Q Consensus       161 ~a~~~la~~y~~~~~~~~A~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~--~  238 (525)
                      .+...+|.++...|+..+|...|.++++..+..                ...+.++|-+...+|+...|+..|++++  +
T Consensus       185 ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~f----------------AiawsnLg~~f~~~Gei~~aiq~y~eAvkld  248 (966)
T KOG4626|consen  185 CARSDLGNLLKAEGRLEEAKACYLKAIETQPCF----------------AIAWSNLGCVFNAQGEIWLAIQHYEEAVKLD  248 (966)
T ss_pred             hhhcchhHHHHhhcccchhHHHHHHHHhhCCce----------------eeeehhcchHHhhcchHHHHHHHHHHhhcCC
Confidence            788889999999999999999999988764432                2346789999999999999999999985  5


Q ss_pred             cCCHHHHHHHHHHHHhcCCCCccCHHHHHHHHHHHHhc--CCHHHHHHHHHHHHcCCCCCCCHHHHHHHHHHHHHcC--C
Q 009801          239 KGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADK--GEPQSMEFLGEIYARGAGVERNYTKALEWLTHAARQQ--L  314 (525)
Q Consensus       239 ~~~~~a~~~Lg~~y~~~~~~~~~~~~~A~~~~~~a~~~--~~~~a~~~Lg~~y~~g~~~~~~~~~A~~~~~~a~~~~--~  314 (525)
                      |+.++|+++||.+|...     +.+++|+..|.+|+..  +++.++-+||.+|..    +|..+.|+..|+++++..  .
T Consensus       249 P~f~dAYiNLGnV~ke~-----~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYye----qG~ldlAI~~Ykral~~~P~F  319 (966)
T KOG4626|consen  249 PNFLDAYINLGNVYKEA-----RIFDRAVSCYLRALNLRPNHAVAHGNLACIYYE----QGLLDLAIDTYKRALELQPNF  319 (966)
T ss_pred             CcchHHHhhHHHHHHHH-----hcchHHHHHHHHHHhcCCcchhhccceEEEEec----cccHHHHHHHHHHHHhcCCCc
Confidence            68999999999999877     4999999999999976  788999999999999    999999999999999874  8


Q ss_pred             HHHHHHHHHHHHhCCCCCccCHHHHHHHHHHHHhC--CChhHHHHHHHHHHcCCCCcCCHHHHHHHHHHHHHc--CCHHH
Q 009801          315 YSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADN--EEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVAANA--GHQKA  390 (525)
Q Consensus       315 ~~a~~~lg~~~~~g~~~~~~~~~~A~~~~~~a~~~--~~~~a~~~lg~~y~~g~~~~~~~~~A~~~~~~a~~~--~~~~a  390 (525)
                      ++++.+||..+..     +|+..+|..+|.+++..  ..++++++||.+|.+    ++.+++|...|+++++.  +.+.+
T Consensus       320 ~~Ay~NlanALkd-----~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E----~~~~e~A~~ly~~al~v~p~~aaa  390 (966)
T KOG4626|consen  320 PDAYNNLANALKD-----KGSVTEAVDCYNKALRLCPNHADAMNNLGNIYRE----QGKIEEATRLYLKALEVFPEFAAA  390 (966)
T ss_pred             hHHHhHHHHHHHh-----ccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHH----hccchHHHHHHHHHHhhChhhhhh
Confidence            9999999999976     68999999999999987  689999999999999    99999999999999987  67889


Q ss_pred             HHHHHHHHHcCCCCcCCHHHHHHHHHHHHHcCC--hHHHHHHHHHHHhcCCHHHHHHHHHHHHHcC--hHHHHHHHHHHH
Q 009801          391 FYQLAKMFHTGVGLKKNLHMATALYKLVAERGP--WSSLSRWALESYLKGDVGKAFLLYSRMAELG--YEVAQSNAAWIL  466 (525)
Q Consensus       391 ~~~l~~~y~~g~g~~~~~~~A~~~~~~a~~~~~--~~a~~~l~~~~~~~g~~~~A~~~~~~a~~~~--~~~a~~~la~~~  466 (525)
                      +.+||.+|..    ++++++|+..|+.|+.+.|  ++++.++|.+|-.+|+...|+.+|.+|+..+  ..+|+.|||.+|
T Consensus       391 ~nNLa~i~kq----qgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi~  466 (966)
T KOG4626|consen  391 HNNLASIYKQ----QGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSNLASIY  466 (966)
T ss_pred             hhhHHHHHHh----cccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHHh
Confidence            9999999998    9999999999999999987  6789999999999999999999999999875  678999999999


Q ss_pred             hhhCCCccccCCCCCCCChHhHHHHHHHHHHHHhCC--CHHHHHHHHHHH
Q 009801          467 DKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQG--NEHAALLIGDAY  514 (525)
Q Consensus       467 ~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~a~~~~--~~~a~~~lg~~y  514 (525)
                      ..                .++..+||.-|+.|++..  .++|.-+|..+.
T Consensus       467 kD----------------sGni~~AI~sY~~aLklkPDfpdA~cNllh~l  500 (966)
T KOG4626|consen  467 KD----------------SGNIPEAIQSYRTALKLKPDFPDAYCNLLHCL  500 (966)
T ss_pred             hc----------------cCCcHHHHHHHHHHHccCCCCchhhhHHHHHH
Confidence            76                668899999999999864  688888877654



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00671 SEL1 Sel1-like repeats Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>smart00671 SEL1 Sel1-like repeats Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
2xm6_A490 Crystal Structure Of The Protein Corresponding To L 2e-20
1ouv_A273 Helicobacter Cysteine Rich Protein C (Hcpc) Length 7e-15
1ouv_A273 Helicobacter Cysteine Rich Protein C (Hcpc) Length 1e-10
>pdb|2XM6|A Chain A, Crystal Structure Of The Protein Corresponding To Locus C5321 From Cft073 E.Coli Strain Length = 490 Back     alignment and structure

Iteration: 1

Score = 97.4 bits (241), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 90/314 (28%), Positives = 143/314 (45%), Gaps = 40/314 (12%) Query: 237 AQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSMEFLGEIYARGAGVE 296 A KG A +G+ Y+ G G++ D+ +++ WF AA++G + +G+ Y G GV Sbjct: 106 ALKGLPQAQQNLGVMYHEG-NGVKVDKAESVKWFRLAAEQGRDSGQQSMGDAYFEGDGVT 164 Query: 297 RNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHY 356 R+Y A EW + AA Q + N +GY+Y +G GVE+ + A+ Y + A +E G Sbjct: 165 RDYVMAREWYSKAAEQGNVWSCNQLGYMYSRGLGVERNDAISAQWYRKSATSGDEL-GQL 223 Query: 357 NLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKMFHTGVGLKKNLHMATALYK 416 +L MYY GIGV +D + F +A G+ A ++L + G+ K A Y+ Sbjct: 224 HLADMYYFGIGVTQDYTQSRVLFSQSAEQGNSIAQFRLGYILEQGLAGAKEPLKALEWYR 283 Query: 417 LVAERGPWSSLSRWALESYLKGDVG------KAFLLYSRMAELGYEVAQSNAAWILDKYG 470 AE+G S + Y KG G +A Y++ AE G AQ+N I + G Sbjct: 284 KSAEQGN-SDGQYYLAHLYDKGAEGVAKNREQAISWYTKSAEQGDATAQANLGAIYFRLG 342 Query: 471 E--------------------------GSMCMGESGFCTDAERHQCAHSLWW-QASEQGN 503 G+ + G D ++ ++W +A+EQG Sbjct: 343 SEEEHKKAVEWFRKAAAKGEKAAQFNLGNALLQGKGVKKDEQQ----AAIWMRKAAEQGL 398 Query: 504 EHAALLIGDAYYYG 517 A + +G+ YYYG Sbjct: 399 SAAQVQLGEIYYYG 412
>pdb|1OUV|A Chain A, Helicobacter Cysteine Rich Protein C (Hcpc) Length = 273 Back     alignment and structure
>pdb|1OUV|A Chain A, Helicobacter Cysteine Rich Protein C (Hcpc) Length = 273 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 2e-87
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 1e-61
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 8e-61
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 5e-59
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 4e-55
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 3e-39
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 6e-32
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 6e-62
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 6e-59
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 6e-54
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 4e-53
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 2e-40
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 1e-26
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 3e-15
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 2e-51
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 9e-45
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 2e-44
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 5e-42
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 8e-41
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 2e-35
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 5e-26
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 4e-16
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 4e-51
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 1e-44
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 2e-41
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 9e-35
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 7e-18
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 4e-13
1klx_A138 Cysteine rich protein B; structural genomics, heli 2e-39
1klx_A138 Cysteine rich protein B; structural genomics, heli 4e-33
1klx_A138 Cysteine rich protein B; structural genomics, heli 3e-32
1klx_A138 Cysteine rich protein B; structural genomics, heli 8e-12
1klx_A138 Cysteine rich protein B; structural genomics, heli 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-08
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 8e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-04
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 1e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 7e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 8e-04
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
 Score =  277 bits (710), Expect = 2e-87
 Identities = 102/427 (23%), Positives = 175/427 (40%), Gaps = 78/427 (18%)

Query: 103 GDVRVMEEATSEVESAAMEGDPHARSVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQS 162
               +      +++  A  G+  A+  LG+ Y  G    ++  +A  +   AAE G   +
Sbjct: 18  SLPALGNVNLEQLKQKAESGEAKAQLELGYRYFQGNETTKDLTQAMDWFRRAAEQGYTPA 77

Query: 163 KMAVAYTYLR-----QDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIRIHNGAEENKG 217
           +  +   Y+      QD + +AV  Y                                  
Sbjct: 78  EYVLGLRYMNGEGVPQD-YAQAVIWY---------------------------------- 102

Query: 218 ALRKSRGEDDEAFQILEYQAQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKG 277
             +K+              A KG   A   +G+ Y+ G  G++ D+ +++ WF  AA++G
Sbjct: 103 --KKA--------------ALKGLPQAQQNLGVMYHEG-NGVKVDKAESVKWFRLAAEQG 145

Query: 278 EPQSMEFLGEIYARGAGVERNYTKALEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYT 337
                + +G+ Y  G GV R+Y  A EW + AA Q    + N +GY+Y +G GVE+ N  
Sbjct: 146 RDSGQQSMGDAYFEGDGVTRDYVMAREWYSKAAEQGNVWSCNQLGYMYSRGLGVER-NDA 204

Query: 338 KAKEYFEKAADNEEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKM 397
            + +++ K+A + +  G  +L  MYY GIGV +D   +   F  +A  G+  A ++L  +
Sbjct: 205 ISAQWYRKSATSGDELGQLHLADMYYFGIGVTQDYTQSRVLFSQSAEQGNSIAQFRLGYI 264

Query: 398 FHTGVGLKKNLHMATALYKLVAERGPWSSLSRWALESYLKG------DVGKAFLLYSRMA 451
              G+   K    A   Y+  AE+G        A   Y KG      +  +A   Y++ A
Sbjct: 265 LEQGLAGAKEPLKALEWYRKSAEQGNSDGQYYLAH-LYDKGAEGVAKNREQAISWYTKSA 323

Query: 452 ELGYEVAQSNAAWILDKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQGNEHAALLIG 511
           E G   AQ+N   I  + G               E H+ A   + +A+ +G + A   +G
Sbjct: 324 EQGDATAQANLGAIYFRLG-------------SEEEHKKAVEWFRKAAAKGEKAAQFNLG 370

Query: 512 DAYYYGR 518
           +A   G+
Sbjct: 371 NALLQGK 377


>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query525
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 100.0
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 100.0
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 100.0
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 100.0
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.97
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.96
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.96
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.95
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.95
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.94
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.94
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.92
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.92
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.9
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.89
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.88
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.88
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.87
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.86
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.85
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.85
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.85
3u4t_A272 TPR repeat-containing protein; structural genomics 99.85
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.85
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.84
3u4t_A272 TPR repeat-containing protein; structural genomics 99.84
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.84
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.84
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.83
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.83
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.83
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.83
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.83
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.82
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.82
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.8
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.79
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.79
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.79
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.78
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.78
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.76
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.75
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.75
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.74
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.74
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.74
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.74
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.73
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.72
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.71
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.71
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.7
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.7
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.7
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.69
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.69
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.69
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.67
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.67
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.65
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.64
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.63
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.61
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.59
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.59
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.59
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.58
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.57
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.57
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.57
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.56
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.54
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.54
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.53
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.52
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.51
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.5
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.5
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.5
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.49
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.47
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.41
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.38
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.37
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.36
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.36
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.35
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.32
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.32
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.31
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.31
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.3
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.28
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.26
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.25
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.25
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.25
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.23
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.22
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.22
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.22
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.21
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.2
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.19
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.18
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.18
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.18
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.16
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.14
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.12
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.11
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.11
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.1
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.1
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.09
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.08
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.05
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.03
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.03
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.0
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.0
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.0
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.0
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.0
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.0
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.99
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.99
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.98
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.98
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.96
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.96
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.95
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.95
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.94
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.94
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.94
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.94
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.93
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.93
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.91
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.91
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.91
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.91
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.89
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.89
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.88
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.88
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.88
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.86
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.85
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.84
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.84
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.83
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.83
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.82
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.82
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.8
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.8
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.79
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.79
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.78
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.75
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.74
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.74
3k9i_A117 BH0479 protein; putative protein binding protein, 98.72
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.72
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.7
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.64
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.63
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.62
3k9i_A117 BH0479 protein; putative protein binding protein, 98.6
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.57
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.44
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.41
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.4
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.4
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.36
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.36
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.33
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.31
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.3
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.28
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.25
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.1
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.0
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.96
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.85
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.85
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.83
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.79
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.78
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.7
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.66
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.66
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.66
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.62
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.58
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.53
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.48
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.46
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.41
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.37
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.94
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.85
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 95.8
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.78
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 95.14
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.93
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.92
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.46
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.01
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.83
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.8
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.79
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.64
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.79
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.29
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 91.29
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 90.97
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.13
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 88.09
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 86.44
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 84.38
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 83.65
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 80.67
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=1.2e-47  Score=394.41  Aligned_cols=384  Identities=25%  Similarity=0.355  Sum_probs=249.1

Q ss_pred             CccccCCCCCCCCcccHHHHHHHHHHHhhcCChHhHHHHHHHHHHHHhcCChHHHHHHHHhhhcCCCccCCHHHHHHHHH
Q 009801           73 SPVFEPSIDPGAINGSYYITISKMMSAVTNGDVRVMEEATSEVESAAMEGDPHARSVLGFLYGMGMMRERNKGKAFLYHH  152 (525)
Q Consensus        73 ~~~~~~~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~~A~~~~~~a~~~~~~~a~~~lg~~y~~g~g~~~d~~~A~~~~~  152 (525)
                      ...++++++.+++++++.+|..+..   ..+..+++++|+.+|+++++.+++.+++.||.+|..|.|+++|+++|++||+
T Consensus        27 ~~~~~~~a~~g~~~a~~~lg~~y~~---g~~~~~~~~~A~~~~~~a~~~~~~~a~~~Lg~~y~~g~g~~~~~~~A~~~~~  103 (490)
T 2xm6_A           27 LEQLKQKAESGEAKAQLELGYRYFQ---GNETTKDLTQAMDWFRRAAEQGYTPAEYVLGLRYMNGEGVPQDYAQAVIWYK  103 (490)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHH---TSSSCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTSSSCCCHHHHHHHHH
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHc---CCCCCcCHHHHHHHHHHHHHCCCHHHHHHHHHHHHcCCCCCCCHHHHHHHHH
Confidence            4456667788999999999998876   3455788999999999999999999999999999999999999999999999


Q ss_pred             HHHcCCCHHHHHHHHHHHhc----cccHHHHHHHHHHHHHHHHhhhhccCCCCCchhhhhcccchhhhhHhhhccCCcHH
Q 009801          153 FAAEGGNIQSKMAVAYTYLR----QDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIRIHNGAEENKGALRKSRGEDDE  228 (525)
Q Consensus       153 ~a~~~~~~~a~~~la~~y~~----~~~~~~A~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  228 (525)
                      ++++.+++.+++.||.+|..    .+++++|+.+|+++++                                        
T Consensus       104 ~a~~~~~~~a~~~Lg~~y~~g~g~~~~~~~A~~~~~~a~~----------------------------------------  143 (490)
T 2xm6_A          104 KAALKGLPQAQQNLGVMYHEGNGVKVDKAESVKWFRLAAE----------------------------------------  143 (490)
T ss_dssp             HHHHTTCHHHHHHHHHHHHHTSSSCCCHHHHHHHHHHHHH----------------------------------------
T ss_pred             HHHHCCCHHHHHHHHHHHHcCCCCCCCHHHHHHHHHHHHH----------------------------------------
Confidence            99999999999999999988    6777777777777643                                        


Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCccCHHHHHHHHHHHHhcCCHHHHHHHHHHHHcCCCCCCCHHHHHHHHHH
Q 009801          229 AFQILEYQAQKGNAGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSMEFLGEIYARGAGVERNYTKALEWLTH  308 (525)
Q Consensus       229 A~~~~~~~~~~~~~~a~~~Lg~~y~~~~~~~~~~~~~A~~~~~~a~~~~~~~a~~~Lg~~y~~g~~~~~~~~~A~~~~~~  308 (525)
                                .+++.+++.||.+|..+ .++++|+++|+.||+++++.+++.+++.||.+|..|.++.+++++|+.+|++
T Consensus       144 ----------~~~~~a~~~Lg~~y~~g-~g~~~d~~~A~~~~~~a~~~~~~~a~~~Lg~~y~~g~g~~~~~~~A~~~~~~  212 (490)
T 2xm6_A          144 ----------QGRDSGQQSMGDAYFEG-DGVTRDYVMAREWYSKAAEQGNVWSCNQLGYMYSRGLGVERNDAISAQWYRK  212 (490)
T ss_dssp             ----------TTCHHHHHHHHHHHHHT-SSSCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTSSSCCCHHHHHHHHHH
T ss_pred             ----------CCCHHHHHHHHHHHHcC-CCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHhcCCCCCcCHHHHHHHHHH
Confidence                      44555555555555554 2445555555555555555555555555555555555555555555555555


Q ss_pred             HHHcCCHHHHHHHHHHHHhCCCCCccCHHHHHHHHHHHHhCCChhHHHHHHHHHHcCCCCcCCHHHHHHHHHHHHHcCCH
Q 009801          309 AARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVAANAGHQ  388 (525)
Q Consensus       309 a~~~~~~~a~~~lg~~~~~g~~~~~~~~~~A~~~~~~a~~~~~~~a~~~lg~~y~~g~~~~~~~~~A~~~~~~a~~~~~~  388 (525)
                      +++.+++.+++.+|.+|..|.++.. ++++|+.+|+++++.+++.+++.||.+|..|.++.+++++|+.+|+++++.+++
T Consensus       213 a~~~~~~~a~~~lg~~y~~g~g~~~-~~~~A~~~~~~a~~~~~~~a~~~lg~~y~~g~~~~~d~~~A~~~~~~a~~~~~~  291 (490)
T 2xm6_A          213 SATSGDELGQLHLADMYYFGIGVTQ-DYTQSRVLFSQSAEQGNSIAQFRLGYILEQGLAGAKEPLKALEWYRKSAEQGNS  291 (490)
T ss_dssp             HHHTTCHHHHHHHHHHHHHTSSSCC-CHHHHHHHHHHHHTTTCHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHTTTCH
T ss_pred             HHHCCCHHHHHHHHHHHHcCCCCCC-CHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHcCCH
Confidence            5555555555555555555544433 555555555555555555555555555555555555555555555555555555


Q ss_pred             HHHHHHHHHHHcC-CCCcCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhcC---CHHHHHHHHHHHHHcChHHHHHHHHH
Q 009801          389 KAFYQLAKMFHTG-VGLKKNLHMATALYKLVAERGPWSSLSRWALESYLKG---DVGKAFLLYSRMAELGYEVAQSNAAW  464 (525)
Q Consensus       389 ~a~~~l~~~y~~g-~g~~~~~~~A~~~~~~a~~~~~~~a~~~l~~~~~~~g---~~~~A~~~~~~a~~~~~~~a~~~la~  464 (525)
                      .+++.||.+|..+ .++.+++++|+.||+++++.+++.+++++|.++...|   ++++|+.+|+++++.+++.+++++|.
T Consensus       292 ~a~~~Lg~~y~~~~~g~~~~~~~A~~~~~~a~~~~~~~a~~~lg~~y~~~g~~~~~~~A~~~~~~a~~~~~~~a~~~Lg~  371 (490)
T 2xm6_A          292 DGQYYLAHLYDKGAEGVAKNREQAISWYTKSAEQGDATAQANLGAIYFRLGSEEEHKKAVEWFRKAAAKGEKAAQFNLGN  371 (490)
T ss_dssp             HHHHHHHHHHHHCBTTBCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHSCCHHHHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHcCCCCCcCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCcccHHHHHHHHHHHHHCCCHHHHHHHHH
Confidence            5555555555554 4444555555555555555555555555555555544   55555555555555555555555555


Q ss_pred             HHhhhCCCccccCCCCCCCChHhHHHHHHHHHHHHhCCCHHHHHHHHHHHHcccccCCC
Q 009801          465 ILDKYGEGSMCMGESGFCTDAERHQCAHSLWWQASEQGNEHAALLIGDAYYYGRVRHSE  523 (525)
Q Consensus       465 ~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~a~~~~~~~a~~~lg~~y~~g~g~~~~  523 (525)
                      +|..           |.. ..+++++|+.||++|++.++++++++||.+|+.|.||.+|
T Consensus       372 ~y~~-----------g~g-~~~~~~~A~~~~~~A~~~~~~~a~~~Lg~~y~~g~g~~~d  418 (490)
T 2xm6_A          372 ALLQ-----------GKG-VKKDEQQAAIWMRKAAEQGLSAAQVQLGEIYYYGLGVERD  418 (490)
T ss_dssp             HHHH-----------TSS-SCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTSSSCCC
T ss_pred             HHHc-----------CCC-CCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHcCCCCCCC
Confidence            5543           000 1335555555555555555555555555555555555443



>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 525
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 9e-13
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 3e-10
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 2e-09
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 6e-09
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 2e-06
d1klxa_133 a.118.18.1 (A:) Cysteine rich protein B (HcpB) {He 2e-11
d1klxa_133 a.118.18.1 (A:) Cysteine rich protein B (HcpB) {He 1e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-05
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.002
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: HCP-like
family: HCP-like
domain: Cysteine rich protein C (HcpC)
species: Helicobacter pylori [TaxId: 210]
 Score = 66.5 bits (160), Expect = 9e-13
 Identities = 61/275 (22%), Positives = 101/275 (36%), Gaps = 16/275 (5%)

Query: 123 DPHARSVLGFLYGMGMMRERNKGKAFLYHHFAAEGGNIQSKMAVAYTYLRQDMHDKAVKL 182
           DP     LG        +E++  +A  Y   A +         +   Y +    +K +K 
Sbjct: 1   DPKELVGLGAKS----YKEKDFTQAKKYFEKACDLKENSGCFNLGVLYYQGQGVEKNLK- 55

Query: 183 YAELAEIAVNSFLISKDSPVIEPIRIHNGAEENKGALRKSRGEDDEAFQILEYQAQKGNA 242
                     +      +  +      +       + +      ++A Q          A
Sbjct: 56  ---------KAASFYAKACDLNYSNGCHLLGNLYYSGQGVSQNTNKALQYYSKACDLKYA 106

Query: 243 GAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADKGEPQSMEFLGEIYARGAGVERNYTKA 302
                +G  Y+ G + + RD  KA+ +F+KA D  +      LG +Y  G G  ++  KA
Sbjct: 107 EGCASLGGIYHDG-KVVTRDFKKAVEYFTKACDLNDGDGCTILGSLYDAGRGTPKDLKKA 165

Query: 303 LEWLTHAARQQLYSAYNGIGYLYVKGYGVEKKNYTKAKEYFEKAADNEEAGGHYNLGVMY 362
           L     A   +        G +Y  G G  K N+ +A   + KA + E  GG +NLG M 
Sbjct: 166 LASYDKACDLKDSPGCFNAGNMYHHGEGATK-NFKEALARYSKACELENGGGCFNLGAMQ 224

Query: 363 YKGIGVKRDVKLACKYFLVAANAGHQKAFYQLAKM 397
           Y G GV R+ K A + F      G + A   L ++
Sbjct: 225 YNGEGVTRNEKQAIENFKKGCKLGAKGACDILKQL 259


>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Length = 133 Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Length = 133 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query525
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.98
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.97
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.97
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.96
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.84
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.83
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 99.82
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 99.82
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.68
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.66
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.63
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.63
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.62
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.61
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.55
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.51
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.4
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.36
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.28
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.27
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.12
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.08
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.03
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.01
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.01
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.0
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.99
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.97
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.91
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.9
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.89
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.87
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.86
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.85
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.83
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.81
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.75
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.74
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.74
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.72
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.71
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.71
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.65
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.56
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.54
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.54
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.8
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.64
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.62
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.43
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.81
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.64
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.09
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 81.22
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.98  E-value=9.2e-29  Score=241.99  Aligned_cols=363  Identities=17%  Similarity=0.141  Sum_probs=304.8

Q ss_pred             cHHHHHHHHHHHhhcCChHhHHHHHHHHHHHH--hcCChHHHHHHHHhhhcCCCccCCHHHHHHHHHHHHc--CCCHHHH
Q 009801           88 SYYITISKMMSAVTNGDVRVMEEATSEVESAA--MEGDPHARSVLGFLYGMGMMRERNKGKAFLYHHFAAE--GGNIQSK  163 (525)
Q Consensus        88 ~~~l~~~~~~~~~~~~~~~~~~~A~~~~~~a~--~~~~~~a~~~lg~~y~~g~g~~~d~~~A~~~~~~a~~--~~~~~a~  163 (525)
                      ++.+|..++.       .|++++|+..++++.  +|.++.+++.+|.+|..    .+++++|+.+|+++++  ++++.++
T Consensus         2 ll~la~~~~~-------~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~----~~~~~~A~~~~~~al~~~p~~~~a~   70 (388)
T d1w3ba_           2 PMELAHREYQ-------AGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQ----CRRLDRSAHFSTLAIKQNPLLAEAY   70 (388)
T ss_dssp             CCTHHHHHHH-------HTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHH----TTCHHHHHHHHHHHHHHCTTCHHHH
T ss_pred             hHHHHHHHHH-------cCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHH----cCCHHHHHHHHHHHHHhCCCCHHHH
Confidence            3567777776       889999999999964  77899999999999998    8999999999999976  4689999


Q ss_pred             HHHHHHHhccccHHHHHHHHHHHHHHHHhhhhccCCCCCchhhhhcccchhhhhHhhhccCCcHHHHHHHHHHHHc--CC
Q 009801          164 MAVAYTYLRQDMHDKAVKLYAELAEIAVNSFLISKDSPVIEPIRIHNGAEENKGALRKSRGEDDEAFQILEYQAQK--GN  241 (525)
Q Consensus       164 ~~la~~y~~~~~~~~A~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~--~~  241 (525)
                      ..+|.+|...|++++|+..+.++.+..+....                .................+..........  ..
T Consensus        71 ~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~----------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  134 (388)
T d1w3ba_          71 SNLGNVYKERGQLQEAIEHYRHALRLKPDFID----------------GYINLAAALVAAGDMEGAVQAYVSALQYNPDL  134 (388)
T ss_dssp             HHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHH----------------HHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTC
T ss_pred             HHHHHHhhhhcccccccccccccccccccccc----------------cccccccccccccccccccccccccccccccc
Confidence            99999999999999999999999876443211                1222333344445555555555544333  55


Q ss_pred             HHHHHHHHHHHHhcCCCCccCHHHHHHHHHHHHhc--CCHHHHHHHHHHHHcCCCCCCCHHHHHHHHHHHHHc--CCHHH
Q 009801          242 AGAMYKIGLFYYFGLRGLRRDRTKALMWFSKAADK--GEPQSMEFLGEIYARGAGVERNYTKALEWLTHAARQ--QLYSA  317 (525)
Q Consensus       242 ~~a~~~Lg~~y~~~~~~~~~~~~~A~~~~~~a~~~--~~~~a~~~Lg~~y~~g~~~~~~~~~A~~~~~~a~~~--~~~~a  317 (525)
                      .......+......     .....+...+.+.+..  +++.++..+|.++..    .+++++|..+++++++.  +++.+
T Consensus       135 ~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~----~~~~~~A~~~~~~al~~~p~~~~~  205 (388)
T d1w3ba_         135 YCVRSDLGNLLKAL-----GRLEEAKACYLKAIETQPNFAVAWSNLGCVFNA----QGEIWLAIHHFEKAVTLDPNFLDA  205 (388)
T ss_dssp             THHHHHHHHHHHTT-----SCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHT----TTCHHHHHHHHHHHHHHCTTCHHH
T ss_pred             cccccccccccccc-----chhhhhHHHHHHhhccCcchhHHHHhhcccccc----cCcHHHHHHHHHHHHHhCcccHHH
Confidence            66666677766555     4888888888887764  678899999999998    99999999999999876  47899


Q ss_pred             HHHHHHHHHhCCCCCccCHHHHHHHHHHHHhC--CChhHHHHHHHHHHcCCCCcCCHHHHHHHHHHHHHc--CCHHHHHH
Q 009801          318 YNGIGYLYVKGYGVEKKNYTKAKEYFEKAADN--EEAGGHYNLGVMYYKGIGVKRDVKLACKYFLVAANA--GHQKAFYQ  393 (525)
Q Consensus       318 ~~~lg~~~~~g~~~~~~~~~~A~~~~~~a~~~--~~~~a~~~lg~~y~~g~~~~~~~~~A~~~~~~a~~~--~~~~a~~~  393 (525)
                      +..+|.++..     .+++++|+..++++.+.  ..+..+..+|.+|..    .+++++|+.+|+++++.  +++.++..
T Consensus       206 ~~~l~~~~~~-----~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~----~~~~~~A~~~~~~al~~~p~~~~~~~~  276 (388)
T d1w3ba_         206 YINLGNVLKE-----ARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYE----QGLIDLAIDTYRRAIELQPHFPDAYCN  276 (388)
T ss_dssp             HHHHHHHHHT-----TTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHH----TTCHHHHHHHHHHHHHTCSSCHHHHHH
T ss_pred             HHHHhhhhhc-----cccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHH----CCCHHHHHHHHHHHHHhCCCCHHHHHH
Confidence            9999999986     56999999999998865  577888999999999    99999999999999987  67899999


Q ss_pred             HHHHHHcCCCCcCCHHHHHHHHHHHHHcCC--hHHHHHHHHHHHhcCCHHHHHHHHHHHHHc--ChHHHHHHHHHHHhhh
Q 009801          394 LAKMFHTGVGLKKNLHMATALYKLVAERGP--WSSLSRWALESYLKGDVGKAFLLYSRMAEL--GYEVAQSNAAWILDKY  469 (525)
Q Consensus       394 l~~~y~~g~g~~~~~~~A~~~~~~a~~~~~--~~a~~~l~~~~~~~g~~~~A~~~~~~a~~~--~~~~a~~~la~~~~~~  469 (525)
                      +|.++..    .+++++|+.+++++....+  ...+..++.++...|++++|+.+|+++++.  +++.+++++|.++.. 
T Consensus       277 l~~~~~~----~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~-  351 (388)
T d1w3ba_         277 LANALKE----KGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQ-  351 (388)
T ss_dssp             HHHHHHH----HSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHT-
T ss_pred             HHHHHHH----cCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHH-
Confidence            9999998    9999999999999998864  667889999999999999999999999876  578899999999988 


Q ss_pred             CCCccccCCCCCCCChHhHHHHHHHHHHHHhCC--CHHHHHHHHHHHH
Q 009801          470 GEGSMCMGESGFCTDAERHQCAHSLWWQASEQG--NEHAALLIGDAYY  515 (525)
Q Consensus       470 ~~~~~~~~~~~~~~~~~~~~~A~~~~~~a~~~~--~~~a~~~lg~~y~  515 (525)
                                     .+++++|+.+|++|++..  +++++.+||.+|.
T Consensus       352 ---------------~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~  384 (388)
T d1w3ba_         352 ---------------QGKLQEALMHYKEAIRISPTFADAYSNMGNTLK  384 (388)
T ss_dssp             ---------------TTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHH
T ss_pred             ---------------cCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHH
Confidence                           667899999999999865  7999999999986



>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure