Citrus Sinensis ID: 009819


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520----
MWNCGIGPIKTYLRYNALSFFFLQVRELSWLQWHPFSVSSSPLEGKYHSSVLIKVLGEWTENLRDYILSKSESDSQVGPPPPVPPPEGHPPPVHPPQGPVRNLMYENLILVAGGISEANPHVGPPLPVPPPQGAPPPGPPLQEEGPPPQGPHPPVPPPQGPPPPLPPPKGNLMYENLIVVAGGISETEPQVGPPPPVPPPQGSPPQRPPPSRHPLLPPTKITASVEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKSNELSLLSNFYKESICPFFSDKLNLETFIYVTRETEPPLEEGELHKTMSSSIYPVPSGCAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFNIHSWWYKGLLFLACMVGGVLIFGGTVIGFWHLWERKSSARENYKDDSIEVDNAQNVGTMAHNDIRKKDTKSSTNILYGSRPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSLMRECHDPIFHFHSHSFDL
cccccccccccccccccccEEEEEcccccccccccEEEEEcccccccEEEEEEEEcccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccEEEEEccccHHHHHHHHHHHHHHHHccccccccEEEEEEEEccccHHHHHHHHHHHccccccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHccccccccccEEEEEEccccc
ccccccccccccccEcccEEEEEEcccccEcEEccEEEEccccccccEEEEEEEccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccEEEEEEccccHHHHHHHHccccccccccEEEEEcccccccHHHccccEEEEEEccccHHHHHHHHHHHHHHHcccccccccEEEEEEEEccHHHHHHHHHHHHHHcccccccccEEEEEEEEEccccccccccccHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccccccccccccccccccHHHHHcccEEEEcccccHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHccccccccccEEEEEEEEEcc
mwncgigpiktyLRYNALSFFFLQVRELswlqwhpfsvsssplegkyhSSVLIKVLGEWTENLRDYILSksesdsqvgppppvpppeghpppvhppqgpvrnlMYENLILVAGgiseanphvgpplpvpppqgapppgpplqeegpppqgphppvpppqgpppplpppkgnlmyENLIVVAGgisetepqvgppppvpppqgsppqrpppsrhpllpptkitasvegpyghevpyHLMYENLILVAGGIGISPFLAILSDILHRInegksclprnVLIVWAVKKSNELSLLSNfykesicpffsdklnLETFIYVtreteppleegelhktmsssiypvpsgcAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILyvnpfnihSWWYKGLLFLACMVGGVLIFGGTVIGFWHLWErkssarenykddsievdnaqnvgtmahndirkkdtksstnilygsrpdfkeifgstskkwghvdvgvivcgppslqssVAKEIrshslmrechdpifhfhshsfdl
MWNCGIGPIKTYLRYNALSFFFLQVRELSWLQWHPFSVSSSPLEGKYHSSVLIKVLGEWTENLRDYILSKSESDSQVGPPPPVPPPEGHPPPVHPPQGPVRNLMYENLILVAGGISEANPHVGPPLPVPPPQGAPPPGPPLQEEGPPPQGPHPPVPPPQGPPPPLPPPKGNLMYENLIVVAGGISETEPQVGPPPPVPPPQGSPPQRPPPSRHPLLPPTKITASVEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKSNELSLLSNFYKESICPFFSDKLNLETFIYVTREteppleegelHKTMSSSIYPVPSGCAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFNIHSWWYKGLLFLACMVGGVLIFGGTVIGFWHLWERKSSARENYKddsievdnaqnvgtmahndirkkdtksstnilygsrPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSLMRECHDPIFHFHSHSFDL
MWNCGIGPIKTYLRYNALSFFFLQVRELSWLQWHPFSVSSSPLEGKYHSSVLIKVLGEWTENLRDYILSKSESDSqvgppppvpppeghpppvhppqgpvRNLMYENLILVAGGISEANphvgpplpvpppqgapppgpplqeegpppqgphppvpppqgpppplpppKGNLMYENLIVVAGGISETEpqvgppppvpppqgsppqrpppsrhpllppTKITASVEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKSNELSLLSNFYKESICPFFSDKLNLETFIYVTRETEPPLEEGELHKTMSSSIYPVPSGCAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFNIHSWWYKGLLFLACMVGGVLIFGGTVIGFWHLWERKSSARENYKDDSIEVDNAQNVGTMAHNDIRKKDTKSSTNILYGSRPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSLMRECHDPIFHFHSHSFDL
*WNCGIGPIKTYLRYNALSFFFLQVRELSWLQWHPFSVSSSPLEGKYHSSVLIKVLGEWTENLRDYIL*********************************NLMYENLILVAGGI********************************************************LMYENLIVVAGG****************************************SVEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKSNELSLLSNFYKESICPFFSDKLNLETFIYVTR*****************SIYPVPSGCAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFNIHSWWYKGLLFLACMVGGVLIFGGTVIGFWHLWER***************************************ILYGSRPDFKEIFGSTSKKWGHVDVGVIVCGPPS*************LMRECHDPIFHF*******
*WNCGI*PIKTYLRYNALSFFFLQVRELSWLQWHPFSVSSSPLEGKYHSSVLIKVLGEWTENLRDYIL*************PVPPPEGHPPPVHPPQGPVRNLMYENLILVAGGISEANPHVG********************************************PKGNLMYENLIVVAGGISETEPQVG***************************KITASVEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKSNELSLLSNFYKESI*PFFSDKLNLETFIYVTRET**********************************NVWSGLYVISSTVGFIILVALLNILYVNPFNIHSWWYKGLLFLACMVGGVLIFGGTVIGFWHL*********************************KKDTKSSTNILYGSRPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSLMRECHDPIFHFHSHSFDL
MWNCGIGPIKTYLRYNALSFFFLQVRELSWLQWHPFSVSSSPLEGKYHSSVLIKVLGEWTENLRDYILSKS**************PEGHPPPVHPPQGPVRNLMYENLILVAGGISEANPHVGPPLPVPPP*****************************PPPPLPPPKGNLMYENLIVVAGGISET************************RHPLLPPTKITASVEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKSNELSLLSNFYKESICPFFSDKLNLETFIYVTRETEPPLEEGELHKTMSSSIYPVPSGCAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFNIHSWWYKGLLFLACMVGGVLIFGGTVIGFWHLWERKSSARENYKDDSIEVDNAQNVGTMAHNDIRKKDTKSSTNILYGSRPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSLMRECHDPIFHFHSHSFDL
*WNCGIGPIKTYLRYNALSFFFLQVRELSWLQWHPFSVSSSPLEGKYHSSVLIKVLGEWTENLRDYILSK********PPPPVPPPEGHPPPVHPPQGPVRNLMYENLILVAGGISEANPHVGPPLPVPPPQGAPPPGPPLQEEGPPPQGPHPPVPPPQGPPPPLPPPKGNLMYENLIVVAGGISETEPQVGPPPPVPPPQGSPPQRPPPSRHPLLPPTKITASVEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKSNELSLLSNFYKESICPFFSDKLNLETFIYVTRETEPPLEEGELHKTMSSSIYPVPSGCAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFNIHSWWYKGLLFLACMVGGVLIFGGTVIGFWHLWERKSS*************************IRKKDTKSSTNILYGSRPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSLMRECHDPIFHFHSHSFDL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWNCGIGPIKTYLRYNALSFFFLQVRELSWLQWHPFSVSSSPLEGKYHSSVLIKVLGEWTENLRDYILSKSESDSQVGPPPPVPPPEGHPPPVHPPQGPVRNLMYENLILVAGGISEANPHVGPPLPVPPPQGAPPPGPPLQEEGPPPQGPHPPVPPPQGPPPPLPPPKGNLMYENLIVVAGGISETEPQVGPPPPVPPPQGSPPQRPPPSRHPLLPPTKITASVEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKSNELSLLSNFYKESICPFFSDKLNLETFIYVTRETEPPLEEGELHKTMSSSIYPVPSGCAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFNIHSWWYKGLLFLACMVGGVLIFGGTVIGFWHLWERKSSARENYKDDSIEVDNAQNVGTMAHNDIRKKDTKSSTNILYGSRPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSLMRECHDPIFHFHSHSFDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query524 2.2.26 [Sep-21-2011]
Q8RWS6738 Ferric reduction oxidase yes no 0.656 0.466 0.535 1e-105
Q3KTM0747 Ferric reduction oxidase no no 0.658 0.461 0.534 1e-104
Q9FLW2707 Ferric reduction oxidase no no 0.566 0.420 0.307 7e-25
Q8W110699 Ferric reduction oxidase no no 0.564 0.423 0.283 7e-22
P92949725 Ferric reduction oxidase no no 0.526 0.380 0.247 1e-14
Q9LMM2704 Probable ferric reduction no no 0.503 0.375 0.271 3e-13
Q8VY13728 Ferric reduction oxidase no no 0.209 0.151 0.382 1e-09
F4I4K7717 Ferric reduction oxidase no no 0.181 0.132 0.346 6e-06
>sp|Q8RWS6|FRO6_ARATH Ferric reduction oxidase 6 OS=Arabidopsis thaliana GN=FRO6 PE=2 SV=1 Back     alignment and function desciption
 Score =  381 bits (979), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/368 (53%), Positives = 253/368 (68%), Gaps = 24/368 (6%)

Query: 167 PPKGNLMYENLIVVAGG-ISETEPQVGPPPPVPPPQGSPPQRPPPSRHPLLPPTKITASV 225
           P  GN     LI V GG  ++   Q+           +  Q   P  +P     KIT  V
Sbjct: 385 PLDGNHHVAVLIKVLGGWTAKLRDQLSNLYEAE----NQDQLISPQSYP-----KITTCV 435

Query: 226 EGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKS 285
           EGPYGHE PYHL YENL+LVAGGIGI+PF AILSDILHR  +GK+CLP  VL+VWA+K S
Sbjct: 436 EGPYGHESPYHLAYENLVLVAGGIGITPFFAILSDILHRKRDGKACLPSKVLVVWAIKNS 495

Query: 286 NELSLLSNFYKESICPFFSDKLNLETFIYVTRETEPPLEEGELHKTMSSSI-YPVPSGCA 344
           +ELSLLS     SICPFFS KLNLE  IY+TR++EP LE+G +HK +  S+  P  +GC+
Sbjct: 496 DELSLLSAIDIPSICPFFSKKLNLEIHIYITRQSEPRLEDGMVHKVVHPSVKLPRTNGCS 555

Query: 345 MSVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFNIHSWWYKGLLFLACMVGGVL 404
           MSVLVGTG+N+WSGLY+I ST+GFI ++ LL+I Y+  +NI +WWYKGLLF+ CMV  VL
Sbjct: 556 MSVLVGTGDNIWSGLYLIISTIGFISMITLLDIFYIKRYNITTWWYKGLLFVGCMVASVL 615

Query: 405 IFGGTVIGFWHLWERKSSARENYKDDSIEVDNAQNVGTMAHN----DIR----KKDTKSS 456
           IFGG V+ FWH WE K+   E   +D ++++     G   HN    +++    ++D ++ 
Sbjct: 616 IFGGLVVVFWHRWEHKTGEVEANGNDKVDLN-----GEETHNPSAAELKGLAIEEDVQNY 670

Query: 457 TNILYGSRPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSLMRECHDPIFH 516
           T I YG+RP F+EIF S + KWG VDVGVIVCGP +LQ++VAKEIRSHS+ R  + P+FH
Sbjct: 671 TTIRYGTRPAFREIFESLNGKWGSVDVGVIVCGPATLQTTVAKEIRSHSIWRSANHPLFH 730

Query: 517 FHSHSFDL 524
           F+SHSFDL
Sbjct: 731 FNSHSFDL 738




Ferric chelate reductase involved in iron uptake by shoot and leaf cells. May participate in the transport of electrons to a Fe(3+) ion via FAD and heme intermediates.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 6EC: .EC: 1EC: .EC: 7
>sp|Q3KTM0|FRO7_ARATH Ferric reduction oxidase 7, chloroplastic OS=Arabidopsis thaliana GN=FRO7 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLW2|FRO5_ARATH Ferric reduction oxidase 5 OS=Arabidopsis thaliana GN=FRO5 PE=2 SV=1 Back     alignment and function description
>sp|Q8W110|FRO4_ARATH Ferric reduction oxidase 4 OS=Arabidopsis thaliana GN=FRO4 PE=2 SV=1 Back     alignment and function description
>sp|P92949|FRO2_ARATH Ferric reduction oxidase 2 OS=Arabidopsis thaliana GN=FRO2 PE=1 SV=2 Back     alignment and function description
>sp|Q9LMM2|FRO1_ARATH Probable ferric reduction oxidase 1 OS=Arabidopsis thaliana GN=FRO1 PE=2 SV=1 Back     alignment and function description
>sp|Q8VY13|FRO8_ARATH Ferric reduction oxidase 8, mitochondrial OS=Arabidopsis thaliana GN=FRO8 PE=2 SV=1 Back     alignment and function description
>sp|F4I4K7|FRO3_ARATH Ferric reduction oxidase 3, mitochondrial OS=Arabidopsis thaliana GN=FRO3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query524
255556713 735 ferric-chelate reductase, putative [Rici 0.671 0.478 0.612 1e-124
359486141 735 PREDICTED: ferric reduction oxidase 7, c 0.593 0.423 0.663 1e-122
297739426 735 unnamed protein product [Vitis vinifera] 0.593 0.423 0.663 1e-122
224057952 734 predicted protein [Populus trichocarpa] 0.576 0.411 0.663 1e-118
357448309 740 NADPH oxidase [Medicago truncatula] gi|8 0.583 0.413 0.663 1e-116
356555827 732 PREDICTED: probable ferric reductase tra 0.576 0.412 0.651 1e-113
449431912 740 PREDICTED: ferric reduction oxidase 7, c 0.578 0.409 0.598 1e-105
356532942 734 PREDICTED: uncharacterized protein LOC10 0.547 0.391 0.644 1e-105
110739950479 FRO2-like protein [Arabidopsis thaliana] 0.656 0.718 0.535 1e-103
8978270 721 FRO2-like protein; NADPH oxidase-like [A 0.656 0.477 0.535 1e-103
>gi|255556713|ref|XP_002519390.1| ferric-chelate reductase, putative [Ricinus communis] gi|223541457|gb|EEF43007.1| ferric-chelate reductase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 220/359 (61%), Positives = 264/359 (73%), Gaps = 7/359 (1%)

Query: 166 PPPKGNLMYENLIVVAGGISETEPQVGPPPPVPPPQGSPPQRPPPSRHPLLPPTKITASV 225
            P  G      LI V G    TE   G        + +  Q  P   HP     KITA V
Sbjct: 384 SPLDGKYHLTILIKVLG--KWTEKLRGNVKNRSEAEVAELQDQPSQPHP-----KITACV 436

Query: 226 EGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKS 285
           EGPYGHEVPYHLMYENLILVAGGIGISPFLAILSD+LHRINE ++CLP+N+L+ WA+KKS
Sbjct: 437 EGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDVLHRINEERACLPKNILVTWAIKKS 496

Query: 286 NELSLLSNFYKESICPFFSDKLNLETFIYVTRETEPPLEEGELHKTMSSSIYPVPSGCAM 345
           +EL LLS    ESICP+FSDKLNLE  IYVTRET   LEEG +HK  +SS+     GC M
Sbjct: 497 SELPLLSTIDMESICPYFSDKLNLEVHIYVTRETYAQLEEGLVHKATNSSVITSSKGCGM 556

Query: 346 SVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFNIHSWWYKGLLFLACMVGGVLI 405
           SVLVGTG+N+WSGLYVI S++GF+IL+ L+++ Y+N + IHSWWYKGLLF+ACMV  +L+
Sbjct: 557 SVLVGTGDNIWSGLYVIISSMGFVILLGLVDVYYINEYGIHSWWYKGLLFIACMVVSILV 616

Query: 406 FGGTVIGFWHLWERKSSARENYKDDSIEVDNAQNVGTMAHNDIRKKDTKSSTNILYGSRP 465
           FGG V+G WHLWE K SA E  KD+ ++    +N   +A+ D+  K+  SST I YGSRP
Sbjct: 617 FGGCVVGLWHLWEMKMSALEENKDNGLKTREVKNNENVANKDLYGKNYASSTMIQYGSRP 676

Query: 466 DFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSLMRECHDPIFHFHSHSFDL 524
           DFKEIFGS SK+WGHVDVGVIVCGPP+L +SVA+EIRS +L RE HDP+FH+HSHSFDL
Sbjct: 677 DFKEIFGSISKRWGHVDVGVIVCGPPNLGTSVAREIRSQNLRRESHDPVFHYHSHSFDL 735




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359486141|ref|XP_002266723.2| PREDICTED: ferric reduction oxidase 7, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739426|emb|CBI29608.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224057952|ref|XP_002299406.1| predicted protein [Populus trichocarpa] gi|222846664|gb|EEE84211.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357448309|ref|XP_003594430.1| NADPH oxidase [Medicago truncatula] gi|87241054|gb|ABD32912.1| Ferric reductase-like transmembrane component [Medicago truncatula] gi|355483478|gb|AES64681.1| NADPH oxidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356555827|ref|XP_003546231.1| PREDICTED: probable ferric reductase transmembrane component-like [Glycine max] Back     alignment and taxonomy information
>gi|449431912|ref|XP_004133744.1| PREDICTED: ferric reduction oxidase 7, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356532942|ref|XP_003535028.1| PREDICTED: uncharacterized protein LOC100804994 [Glycine max] Back     alignment and taxonomy information
>gi|110739950|dbj|BAF01880.1| FRO2-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|8978270|dbj|BAA98161.1| FRO2-like protein; NADPH oxidase-like [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query524
TAIR|locus:2157027738 FRO6 "ferric reduction oxidase 0.580 0.411 0.590 1.3e-124
TAIR|locus:2157032747 FRO7 "ferric reduction oxidase 0.580 0.406 0.590 1.5e-123
TAIR|locus:2178677699 FRO4 "ferric reduction oxidase 0.551 0.413 0.280 1.1e-36
TAIR|locus:2025366704 FRO1 "AT1G01590" [Arabidopsis 0.503 0.375 0.275 3.2e-28
TAIR|locus:2025351725 FRO2 "AT1G01580" [Arabidopsis 0.547 0.395 0.257 1.6e-26
TAIR|locus:2157697728 FRO8 "ferric reduction oxidase 0.183 0.131 0.415 1.6e-13
ZFIN|ZDB-GENE-040426-1380571 cybb "cytochrome b-245, beta p 0.175 0.161 0.262 7.6e-12
UNIPROTKB|F5GWU5303 CYBB "Cytochrome b-245 heavy c 0.080 0.138 0.386 1.2e-11
TAIR|locus:2168113886 AT5G60010 [Arabidopsis thalian 0.093 0.055 0.411 2.2e-11
DICTYBASE|DDB_G02911171142 noxC "flavocytochrome b large 0.106 0.049 0.396 3.1e-11
TAIR|locus:2157027 FRO6 "ferric reduction oxidase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 984 (351.4 bits), Expect = 1.3e-124, Sum P(2) = 1.3e-124
 Identities = 183/310 (59%), Positives = 235/310 (75%)

Query:   220 KITASVEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIV 279
             KIT  VEGPYGHE PYHL YENL+LVAGGIGI+PF AILSDILHR  +GK+CLP  VL+V
Sbjct:   430 KITTCVEGPYGHESPYHLAYENLVLVAGGIGITPFFAILSDILHRKRDGKACLPSKVLVV 489

Query:   280 WAVKKSNELSLLSNFYKESICPFFSDKLNLETFIYVTRETEPPLEEGELHKTMSSSI-YP 338
             WA+K S+ELSLLS     SICPFFS KLNLE  IY+TR++EP LE+G +HK +  S+  P
Sbjct:   490 WAIKNSDELSLLSAIDIPSICPFFSKKLNLEIHIYITRQSEPRLEDGMVHKVVHPSVKLP 549

Query:   339 VPSGCAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFNIHSWWYKGLLFLAC 398
               +GC+MSVLVGTG+N+WSGLY+I ST+GFI ++ LL+I Y+  +NI +WWYKGLLF+ C
Sbjct:   550 RTNGCSMSVLVGTGDNIWSGLYLIISTIGFISMITLLDIFYIKRYNITTWWYKGLLFVGC 609

Query:   399 MVGGVLIFGGTVIGFWHLWERKSSARENYKDDSIEVDNAQNVGTMAHNDIR----KKDTK 454
             MV  VLIFGG V+ FWH WE K+   E   +D +++ N +     +  +++    ++D +
Sbjct:   610 MVASVLIFGGLVVVFWHRWEHKTGEVEANGNDKVDL-NGEETHNPSAAELKGLAIEEDVQ 668

Query:   455 SSTNILYGSRPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSLMRECHDPI 514
             + T I YG+RP F+EIF S + KWG VDVGVIVCGP +LQ++VAKEIRSHS+ R  + P+
Sbjct:   669 NYTTIRYGTRPAFREIFESLNGKWGSVDVGVIVCGPATLQTTVAKEIRSHSIWRSANHPL 728

Query:   515 FHFHSHSFDL 524
             FHF+SHSFDL
Sbjct:   729 FHFNSHSFDL 738


GO:0005506 "iron ion binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016020 "membrane" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000293 "ferric-chelate reductase activity" evidence=IDA
GO:0009416 "response to light stimulus" evidence=IEP
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2157032 FRO7 "ferric reduction oxidase 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178677 FRO4 "ferric reduction oxidase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025366 FRO1 "AT1G01590" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025351 FRO2 "AT1G01580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157697 FRO8 "ferric reduction oxidase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1380 cybb "cytochrome b-245, beta polypeptide (chronic granulomatous disease)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F5GWU5 CYBB "Cytochrome b-245 heavy chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2168113 AT5G60010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291117 noxC "flavocytochrome b large subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00011355001
SubName- Full=Chromosome undetermined scaffold_301, whole genome shotgun sequence; (735 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query524
PLN02631699 PLN02631, PLN02631, ferric-chelate reductase 2e-27
PLN02292702 PLN02292, PLN02292, ferric-chelate reductase 7e-27
PLN02844722 PLN02844, PLN02844, oxidoreductase/ferric-chelate 2e-24
cd06186210 cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NO 6e-18
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-12
cd06186210 cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NO 5e-12
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 5e-12
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 8e-12
PLN02844722 PLN02844, PLN02844, oxidoreductase/ferric-chelate 3e-11
cd00322223 cd00322, FNR_like, Ferredoxin reductase (FNR), an 4e-11
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 7e-11
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-10
pfam08030149 pfam08030, NAD_binding_6, Ferric reductase NAD bin 3e-10
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-09
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 2e-09
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 7e-09
pfam08022103 pfam08022, FAD_binding_8, FAD-binding domain 8e-09
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-08
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-08
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-08
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 2e-08
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 4e-08
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 4e-08
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-08
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 4e-08
pfam04652315 pfam04652, DUF605, Vta1 like 4e-08
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 5e-08
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-07
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-07
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-07
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-07
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-07
PLN02292702 PLN02292, PLN02292, ferric-chelate reductase 3e-07
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-07
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 9e-07
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-06
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-06
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 1e-06
pfam04652315 pfam04652, DUF605, Vta1 like 2e-06
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-06
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 2e-06
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 2e-06
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-06
pfam04652315 pfam04652, DUF605, Vta1 like 4e-06
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 5e-06
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 5e-06
cd06198216 cd06198, FNR_like_3, NAD(P) binding domain of ferr 5e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
pfam03276582 pfam03276, Gag_spuma, Spumavirus gag protein 9e-06
PLN02631699 PLN02631, PLN02631, ferric-chelate reductase 1e-05
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 1e-05
cd06195241 cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase i 1e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-05
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 2e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-05
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-05
pfam10152147 pfam10152, DUF2360, Predicted coiled-coil domain-c 3e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-05
cd06198216 cd06198, FNR_like_3, NAD(P) binding domain of ferr 4e-05
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 4e-05
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 4e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 4e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 5e-05
PHA03321694 PHA03321, PHA03321, tegument protein VP11/12; Prov 6e-05
PHA033771000 PHA03377, PHA03377, EBNA-3C; Provisional 6e-05
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 7e-05
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 7e-05
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 7e-05
PRK12438991 PRK12438, PRK12438, hypothetical protein; Provisio 1e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-04
pfam03276582 pfam03276, Gag_spuma, Spumavirus gag protein 2e-04
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 2e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 2e-04
PRK14086617 PRK14086, dnaA, chromosomal replication initiation 2e-04
PRK14086617 PRK14086, dnaA, chromosomal replication initiation 2e-04
COG0543252 COG0543, UbiB, 2-polyprenylphenol hydroxylase and 2e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 3e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-04
PHA033071352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-04
PTZ00441576 PTZ00441, PTZ00441, sporozoite surface protein 2 ( 3e-04
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 3e-04
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 4e-04
pfam04652315 pfam04652, DUF605, Vta1 like 4e-04
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 5e-04
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 5e-04
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 5e-04
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 6e-04
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 7e-04
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 8e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-04
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 8e-04
TIGR02031589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase s 9e-04
PRK08345289 PRK08345, PRK08345, cytochrome-c3 hydrogenase subu 9e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.001
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.001
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 0.001
cd06189224 cd06189, flavin_oxioreductase, NAD(P)H dependent f 0.001
PRK14963504 PRK14963, PRK14963, DNA polymerase III subunits ga 0.001
COG4097438 COG4097, COG4097, Predicted ferric reductase [Inor 0.001
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 0.001
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.002
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.002
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.002
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.002
TIGR03354396 TIGR03354, VI_FHA, type VI secretion system FHA do 0.002
COG3147226 COG3147, DedD, Uncharacterized protein conserved i 0.002
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.003
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.003
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.003
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.003
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.003
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.003
PRK06975656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 0.003
PRK00054250 PRK00054, PRK00054, dihydroorotate dehydrogenase e 0.003
pfam00175106 pfam00175, NAD_binding_1, Oxidoreductase NAD-bindi 0.003
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
pfam08030149 pfam08030, NAD_binding_6, Ferric reductase NAD bin 0.004
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 0.004
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.004
PRK13729475 PRK13729, PRK13729, conjugal transfer pilus assemb 0.004
pfam12526115 pfam12526, DUF3729, Protein of unknown function (D 0.004
>gnl|CDD|178238 PLN02631, PLN02631, ferric-chelate reductase Back     alignment and domain information
 Score =  115 bits (290), Expect = 2e-27
 Identities = 96/323 (29%), Positives = 168/323 (52%), Gaps = 38/323 (11%)

Query: 221 ITASVEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVW 280
           +  S EGPYG        + +LILV+GG GI+PF++++ +++ +     + LP +VL+V 
Sbjct: 394 LEVSTEGPYGPNSFDVSRHNSLILVSGGSGITPFISVIRELIFQSQNPSTKLP-DVLLVC 452

Query: 281 AVKKSNELSLLSNFYKESICPFFSDKLNLETFIYVTRETEPPLEEGELHKTMSSSIY-PV 339
           + K  ++L+ L   +   I      +LNL    Y+TRE + P E  + H+ + +  + P 
Sbjct: 453 SFKHYHDLAFLDLIFPLDISVSDISRLNLRIEAYITREDKKP-ETTDDHRLLQTKWFKPQ 511

Query: 340 PSGCAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFN-----IHSWWYKGL- 393
           P    +S ++G  N +W G+ ++SS V F++L+ ++   Y+ P +     I+++ Y+GL 
Sbjct: 512 PLDSPISPVLGPNNFLWLGVVILSSFVMFLLLIGIVTRYYIYPVDHNTGSIYNFSYRGLW 571

Query: 394 -LFLACMVGGVLIFGGTVIGFWHLWERKSSARENYKDDSIEVDNAQ------NVGTMAHN 446
            +FL    G V IF  + I F  LW RK   +E  K+   +V + +      + G+  H 
Sbjct: 572 DMFL----GSVCIFISSSIVF--LW-RKKQNKEGDKESKKQVQSVEFQTPTSSPGSWFHG 624

Query: 447 DIRKKDT------KSSTNILYGSRPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKE 500
             R+ ++        +T++ +GS+P+ K+I        G  DVGV+VCGP  ++  VAK 
Sbjct: 625 HERELESVPYQSIVQATSVHFGSKPNLKKILLEAE---GSEDVGVMVCGPRKMRHEVAK- 680

Query: 501 IRSHSLMRECHDPIFHFHSHSFD 523
           I S  L +       HF + SF+
Sbjct: 681 ICSSGLAKN-----LHFEAISFN 698


Length = 699

>gnl|CDD|215165 PLN02292, PLN02292, ferric-chelate reductase Back     alignment and domain information
>gnl|CDD|215453 PLN02844, PLN02844, oxidoreductase/ferric-chelate reductase Back     alignment and domain information
>gnl|CDD|99783 cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|99783 cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|215453 PLN02844, PLN02844, oxidoreductase/ferric-chelate reductase Back     alignment and domain information
>gnl|CDD|99778 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|203841 pfam08030, NAD_binding_6, Ferric reductase NAD binding domain Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|219702 pfam08022, FAD_binding_8, FAD-binding domain Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|215165 PLN02292, PLN02292, ferric-chelate reductase Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|99795 cd06198, FNR_like_3, NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|178238 PLN02631, PLN02631, ferric-chelate reductase Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|99792 cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|99795 cd06198, FNR_like_3, NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223041 PHA03321, PHA03321, tegument protein VP11/12; Provisional Back     alignment and domain information
>gnl|CDD|177614 PHA03377, PHA03377, EBNA-3C; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|223617 COG0543, UbiB, 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|240420 PTZ00441, PTZ00441, sporozoite surface protein 2 (SSP2); Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information
>gnl|CDD|236247 PRK08345, PRK08345, cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|99786 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|226582 COG4097, COG4097, Predicted ferric reductase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|234178 TIGR03354, VI_FHA, type VI secretion system FHA domain protein Back     alignment and domain information
>gnl|CDD|225689 COG3147, DedD, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|234601 PRK00054, PRK00054, dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215769 pfam00175, NAD_binding_1, Oxidoreductase NAD-binding domain Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|203841 pfam08030, NAD_binding_6, Ferric reductase NAD binding domain Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|184281 PRK13729, PRK13729, conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 524
PLN02844722 oxidoreductase/ferric-chelate reductase 100.0
PLN02631699 ferric-chelate reductase 100.0
PLN02292702 ferric-chelate reductase 100.0
KOG0039646 consensus Ferric reductase, NADH/NADPH oxidase and 100.0
cd06186210 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyz 99.96
cd06198216 FNR_like_3 NAD(P) binding domain of ferredoxin red 99.93
COG4097438 Predicted ferric reductase [Inorganic ion transpor 99.91
cd06195241 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-c 99.9
cd06197220 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin 99.9
cd06215231 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferr 99.9
cd06212232 monooxygenase_like The oxygenase reductase FAD/NAD 99.9
PF08030156 NAD_binding_6: Ferric reductase NAD binding domain 99.9
cd06189224 flavin_oxioreductase NAD(P)H dependent flavin oxid 99.9
cd06210236 MMO_FAD_NAD_binding Methane monooxygenase (MMO) re 99.9
cd06184247 flavohem_like_fad_nad_binding FAD_NAD(P)H binding 99.89
cd06191231 FNR_iron_sulfur_binding Iron-sulfur binding Ferred 99.89
cd06187224 O2ase_reductase_like The oxygenase reductase FAD/N 99.89
cd06213227 oxygenase_e_transfer_subunit The oxygenase reducta 99.89
cd06211238 phenol_2-monooxygenase_like Phenol 2-monooxygenase 99.89
PRK08051232 fre FMN reductase; Validated 99.89
cd00322223 FNR_like Ferredoxin reductase (FNR), an FAD and NA 99.89
cd06216243 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferr 99.88
cd06209228 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenD 99.88
cd06190232 T4MO_e_transfer_like Toluene-4-monoxygenase electr 99.88
cd06194222 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding 99.88
cd06188283 NADH_quinone_reductase Na+-translocating NADH:quin 99.88
cd06217235 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferr 99.88
PRK07609339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.88
PRK13289399 bifunctional nitric oxide dioxygenase/dihydropteri 99.87
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.87
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 99.87
cd06185211 PDR_like Phthalate dioxygenase reductase (PDR) is 99.86
PRK11872340 antC anthranilate dioxygenase reductase; Provision 99.85
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.85
cd06214241 PA_degradation_oxidoreductase_like NAD(P) binding 99.85
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electro 99.85
cd06221253 sulfite_reductase_like Anaerobic sulfite reductase 99.83
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 99.83
PRK10926248 ferredoxin-NADP reductase; Provisional 99.82
cd06183234 cyt_b5_reduct_like Cytochrome b5 reductase catalyz 99.82
cd06200245 SiR_like1 Cytochrome p450- like alpha subunits of 99.82
PRK05464409 Na(+)-translocating NADH-quinone reductase subunit 99.82
TIGR01941405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.81
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 99.81
COG1018266 Hmp Flavodoxin reductases (ferredoxin-NADPH reduct 99.81
PRK05713312 hypothetical protein; Provisional 99.81
PLN03116307 ferredoxin--NADP+ reductase; Provisional 99.81
cd06208286 CYPOR_like_FNR These ferredoxin reductases are rel 99.81
cd06196218 FNR_like_1 Ferredoxin reductase-like proteins cata 99.79
TIGR03224411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p 99.78
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 99.78
PLN03115367 ferredoxin--NADP(+) reductase; Provisional 99.78
PRK05802320 hypothetical protein; Provisional 99.77
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 99.77
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron 99.76
cd06182267 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) 99.76
PRK08221263 anaerobic sulfite reductase subunit B; Provisional 99.75
PTZ00274325 cytochrome b5 reductase; Provisional 99.75
PTZ00319300 NADH-cytochrome B5 reductase; Provisional 99.75
cd06201289 SiR_like2 Cytochrome p450- like alpha subunits of 99.73
TIGR02911261 sulfite_red_B sulfite reductase, subunit B. Member 99.73
KOG0534286 consensus NADH-cytochrome b-5 reductase [Coenzyme 99.69
PLN02252888 nitrate reductase [NADPH] 99.69
COG0543252 UbiB 2-polyprenylphenol hydroxylase and related fl 99.69
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 99.63
PRK12779944 putative bifunctional glutamate synthase subunit b 99.63
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.61
PF08022105 FAD_binding_8: FAD-binding domain; InterPro: IPR01 99.6
cd06193235 siderophore_interacting Siderophore interacting pr 99.58
PTZ003061167 NADH-dependent fumarate reductase; Provisional 99.54
cd06207382 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) 99.53
cd06206384 bifunctional_CYPOR These bifunctional proteins fus 99.52
TIGR01931597 cysJ sulfite reductase [NADPH] flavoprotein, alpha 99.5
cd06203398 methionine_synthase_red Human methionine synthase 99.44
cd06199360 SiR Cytochrome p450- like alpha subunits of E. col 99.39
PRK06214530 sulfite reductase; Provisional 99.32
cd06202406 Nitric_oxide_synthase The ferredoxin-reductase (FN 99.23
cd06204416 CYPOR NADPH cytochrome p450 reductase (CYPOR) serv 99.22
PRK10953600 cysJ sulfite reductase subunit alpha; Provisional 99.22
PF00175109 NAD_binding_1: Oxidoreductase NAD-binding domain ; 99.15
COG2871410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.08
PRK065671028 putative bifunctional glutamate synthase subunit b 98.4
COG0369587 CysJ Sulfite reductase, alpha subunit (flavoprotei 98.36
PF0097099 FAD_binding_6: Oxidoreductase FAD-binding domain; 98.36
KOG1158645 consensus NADP/FAD dependent oxidoreductase [Energ 98.34
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 97.86
KOG3378385 consensus Globins and related hemoproteins [Energy 97.48
KOG1159574 consensus NADP-dependent flavoprotein reductase [E 92.74
KOG1923 830 consensus Rac1 GTPase effector FRL [Signal transdu 86.24
PHA03378991 EBNA-3B; Provisional 85.29
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 83.18
>PLN02844 oxidoreductase/ferric-chelate reductase Back     alignment and domain information
Probab=100.00  E-value=9.4e-62  Score=541.80  Aligned_cols=361  Identities=30%  Similarity=0.531  Sum_probs=282.1

Q ss_pred             ecCCCCccCCCcEEEEEeCCCCCccccceEeEecCCCCCCeEEEEEEeeCchHHHHHHHHhcCCCCCCCCCCCCCCCCCC
Q 009819            8 PIKTYLRYNALSFFFLQVRELSWLQWHPFSVSSSPLEGKYHSSVLIKVLGEWTENLRDYILSKSESDSQVGPPPPVPPPE   87 (524)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~S~P~~~~~~i~~~IK~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   87 (524)
                      ++...++|+||||+||+++.++++|||||||+|+|+.+++.++++||+.|+||++|++++....+.+..           
T Consensus       332 ~r~~~~~f~PGQfV~L~vp~~s~~q~HPFSIaS~p~~~~~~l~~~IK~~gG~T~~L~~~i~~~l~~g~~-----------  400 (722)
T PLN02844        332 PKDPGLKYAPTSVIFMKIPSISRFQWHPFSITSSSNIDDHTMSVIIKCEGGWTNSLYNKIQAELDSETN-----------  400 (722)
T ss_pred             ECCCCCCcCCCeeEEEEECCCCceeEEEEEeecCCCCCCCeEEEEEEeCCCchHHHHHHHHhhccCCCC-----------
Confidence            455689999999999999999999999999999886556789999999999999999988654221000           


Q ss_pred             CCCCCCCCCCCCcccchhhhhhhhhCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 009819           88 GHPPPVHPPQGPVRNLMYENLILVAGGISEANPHVGPPLPVPPPQGAPPPGPPLQEEGPPPQGPHPPVPPPQGPPPPLPP  167 (524)
Q Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  167 (524)
                                                                                                      
T Consensus       401 --------------------------------------------------------------------------------  400 (722)
T PLN02844        401 --------------------------------------------------------------------------------  400 (722)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCccchhhhhhcCCccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCeeEEEEeCcccCCCCCccccccEEEEec
Q 009819          168 PKGNLMYENLIVVAGGISETEPQVGPPPPVPPPQGSPPQRPPPSRHPLLPPTKITASVEGPYGHEVPYHLMYENLILVAG  247 (524)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~l~V~VdGPYG~~~~~~~~~~~vVLIAG  247 (524)
                                                                  ..     .++++.|+||||.+..+...+++++||||
T Consensus       401 --------------------------------------------~~-----~~~~v~VeGPYG~~s~~~~~~~~lVLIAG  431 (722)
T PLN02844        401 --------------------------------------------QM-----NCIPVAIEGPYGPASVDFLRYDSLLLVAG  431 (722)
T ss_pred             --------------------------------------------cc-----cceEEEEECCccCCCCCccCCCeEEEEEc
Confidence                                                        00     12589999999998766667899999999


Q ss_pred             CcChHHHHHHHHHHHHHhhcCCCCCCceEEEEEeccCCchHHHHHHHHHhccCCcccCCCceEEEEEEcCCCCCCC--cc
Q 009819          248 GIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKSNELSLLSNFYKESICPFFSDKLNLETFIYVTRETEPPL--EE  325 (524)
Q Consensus       248 GiGITP~lSiL~~Ll~~~~~~~~~~~rkV~LiW~vRs~~dl~wl~ell~ell~~~~~~~~~l~I~IyVTr~~~~~~--~~  325 (524)
                      |+||||++|+++++.++.+.. ....++|+|+|++|+.+|+.|++++..++..+. .+..++++++|+||+.....  ++
T Consensus       432 GiGITPfLSiLrdl~~~~~~~-~~~~~~V~LIw~vR~~~dL~~~del~~~l~~~~-~~~~~lkl~iyVTRE~~~~~rl~~  509 (722)
T PLN02844        432 GIGITPFLSILKEIASQSSSR-YRFPKRVQLIYVVKKSQDICLLNPISSLLLNQS-SNQLNLKLKVFVTQEEKPNATLRE  509 (722)
T ss_pred             CcCHHHHHHHHHHHHhccccc-cCCCCcEEEEEEECCHHHhhhHHHHHHHhHHhH-HHhcCceEEEEECCCCCCCCchhh
Confidence            999999999999998642211 123468999999999999999998875543221 23348999999999876422  11


Q ss_pred             cccccccc--cccCCCCCCCceeeeeCCCCchhhHHHHHHHHHHHHHHHHHhhheeeCCCCCch----------------
Q 009819          326 GELHKTMS--SSIYPVPSGCAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILYVNPFNIHS----------------  387 (524)
Q Consensus       326 ~~i~~~~~--~~~~P~ps~~s~s~i~G~~s~~~~~a~ilas~~gfl~~~g~l~~~~v~p~~~~s----------------  387 (524)
                      ...+.++.  .++.|   +.+++++||++||+|++++|++||++|+++++++++||| |.|..+                
T Consensus       510 ~i~~~~~~~~~~~~~---~~~~~~i~G~~~~lw~~~~~~~s~~~f~~~~~~~~~~~i-~~~~~~~~~~~~~~~~~~~~~~  585 (722)
T PLN02844        510 LLNQFSQVQTVNFST---KCSRYAIHGLESFLWMAAMVALTSITFLVFLIGLNHIFI-PSEHKSHSGVKMAASGEMKTAK  585 (722)
T ss_pred             HhhccchhhhcCCCC---CCCceEEeCCCchHHHHHHHHHHHHHHHHHHHHHheEEe-ccccccccchhccccccccccc
Confidence            00000111  12222   456799999999999999999999999999999999999 555333                


Q ss_pred             ----hhHHHHHHHHHHhhheeeccceeeeehhhhhhhhccccc-CCCCcccccccccccccccccccccCCCcccccccC
Q 009819          388 ----WWYKGLLFLACMVGGVLIFGGTVIGFWHLWERKSSAREN-YKDDSIEVDNAQNVGTMAHNDIRKKDTKSSTNILYG  462 (524)
Q Consensus       388 ----~~~~~~l~l~~m~~gV~v~g~~vi~~w~~~~~~~~~~~s-~~~~~ie~~~p~~~~~~~~~~~~~~~L~~~~~V~~G  462 (524)
                          ||++++++++||++||++ ||+|+.+|+ |+|++++.+. .+++.++.    ....++    ....+.+..++|||
T Consensus       586 ~~~~~~~~~~l~~~~~~~~~~~-~~~~~~~~~-~~~~~~~~~~~~~~~~~~~----~~~~~~----~~~~~~~~~~~~~g  655 (722)
T PLN02844        586 EKTPSWVVDLLLIVSFIIAITC-STFVAIILR-WRRLKKEIPRVSQKQGIKP----EEGSME----KRGPVLEEHEIHFG  655 (722)
T ss_pred             CCCchHHHHHHHHHHHHHHhee-cceEeEeee-ccccccCCccccccccCCC----CCcccc----ccccccccceeecC
Confidence                999999999999999988 999999999 7777655443 22222221    111222    22334567899999


Q ss_pred             CCCChHHHHHhhhcccCCceEEEEEeCChhhHHHHHHHHHhccc-----cccCCCceEEEEEeeccC
Q 009819          463 SRPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSL-----MRECHDPIFHFHSHSFDL  524 (524)
Q Consensus       463 ~RPdl~~I~~~~~~~~~~~~VGVfvCGP~sL~~~Va~~c~~~n~-----~~~~~~~~f~fHsEsF~L  524 (524)
                      +|||++|||.++.+++++++|||+||||++||++||++||++|.     .+.+.++.|||||.||+|
T Consensus       656 ~rp~~~~i~~~~~~~~~~~~vgvlv~gp~~~~~~va~~~~~~~~~~~~~~~~~~~~~~~~hs~~f~l  722 (722)
T PLN02844        656 GRPNFQDIFSKFPKETRGSDIGVLVCGPETMKESVASMCRLKSQCFNVGDDGKRKMYFSFHSLNFTL  722 (722)
T ss_pred             CCCCHHHHHHHhhhhccCCceeEEEeCchHHHHHHHHHHHhcccccccccccccCCceeeeecccCC
Confidence            99999999999999999999999999999999999999999997     456667889999999997



>PLN02631 ferric-chelate reductase Back     alignment and domain information
>PLN02292 ferric-chelate reductase Back     alignment and domain information
>KOG0039 consensus Ferric reductase, NADH/NADPH oxidase and related proteins [Inorganic ion transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide Back     alignment and domain information
>cd06198 FNR_like_3 NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin Back     alignment and domain information
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin reductase-like proteins Back     alignment and domain information
>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>PF08030 NAD_binding_6: Ferric reductase NAD binding domain; InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins Back     alignment and domain information
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins Back     alignment and domain information
>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol Back     alignment and domain information
>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin Back     alignment and domain information
>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain Back     alignment and domain information
>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant Back     alignment and domain information
>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol Back     alignment and domain information
>PRK08051 fre FMN reductase; Validated Back     alignment and domain information
>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain Back     alignment and domain information
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system Back     alignment and domain information
>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain Back     alignment and domain information
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain Back     alignment and domain information
>cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>PRK10926 ferredoxin-NADP reductase; Provisional Back     alignment and domain information
>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor Back     alignment and domain information
>cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PLN03116 ferredoxin--NADP+ reductase; Provisional Back     alignment and domain information
>cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain Back     alignment and domain information
>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PLN03115 ferredoxin--NADP(+) reductase; Provisional Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>PRK08221 anaerobic sulfite reductase subunit B; Provisional Back     alignment and domain information
>PTZ00274 cytochrome b5 reductase; Provisional Back     alignment and domain information
>PTZ00319 NADH-cytochrome B5 reductase; Provisional Back     alignment and domain information
>cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>TIGR02911 sulfite_red_B sulfite reductase, subunit B Back     alignment and domain information
>KOG0534 consensus NADH-cytochrome b-5 reductase [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PLN02252 nitrate reductase [NADPH] Back     alignment and domain information
>COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PF08022 FAD_binding_8: FAD-binding domain; InterPro: IPR013112 This FAD binding domain is associated with ferric reductase NAD binding proteins and the heavy chain of Cytochrome b-245 Back     alignment and domain information
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component Back     alignment and domain information
>cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate Back     alignment and domain information
>cd06199 SiR Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>PRK06214 sulfite reductase; Provisional Back     alignment and domain information
>cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain Back     alignment and domain information
>cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information
>PF00175 NAD_binding_1: Oxidoreductase NAD-binding domain ; InterPro: IPR001433 Bacterial ferredoxin-NADP+ reductase may be bound to the thylakoid membrane or anchored to the thylakoid-bound phycobilisomes Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00970 FAD_binding_6: Oxidoreductase FAD-binding domain; InterPro: IPR008333 These sequences contain an oxidoreductase FAD-binding domain Back     alignment and domain information
>KOG1158 consensus NADP/FAD dependent oxidoreductase [Energy production and conversion] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3378 consensus Globins and related hemoproteins [Energy production and conversion] Back     alignment and domain information
>KOG1159 consensus NADP-dependent flavoprotein reductase [Energy production and conversion] Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PHA03378 EBNA-3B; Provisional Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query524
3a1f_A186 Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi 3e-18
3a1f_A186 Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi 3e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-12
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-11
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-10
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-09
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-12
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-09
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-08
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 1e-09
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-09
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 9e-09
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 4e-08
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 4e-07
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 7e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 7e-07
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 1e-06
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 2e-05
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 3e-06
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 4e-06
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 2e-05
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 3e-05
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 2e-05
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 4e-05
2wvr_C546 DNA replication factor CDT1; DNA replication licen 7e-05
2wvr_C546 DNA replication factor CDT1; DNA replication licen 5e-04
3q2s_C229 Cleavage and polyadenylation specificity factor S; 7e-05
3q2s_C229 Cleavage and polyadenylation specificity factor S; 8e-04
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 8e-05
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 9e-05
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 3e-04
1qfj_A232 Protein (flavin reductase); riboflavin, ferredoxin 1e-04
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 2e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 2e-04
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 3e-04
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 8e-04
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 3e-04
1fdr_A248 Flavodoxin reductase; ferredoxin reductase, flavin 4e-04
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 4e-04
2r6h_A290 NADH:ubiquinone oxidoreductase, Na translocating, 5e-04
1rm1_C286 Transcription initiation factor IIA large chain; y 8e-04
>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Length = 186 Back     alignment and structure
 Score = 82.1 bits (202), Expect = 3e-18
 Identities = 24/117 (20%), Positives = 48/117 (41%), Gaps = 3/117 (2%)

Query: 225 VEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEGKS-CLPRNVLIVWAVK 283
           V+GP+G        YE ++LV  GIG++PF +IL  + ++     +    + +   W  +
Sbjct: 3   VDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCR 62

Query: 284 KSNELSLLSNFYK--ESICPFFSDKLNLETFIYVTRETEPPLEEGELHKTMSSSIYP 338
            ++     ++  +  ES     ++   L   IY+T   E       +H      +  
Sbjct: 63  DTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVIT 119


>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Length = 186 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Length = 232 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 Back     alignment and structure
>1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* Length = 248 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} Length = 290 Back     alignment and structure
>1rm1_C Transcription initiation factor IIA large chain; yeast TFIIA, TBP protein, ATA-box DNA, transcription/DNA complex; 2.50A {Saccharomyces cerevisiae} Length = 286 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query524
3a1f_A186 Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi 99.92
4eh1_A243 Flavohemoprotein; structural genomics, niaid, nati 99.92
3jqq_A316 Ferredoxin NADP reductase; FAD, oxidoreductase; HE 99.91
1tvc_A250 Methane monooxygenase component C, methane monooxy 99.9
1qfj_A232 Protein (flavin reductase); riboflavin, ferredoxin 99.9
3vo2_A310 Putative uncharacterized protein; rossmann fold, o 99.9
4fk8_A271 Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st 99.89
4g1v_A399 Flavohemoglobin; three domains: globin fold, antip 99.89
3lo8_A311 Ferredoxin--NADP reductase; electron transport, ox 99.89
2r6h_A290 NADH:ubiquinone oxidoreductase, Na translocating, 99.89
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.88
1fdr_A248 Flavodoxin reductase; ferredoxin reductase, flavin 99.88
1cqx_A403 Flavohemoprotein; globin fold, six-stranded antipa 99.87
2bmw_A304 Ferredoxin--NADP reductase; oxidoreductase, flavop 99.87
1gvh_A396 Flavohemoprotein; oxidoreductase, NADP, heme, flav 99.87
1fnb_A314 Ferredoxin-NADP+ reductase; oxidoreductase (NADP+( 99.87
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.86
2bgi_A272 Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi 99.86
2b5o_A402 FNR, ferredoxin--NADP reductase; complex with FAD, 99.85
2qdx_A257 Ferredoxin reductase; oxidoreductase; HET: FAD; 1. 99.85
2rc5_A314 Ferredoxin-NADP reductase; FAD, oxidoreductase; HE 99.85
2eix_A243 NADH-cytochrome B5 reductase; flavoprotein, FAD-bi 99.85
1ep3_B262 Dihydroorotate dehydrogenase B (PYRK subunit); het 99.83
2cnd_A270 NADH-dependent nitrate reductase; nitrate assimila 99.8
1umk_A275 B5R, NADH-cytochrome B5 reductase; flavoprotein, b 99.8
1ddg_A374 Sulfite reductase (NADPH) flavoprotein alpha- comp 99.68
4dql_A393 Bifunctional P-450/NADPH-P450 reductase; rossmann 99.65
1f20_A435 Nitric-oxide synthase; nitric-xoide synthase, redu 99.52
2gpj_A252 Siderophore-interacting protein; structural genomi 99.52
2qtl_A539 MSR;, methionine synthase reductase; alpha-beta-al 99.52
1tll_A688 Nitric-oxide synthase, brain; reductase module, FM 99.46
3qfs_A458 CPR, P450R, NADPH--cytochrome P450 reductase; flav 99.43
3lyu_A142 Putative hydrogenase; the C-terminal has AN alpha- 99.41
3qe2_A618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 99.38
2bpo_A682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 99.36
3lrx_A158 Putative hydrogenase; alpha-beta protein, structur 99.36
2eix_A243 NADH-cytochrome B5 reductase; flavoprotein, FAD-bi 82.31
>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Back     alignment and structure
Probab=99.92  E-value=5.3e-25  Score=203.46  Aligned_cols=183  Identities=22%  Similarity=0.451  Sum_probs=126.3

Q ss_pred             EEEeCcccCCCCCccccccEEEEecCcChHHHHHHHHHHHHHhhcC-CCCCCceEEEEEeccCCchHHHHHHHHHhccCC
Q 009819          223 ASVEGPYGHEVPYHLMYENLILVAGGIGISPFLAILSDILHRINEG-KSCLPRNVLIVWAVKKSNELSLLSNFYKESICP  301 (524)
Q Consensus       223 V~VdGPYG~~~~~~~~~~~vVLIAGGiGITP~lSiL~~Ll~~~~~~-~~~~~rkV~LiW~vRs~~dl~wl~ell~ell~~  301 (524)
                      |.|+||||.+..+...++++|||||||||||+++|+++++.+.+.+ .....++|+|+|++|+.+++.|+.++++++...
T Consensus         1 v~v~GP~G~~~~~~~~~~~~vlIagG~GItP~~s~l~~l~~~~~~~~~~~~~~~v~l~~~~r~~~~~~w~~~~l~~l~~~   80 (186)
T 3a1f_A            1 IAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQ   80 (186)
T ss_dssp             CCTTSTTSHHHHHHTTSSEEEEEEEGGGHHHHHHHHHHHHHHHHHCTTCCCCCEEEEEEEESCTTTTHHHHHHHHHHHHH
T ss_pred             CeEECCCCCCccChhhCCeEEEEecCccHHHHHHHHHHHHHHHhhcccCCCCcEEEEEEEECCcchHHHHHHHHHHHHHH
Confidence            3579999999765557889999999999999999999998763211 012367899999999999999888888775321


Q ss_pred             cc--cCCCceEEEEEEcCCCCCCCcccccccccccccCCCCCCCceeeeeCCCCchhhHHHHHHHHHHHHHHHHHhhhee
Q 009819          302 FF--SDKLNLETFIYVTRETEPPLEEGELHKTMSSSIYPVPSGCAMSVLVGTGNNVWSGLYVISSTVGFIILVALLNILY  379 (524)
Q Consensus       302 ~~--~~~~~l~I~IyVTr~~~~~~~~~~i~~~~~~~~~P~ps~~s~s~i~G~~s~~~~~a~ilas~~gfl~~~g~l~~~~  379 (524)
                      ..  ....++++++|+|+....+...     .                                                
T Consensus        81 ~~~~~~~~~~~~~~~~t~~~~~~~~~-----~------------------------------------------------  107 (186)
T 3a1f_A           81 MQERNNAGFLSYNIYLTGWDESQANH-----F------------------------------------------------  107 (186)
T ss_dssp             HHHTTCTTSEEEEEEETTC-------------------------------------------------------------
T ss_pred             HhhccCCCeEEEEEEEcCCCCCcccc-----e------------------------------------------------
Confidence            00  0123799999999854311000     0                                                


Q ss_pred             eCCCCCchhhHHHHHHHHHHhhheeeccceeeeehhhhhhhhcccccCCCCcccccccccccccccccccccCCCccccc
Q 009819          380 VNPFNIHSWWYKGLLFLACMVGGVLIFGGTVIGFWHLWERKSSARENYKDDSIEVDNAQNVGTMAHNDIRKKDTKSSTNI  459 (524)
Q Consensus       380 v~p~~~~s~~~~~~l~l~~m~~gV~v~g~~vi~~w~~~~~~~~~~~s~~~~~ie~~~p~~~~~~~~~~~~~~~L~~~~~V  459 (524)
                                         +           + -   |+..        .+.+                  +++  ...+
T Consensus       108 -------------------~-----------~-~---~~~~--------~~~~------------------~g~--~~~~  125 (186)
T 3a1f_A          108 -------------------A-----------V-H---HDEE--------KDVI------------------TGL--KQKT  125 (186)
T ss_dssp             -----------------------------------------------------------------------------CCE
T ss_pred             -------------------e-----------e-c---cccc--------cccC------------------CCC--cccc
Confidence                               0           0 0   0000        0000                  111  1467


Q ss_pred             ccCCCCChHHHHHhhhcccCCceEEEEEeCChhhHHHHHHHHHhccccccCCCceEEEEEeec
Q 009819          460 LYGSRPDFKEIFGSTSKKWGHVDVGVIVCGPPSLQSSVAKEIRSHSLMRECHDPIFHFHSHSF  522 (524)
Q Consensus       460 ~~G~RPdl~~I~~~~~~~~~~~~VGVfvCGP~sL~~~Va~~c~~~n~~~~~~~~~f~fHsEsF  522 (524)
                      ++| |||+..+++++.+.....++.||+|||.+|.++|+++|++.... ...+.+|+||+|+|
T Consensus       126 ~~g-R~~~~~~~~~~~~~~~~~~~~v~~CGP~~m~~~v~~~l~~~g~~-~~~~~~~~~~~E~F  186 (186)
T 3a1f_A          126 LYG-RPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSES-GPRGVHFIFNKENF  186 (186)
T ss_dssp             EES-CCCHHHHHHHHHHHSTTCEEEEEEESCHHHHHHHHHHHHHTCCC-STTCCEEEEECCCC
T ss_pred             ccC-CCCHHHHHHHHHHhCCCCcEEEEEeCCHHHHHHHHHHHHHhhcc-CCCCCEEEEEeccC
Confidence            787 99999999988766555689999999999999999999997652 12335799999998



>4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* Back     alignment and structure
>1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Back     alignment and structure
>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Back     alignment and structure
>3vo2_A Putative uncharacterized protein; rossmann fold, oxidoreductase, FAD binding; HET: FAD; 1.39A {Zea mays} PDB: 3vo1_A* 1gaw_A* 1gaq_A* 1qg0_A* 4af6_A* 1qga_A* 1qfz_A* 1qfy_A* 4af7_A* 1sm4_A* 3mhp_A* 1fnb_A* 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 2xnc_A* Back     alignment and structure
>4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* Back     alignment and structure
>4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A* Back     alignment and structure
>3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* Back     alignment and structure
>2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* Back     alignment and structure
>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Back     alignment and structure
>2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... Back     alignment and structure
>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Back     alignment and structure
>1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A* Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Back     alignment and structure
>2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} Back     alignment and structure
>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Back     alignment and structure
>2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* Back     alignment and structure
>2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Back     alignment and structure
>2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* Back     alignment and structure
>1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* Back     alignment and structure
>1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* Back     alignment and structure
>4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* Back     alignment and structure
>1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 Back     alignment and structure
>2gpj_A Siderophore-interacting protein; structural genomics, joint for structural genomics, JCSG; HET: FAD; 2.20A {Shewanella putrefaciens} Back     alignment and structure
>2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Back     alignment and structure
>3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A* Back     alignment and structure
>3lyu_A Putative hydrogenase; the C-terminal has AN alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Back     alignment and structure
>3lrx_A Putative hydrogenase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.60A {Pyrococcus furiosus} Back     alignment and structure
>2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 524
d1f20a2165 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synth 7e-06
d1fnda2160 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodo 6e-05
d1jb9a2154 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodo 1e-04
d1a8pa2158 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodo 1e-04
d2bmwa2162 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodo 2e-04
d1fdra2148 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodo 3e-04
d1krha2133 c.25.1.2 (A:206-338) Benzoate dioxygenase reductas 8e-04
d1qfja2135 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase 0.002
d1tvca2141 c.25.1.2 (A:111-251) Methane monooxygenase compone 0.002
d1cqxa3142 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal d 0.002
d1ep3b2160 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase 0.003
d1gvha3143 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal d 0.003
d2cnda2146 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea 0.003
>d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 165 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ferredoxin reductase-like, C-terminal NADP-linked domain
superfamily: Ferredoxin reductase-like, C-terminal NADP-linked domain
family: NADPH-cytochrome p450 reductase-like
domain: Neuronal nitric-oxide synthase FAD/NADP+ domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 44.4 bits (104), Expect = 7e-06
 Identities = 17/82 (20%), Positives = 28/82 (34%), Gaps = 5/82 (6%)

Query: 241 NLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKSNELSLLSNFYKESIC 300
             ILV  G GI+PF +        I          VL+    +   +       Y+E   
Sbjct: 11  PCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDH-----IYREETL 65

Query: 301 PFFSDKLNLETFIYVTRETEPP 322
              +  +  E +   +RE + P
Sbjct: 66  QAKNKGVFRELYTAYSREPDRP 87


>d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 160 Back     information, alignment and structure
>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]} Length = 154 Back     information, alignment and structure
>d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]} Length = 158 Back     information, alignment and structure
>d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} Length = 162 Back     information, alignment and structure
>d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]} Length = 148 Back     information, alignment and structure
>d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Length = 133 Back     information, alignment and structure
>d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Length = 135 Back     information, alignment and structure
>d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Length = 141 Back     information, alignment and structure
>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Length = 142 Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 160 Back     information, alignment and structure
>d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 143 Back     information, alignment and structure
>d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} Length = 146 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query524
d1cqxa3142 Flavohemoglobin, C-terminal domain {Alcaligenes eu 99.59
d1tvca2141 Methane monooxygenase component C, MmoC {Methyloco 99.56
d1krha2133 Benzoate dioxygenase reductase {Acinetobacter sp. 99.53
d1gvha3143 Flavohemoglobin, C-terminal domain {Escherichia co 99.47
d1fdra2148 Ferredoxin reductase (flavodoxin reductase) {Esche 99.38
d1qfja2135 NAD(P)H:flavin oxidoreductase {Escherichia coli [T 99.36
d2piaa2120 Phthalate dioxygenase reductase {Pseudomonas cepac 99.34
d1umka2147 cytochrome b5 reductase {Human (Homo sapiens) [Tax 99.34
d2bmwa2162 Ferredoxin reductase (flavodoxin reductase) {Cyano 99.23
d1fnda2160 Ferredoxin reductase (flavodoxin reductase) {Spina 99.2
d1a8pa2158 Ferredoxin reductase (flavodoxin reductase) {Azoto 99.19
d2cnda2146 Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} 99.16
d1f20a2165 Neuronal nitric-oxide synthase FAD/NADP+ domain {R 99.13
d1jb9a2154 Ferredoxin reductase (flavodoxin reductase) {Maize 99.11
d1ddga2153 Sulfite reductase flavoprotein {Escherichia coli [ 99.07
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 99.03
d1ja1a3160 NADPH-cytochrome p450 reductase {Rat (Rattus norve 98.99
d1qfja197 NAD(P)H:flavin oxidoreductase {Escherichia coli [T 98.92
d1a8pa199 Ferredoxin reductase (flavodoxin reductase) N-term 98.69
d1fdra199 Ferredoxin reductase (flavodoxin reductase) N-term 98.57
d1krha1100 Benzoate dioxygenase reductase {Acinetobacter sp. 98.53
d1tvca1109 Methane monooxygenase component C, MmoC {Methyloco 98.45
d1ep3b1101 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 98.32
d1cqxa2111 Flavohemoglobin, central domain {Alcaligenes eutro 98.31
d1gvha2107 Flavohemoglobin, central domain {Escherichia coli 98.24
d2bmwa1133 Ferredoxin reductase (flavodoxin reductase) N-term 97.86
d1fnda1136 Ferredoxin reductase (flavodoxin reductase) N-term 97.72
d2cnda1114 Nitrate reductase core domain {Corn (Zea mays) [Ta 97.51
d2piaa1103 Phthalate dioxygenase reductase {Pseudomonas cepac 97.3
d1umka1124 cytochrome b5 reductase {Human (Homo sapiens) [Tax 97.23
d1jb9a1157 Ferredoxin reductase (flavodoxin reductase) N-term 94.53
>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ferredoxin reductase-like, C-terminal NADP-linked domain
superfamily: Ferredoxin reductase-like, C-terminal NADP-linked domain
family: Flavohemoglobin, C-terminal domain
domain: Flavohemoglobin, C-terminal domain
species: Alcaligenes eutrophus [TaxId: 106590]
Probab=99.59  E-value=2.6e-15  Score=131.96  Aligned_cols=71  Identities=21%  Similarity=0.469  Sum_probs=56.2

Q ss_pred             ccccEEEEecCcChHHHHHHHHHHHHHhhcCCCCCCceEEEEEeccCCchHHHHHHHHHhccCCcccCCCceEEEEEEcC
Q 009819          238 MYENLILVAGGIGISPFLAILSDILHRINEGKSCLPRNVLIVWAVKKSNELSLLSNFYKESICPFFSDKLNLETFIYVTR  317 (524)
Q Consensus       238 ~~~~vVLIAGGiGITP~lSiL~~Ll~~~~~~~~~~~rkV~LiW~vRs~~dl~wl~ell~ell~~~~~~~~~l~I~IyVTr  317 (524)
                      ..+++||||||||||||+||+++++++       ..++++|+|++|+.+++.+.+++.+. .    .+..+++++.++++
T Consensus         4 ~~~plvliagGtGIaP~~sil~~~~~~-------~~~~i~li~~~r~~~~l~~~~~~~~~-~----~~~~~~~~~~~~~~   71 (142)
T d1cqxa3           4 AKTPIVLISGGVGLTPMVSMLKVALQA-------PPRQVVFVHGARNSAVHAMRDRLREA-A----KTYENLDLFVFYDQ   71 (142)
T ss_dssp             CCSCEEEEESSCCHHHHHHHHHHHTCS-------SCCCEEEEEEESCSSSCHHHHHHHHH-H----HHCTTEEEEEEESS
T ss_pred             CCCCEEEEEcceeHHHHHHHHHHHHHc-------CCCcEEEEeeccChhhhhhHHHHHHH-H----HhCCCeEEEEEEcc
Confidence            456799999999999999999987643       24689999999999999776655432 1    24568999999998


Q ss_pred             CCC
Q 009819          318 ETE  320 (524)
Q Consensus       318 ~~~  320 (524)
                      ...
T Consensus        72 ~~~   74 (142)
T d1cqxa3          72 PLP   74 (142)
T ss_dssp             CCT
T ss_pred             cCC
Confidence            654



>d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} Back     information, alignment and structure
>d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]} Back     information, alignment and structure
>d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1ja1a3 c.25.1.4 (A:519-678) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qfja1 b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krha1 b.43.4.2 (A:106-205) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1ep3b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1cqxa2 b.43.4.2 (A:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1gvha2 b.43.4.2 (A:147-253) Flavohemoglobin, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmwa1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} Back     information, alignment and structure
>d1fnda1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform [TaxId: 4577]} Back     information, alignment and structure