Citrus Sinensis ID: 009835


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520----
MLSKMFPILEYVALLSVILFQLEPRIADSNNTVMRCIDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLRRSDDENSRGTVLKGTISPALLKLHDLRHLDLSNNHFGGSPLPEFIGSLSRLRYLNLSCGTSLLKVPRPFQYLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLTKSSDWFQVVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDLSEMIQNLSGGCTMNSLEGVCLEGNDITGPLPDLGGFSSLKILVLGENRLNGTIDKSLSQLLKLESLSLGRNSFTGKIPLGTQLQSFNASVYAGNPELCGLPLPNKCPDEESTPLPGRNDGANTLEDEDDQFMTLGFYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQKFRN
cccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccEEcccccccEEEEEccccccccccccccEEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHHHccccccEEEccccccccccccHHHHcccccccEEEEcccccccccccccccccccccccEEEcccccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEcccccccccccccccccccccEEEccccccccccHHHHHHcccccccccccEEEccccccEEccccccccccccEEEcccccccccccHHccccccccEEEccccccEEEcccccccccccHHHHcccccccccccccccccccccccccccccccccccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEHHHHccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEcccccEEEcccccccccccHHHcccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEcccccccccccHHHcccccccEEEcccccccccccccHHHccccccEEEEEccccccccccHHHcccccccccEEEEcccccccccccccHHHcccccccEEEcEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHccHHHccccccEEEccccEEccEHHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
MLSKMFPILEYVALLSVILFQlepriadsnntvMRCIDEEREALLTFKQSLVDEYGvlsswgkdndkrdcckwrgvrcsnktghVKVLNLrrsddensrgtvlkgtispallklhdlrhldlsnnhfggsplpefiGSLSRLRYLNLScgtsllkvprpfqyLSGLVYLHLensnlfslgSLQWLSHLSSLRHLDLSYINLTKSSDWFQVVAKLRSLKTLVlhscalppinpssiwhfnlstsietldlsdnnlpsssvypwlfnLSRNIQYLNLGfnslqgsiPEAFQLMVSLRFLYLTsneleggipkffgkmcslnrlclpynklsGDLSEMIQNLsggctmnslegvclegnditgplpdlggfsslkilvlgenrlngtiDKSLSQLLKLEslslgrnsftgkiplgtqlqsfnasvyagnpelcglplpnkcpdeestplpgrndgantlededdqFMTLGFYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQKFRN
MLSKMFPILEYVALLSVILFQLEPRIADSNNTVMRCIDEEREALLTFKQSLVDEYgvlsswgkdndkrdcckwrgvrcsnktghvkvlnlrrsddensrgtvLKGTISPALLKLHDLRHLDLSNNHFGGSPLPEFIGSLSRLRYLNLSCGTSLLKVPRPFQYLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLTKSSDWFQVVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDLSEMIQNLSGGCTMNSLEGVCLEGNDITGPLPDLGGFSSLKILVLGENRLNGTIDKSLSQLLKLESLSLGRNSFTGKIPLGTQLQSFNASVYAGNPELCGLPLPNKCPDEESTPLPGRNDGANTLEDEDDQFMTLGFYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQKFRN
MLSKMFPILEYVALLSVILFQLEPRIADSNNTVMRCIDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLRRSDDENSRGTVLKGTISPAllklhdlrhldlSNNHFGGSPLPEFIGSLSRLRYLNLSCGTSLLKVPRPFQYLSGLVYLHLENSNLFslgslqwlshlsslrhldlsYINLTKSSDWFQVVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETldlsdnnlpsssVYPWLFNLSRNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDLSEMIQNLSGGCTMNSLEGVCLEGNDITGPLPDLGGFSSLKILVLGENRLNGTIDKslsqllkleslslGRNSFTGKIPLGTQLQSFNASVYAGNPELCGLPLPNKCPDEESTPLPGRNDGANTLEDEDDQFMTLGFYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQKFRN
****MFPILEYVALLSVILFQLEPRIADSNNTVMRCIDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLR*********TVLKGTISPALLKLHDLRHLDLSNNHFGGSPLPEFIGSLSRLRYLNLSCGTSLLKVPRPFQYLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLTKSSDWFQVVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDLSEMIQNLSGGCTMNSLEGVCLEGNDITGPLPDLGGFSSLKILVLGENRLNGTIDKSLSQLLKLESLSLGRNSFTGKIPLGTQLQSFNASVYAGNPELCGLP****************************QFMTLGFYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKL*****
*********EYVALLSVILFQLEPRIA***********EEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLRRSDDENSRGTVLKGTISPALLKLHDLRHLDLSNNHFGGSPLPEFIGSLSRLRYLNLSCGTSLLKVPRPFQYLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLTKSSDWFQVVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDLSEMIQNLSGGCTMNSLEGVCLEGNDITGPLPDLGGFSSLKILVLGENRLNGTIDKSLSQLLKLESLSLGRNSFTGKIPLGTQLQSFNASVYAGNPELCGLPLP***************************FMTLGFYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQKFR*
MLSKMFPILEYVALLSVILFQLEPRIADSNNTVMRCIDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLRRSDDENSRGTVLKGTISPALLKLHDLRHLDLSNNHFGGSPLPEFIGSLSRLRYLNLSCGTSLLKVPRPFQYLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLTKSSDWFQVVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDLSEMIQNLSGGCTMNSLEGVCLEGNDITGPLPDLGGFSSLKILVLGENRLNGTIDKSLSQLLKLESLSLGRNSFTGKIPLGTQLQSFNASVYAGNPELCGLPLPNKCPDEESTPLPGRNDGANTLEDEDDQFMTLGFYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQKFRN
*LSKMFPILEYVALLSVILFQLEPRIADSNNTVMRCIDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLRRSDDENSRGTVLKGTISPALLKLHDLRHLDLSNNHFGGSPLPEFIGSLSRLRYLNLSCGTSLLKVPRPFQYLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLTKSSDWFQVVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDLSEMIQNLSGGCTMNSLEGVCLEGNDITGPLPDLGGFSSLKILVLGENRLNGTIDKSLSQLLKLESLSLGRNSFTGKIPLGTQLQSFNASVYAGNPELCGLPLPNKCP*****************EDEDDQFMTLGFYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQK***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSKMFPILEYVALLSVILFQLEPRIADSNNTVMRCIDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLRRSDDENSRGTVLKGTISPALLKLHDLRHLDLSNNHFGGSPLPEFIGSLSRLRYLNLSCGTSLLKVPRPFQYLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLTKSSDWFQVVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDLSEMIQNLSGGCTMNSLEGVCLEGNDITGPLPDLGGFSSLKILVLGENRLNGTIDKSLSQLLKLESLSLGRNSFTGKIPLGTQLQSFNASVYAGNPELCGLPLPNKCPDEESTPLPGRNDGANTLEDEDDQFMTLGFYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQKFRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query524 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.666 0.412 0.329 3e-28
Q9SHI2 1101 Leucine-rich repeat recep no no 0.711 0.338 0.312 6e-28
C0LGE4 882 Probable LRR receptor-lik no no 0.732 0.435 0.287 2e-26
Q6XAT2 967 LRR receptor-like serine/ no no 0.702 0.380 0.289 2e-26
Q42371 976 LRR receptor-like serine/ no no 0.688 0.369 0.310 6e-26
C0LGW6 966 LRR receptor-like serine/ no no 0.685 0.371 0.294 8e-26
O49545 1003 Leucine-rich repeat recep no no 0.734 0.383 0.295 1e-25
Q9SD62 1025 Putative receptor-like pr no no 0.719 0.367 0.304 3e-25
Q9LRT1 1016 Probably inactive leucine no no 0.679 0.350 0.306 6e-25
Q9M2Z1 1002 Leucine-rich repeat recep no no 0.688 0.360 0.305 1e-24
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 127/385 (32%), Positives = 189/385 (49%), Gaps = 36/385 (9%)

Query: 36  CIDEEREALLTFKQSLVDEYGVLSSW-------GKDNDKRDCCKWRGVRCSNKTGHVKVL 88
           C D++R+ALL F+     E+ + +SW       G  N   DCC W GV C++K+G V  L
Sbjct: 34  CRDDQRDALLEFR----GEFPINASWHIMNQWRGPWNKSTDCCLWNGVTCNDKSGQVISL 89

Query: 89  NLRRSDDENSRGTVLKGTISPALLKLHDLRHLDLSNNHFGGSPLPEFIGSLSRLRYLNLS 148
           ++  +   N   T      + +L KL  LRHLDL+N +  G  +P  +G+LS L  +NL 
Sbjct: 90  DIPNTFLNNYLKT------NSSLFKLQYLRHLDLTNCNLYGE-IPSSLGNLSHLTLVNLY 142

Query: 149 CGTSLLKVPRPFQYLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLT-KSSDW 207
               + ++P     L+ L +L L N N+ +      L +LS L +L+L    L  K  D 
Sbjct: 143 FNKFVGEIPASIGNLNQLRHLILAN-NVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPD- 200

Query: 208 FQVVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLS 267
              +  L+ L+ L L S  L    PSS+   NLS  +  L L+ N L    V   + NL 
Sbjct: 201 --SIGDLKQLRNLSLASNNLIGEIPSSLG--NLSNLVH-LVLTHNQL-VGEVPASIGNLI 254

Query: 268 RNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNK 327
             ++ ++   NSL G+IP +F  +  L    L+SN      P       +L    + YN 
Sbjct: 255 E-LRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNS 313

Query: 328 LSGDLSEMIQNLSGGCTMNSLEGVCLEGNDITGPLPDLGGFSSLKI--LVLGENRLNGTI 385
            SG   + +        + SLE + L+ N  TGP+      SS K+  L+LG NRL+G I
Sbjct: 314 FSGPFPKSL------LLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPI 367

Query: 386 DKSLSQLLKLESLSLGRNSFTGKIP 410
            +S+S+LL LE L +  N+FTG IP
Sbjct: 368 PESISRLLNLEELDISHNNFTGAIP 392




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGE4|Y1124_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=1 SV=1 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query524
225464712 1021 PREDICTED: receptor-like protein 12-like 0.709 0.364 0.446 1e-79
224105895 963 predicted protein [Populus trichocarpa] 0.761 0.414 0.460 1e-78
302143724546 unnamed protein product [Vitis vinifera] 0.847 0.813 0.388 7e-78
359490572 975 PREDICTED: probable LRR receptor-like se 0.704 0.378 0.429 5e-75
224125666 938 predicted protein [Populus trichocarpa] 0.757 0.423 0.459 7e-75
224116866 994 predicted protein [Populus trichocarpa] 0.698 0.368 0.451 1e-69
224105891 1036 predicted protein [Populus trichocarpa] 0.698 0.353 0.451 2e-69
225466147 1024 PREDICTED: LRR receptor-like serine/thre 0.702 0.359 0.466 8e-69
147807651 971 hypothetical protein VITISV_018647 [Viti 0.715 0.386 0.402 2e-66
255570346 831 serine-threonine protein kinase, plant-t 0.650 0.410 0.442 3e-66
>gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  303 bits (776), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 189/423 (44%), Positives = 246/423 (58%), Gaps = 51/423 (12%)

Query: 36  CIDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLRR-SD 94
           C+++ER+ALL FKQ LVD++G+LSSWG + D+RDCCKWRGV+CSN+T HV +L+L     
Sbjct: 52  CVEKERQALLDFKQGLVDDFGILSSWGNEEDRRDCCKWRGVQCSNRTSHVIMLDLHALPT 111

Query: 95  DENSRGTVLKGTISPALLKLHDLRHLDLSNNHFGGSPLPEFIGSLSRLRYLNLSCGTSLL 154
           D   +   L+G IS +LL+L  L HLDLS N F GS +PEFIG  S+LRYLNLS      
Sbjct: 112 DTVHKYQSLRGRISSSLLELQHLNHLDLSLNDFQGSYVPEFIGLFSKLRYLNLSEARLAG 171

Query: 155 KVPRPFQYLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLTKSSDWFQVVAKL 214
            +P     LS L +L L  +   S  +L+WLS LSSLRHLDLS +NL K+  W  V+ +L
Sbjct: 172 MIPSHLGNLSNLHFLDLSRNYGMSSETLEWLSRLSSLRHLDLSGLNLDKAIYWEHVINRL 231

Query: 215 RSLKTLVLHSCALPP-INPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRNIQYL 273
            SL  L+LH  ALP  I PS++ + N S S+  LDLS N L SSSVYPWLFNLS ++ +L
Sbjct: 232 PSLTDLLLHDSALPQIITPSALSYTNSSKSLVVLDLSWNFL-SSSVYPWLFNLSSSLVHL 290

Query: 274 NLGFNSLQGSIPEAFQLMVSLRFL------------------------------------ 297
           +L  N +QG IP+ F  MVSL +L                                    
Sbjct: 291 DLSINQIQGLIPDTFGEMVSLEYLDLFFNQLEGEIPQSLTSTSLVHLDLSVNHLHGSIPD 350

Query: 298 ---YLTS--------NELEGGIPKFFGKMCSLNRLCLPYNKLSGDLSEMIQNLSGGCTMN 346
              ++TS        N+LEGGIPK F  +CSL  + L  N L+  L E +QN S  C+ +
Sbjct: 351 TFGHMTSLSYLDLSLNQLEGGIPKSFKNLCSLQMVMLLSNSLTAQLPEFVQN-SLSCSKD 409

Query: 347 SLEGVCLEGNDITGPLPDLGGFSSLKILVLGENRLNGTIDKSLSQLLKLESLSLGRNSFT 406
           +LE + L  N  TG  P+  GFS L  L +  NRLNGT  + + QL +LE L +  NS  
Sbjct: 410 TLEVLVLSWNQFTGSFPNFTGFSVLGHLYIDHNRLNGTFPEHIGQLSQLEVLEISGNSLH 469

Query: 407 GKI 409
           G I
Sbjct: 470 GNI 472




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224105895|ref|XP_002333753.1| predicted protein [Populus trichocarpa] gi|222838401|gb|EEE76766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302143724|emb|CBI22585.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125666|ref|XP_002329688.1| predicted protein [Populus trichocarpa] gi|222870596|gb|EEF07727.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224116866|ref|XP_002331833.1| predicted protein [Populus trichocarpa] gi|222875071|gb|EEF12202.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105891|ref|XP_002333752.1| predicted protein [Populus trichocarpa] gi|222838400|gb|EEE76765.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225466147|ref|XP_002270042.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147807651|emb|CAN64389.1| hypothetical protein VITISV_018647 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255570346|ref|XP_002526132.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223534509|gb|EEF36208.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query524
TAIR|locus:2044767 905 AT2G34930 "AT2G34930" [Arabido 0.698 0.404 0.301 3.1e-32
TAIR|locus:2043540 960 AT2G25790 [Arabidopsis thalian 0.272 0.148 0.364 1.9e-23
TAIR|locus:2091260372 DRT100 "DNA-DAMAGE REPAIR/TOLE 0.370 0.521 0.298 2.5e-23
TAIR|locus:2182260371 AT5G12940 [Arabidopsis thalian 0.295 0.417 0.355 3.3e-23
TAIR|locus:2005629 1140 AT1G75640 [Arabidopsis thalian 0.332 0.152 0.337 2e-22
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.515 0.288 0.245 4e-14
TAIR|locus:2005507 976 ER "ERECTA" [Arabidopsis thali 0.337 0.181 0.286 2e-21
TAIR|locus:2066306480 AT2G26380 [Arabidopsis thalian 0.269 0.293 0.331 1.2e-19
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.631 0.345 0.283 2.5e-19
TAIR|locus:2139885 1013 AT4G28650 [Arabidopsis thalian 0.272 0.141 0.324 2.8e-19
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 363 (132.8 bits), Expect = 3.1e-32, P = 3.1e-32
 Identities = 118/391 (30%), Positives = 173/391 (44%)

Query:    35 RCIDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLRRSD 94
             +CI  ER+ALLTF+ +L D    L SW       DCC W GV C  +T HV  ++LR   
Sbjct:    32 KCISTERQALLTFRAALTDLSSRLFSWSGP----DCCNWPGVLCDARTSHVVKIDLRNPS 87

Query:    95 -----DENSRGTVLKGTISPAXXXXXXXXXXXXSNNHFGGSPLPEFIGSLSRLRYLNLSC 149
                  DE  RG+ L+G I P+            S+N F    +PEFIG +  LRYLNLS 
Sbjct:    88 QDVRSDEYKRGS-LRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSS 146

Query:   150 GTSLLKVPRPFQYLSGLVYLHL--ENS------NLFXXXXXXXXXXXXXXXXXXXXYINL 201
              +   ++P     LS L  L L  E+       +L                     Y+NL
Sbjct:   147 SSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNL 206

Query:   202 TKSSD-WFQVVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETXXXXXXXXXXXXVY 260
             + + + W Q  +++ +LK L L +  L  + P+     +L   +E             + 
Sbjct:   207 SGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKL-LEVLDLSENSLNSP-IP 264

Query:   261 PWLFNLSRNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSN-ELEGGIPKFFGKMCSLN 319
              WLF L+ N++ L L ++ LQGSIP  F+ +  L  L L++N  L+G IP   G +  L 
Sbjct:   265 NWLFGLT-NLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLK 323

Query:   320 RLCLPYNKLSGDLSEMIQNLSGGCTMNSLEGVCLEGNDITGPLPD-LGGFSSLKILVLGE 378
              L L  N+L+G +   +   S     NSL  + L  N + G LP+ LG   +L+ L L  
Sbjct:   324 FLDLSANELNGQIHGFLDAFSRN-KGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSS 382

Query:   379 NRLNGTIDKXXXXXXXXXXXXXGRNSFTGKI 409
             N   G++                 N+  G I
Sbjct:   383 NSFTGSVPSSIGNMASLKKLDLSNNAMNGTI 413


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2043540 AT2G25790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091260 DRT100 "DNA-DAMAGE REPAIR/TOLERATION 100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182260 AT5G12940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005629 AT1G75640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005507 ER "ERECTA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066306 AT2G26380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139885 AT4G28650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00037814001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (996 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query524
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  144 bits (366), Expect = 1e-36
 Identities = 144/463 (31%), Positives = 202/463 (43%), Gaps = 113/463 (24%)

Query: 39  EEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLRRSDDENS 98
           EE E LL+FK S+ D    LS+W   N   D C W+G+ C+N +  V  ++L        
Sbjct: 29  EELELLLSFKSSINDPLKYLSNW---NSSADVCLWQGITCNNSS-RVVSIDLS------- 77

Query: 99  RGTVLKGTISPALLKL-------------------------HDLRHLDLSNNHFGGS--- 130
            G  + G IS A+ +L                           LR+L+LSNN+F GS   
Sbjct: 78  -GKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR 136

Query: 131 ------------------PLPEFIGSLSRLRYLNLSCGTSLLKVPRPFQYLSGLVYLHLE 172
                              +P  IGS S L+ L+L     + K+P     L+ L +L L 
Sbjct: 137 GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLA 196

Query: 173 NSNLF-----SLG---SLQW---------------LSHLSSLRHLDLSYINLTKSSDWFQ 209
           ++ L       LG   SL+W               +  L+SL HLDL Y NLT       
Sbjct: 197 SNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIP--S 254

Query: 210 VVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRN 269
            +  L++L+ L L+   L    P SI  F+L   I +LDLSDN+L  S   P L    +N
Sbjct: 255 SLGNLKNLQYLFLYQNKLSGPIPPSI--FSLQKLI-SLDLSDNSL--SGEIPELVIQLQN 309

Query: 270 IQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLS 329
           ++ L+L  N+  G IP A   +  L+ L L SN+  G IPK  GK  +L  L L  N L+
Sbjct: 310 LEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLT 369

Query: 330 GDLSEMIQNLSGGCTM-----NSLEG--------------VCLEGNDITGPLPDLGGFSS 370
           G++ E + + SG         NSLEG              V L+ N  +G LP    F+ 
Sbjct: 370 GEIPEGLCS-SGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPS--EFTK 426

Query: 371 LKI---LVLGENRLNGTIDKSLSQLLKLESLSLGRNSFTGKIP 410
           L +   L +  N L G I+     +  L+ LSL RN F G +P
Sbjct: 427 LPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLP 469


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 524
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.98
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.84
KOG4237498 consensus Extracellular matrix protein slit, conta 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
PLN03150623 hypothetical protein; Provisional 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
PLN03150623 hypothetical protein; Provisional 99.54
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.4
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.33
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.3
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.23
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.23
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.22
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.22
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.2
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.99
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.86
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.85
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.84
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.71
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.7
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.64
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.6
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.53
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.42
KOG4341483 consensus F-box protein containing LRR [General fu 98.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.26
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.22
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.16
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.13
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.1
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.1
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.01
KOG4341483 consensus F-box protein containing LRR [General fu 98.01
PRK15386426 type III secretion protein GogB; Provisional 97.94
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.75
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.63
PRK15386426 type III secretion protein GogB; Provisional 97.62
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.95
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.89
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.88
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.72
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.48
KOG4308478 consensus LRR-containing protein [Function unknown 96.38
KOG4308478 consensus LRR-containing protein [Function unknown 94.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.82
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.48
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.0
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 90.5
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.01
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.02
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.28
smart0037026 LRR Leucine-rich repeats, outliers. 87.28
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 87.03
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.97
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.91
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.76
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 86.18
smart0037026 LRR Leucine-rich repeats, outliers. 85.87
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.87
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 85.23
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.76
PF08374 221 Protocadherin: Protocadherin; InterPro: IPR013585 80.28
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.8e-44  Score=404.04  Aligned_cols=284  Identities=35%  Similarity=0.508  Sum_probs=168.3

Q ss_pred             CHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCcccceEeCCCCCcEEEEEcCCCCCC----------------CCCC
Q 009835           37 IDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLRRSDDE----------------NSRG  100 (524)
Q Consensus        37 ~~~~~~~l~~~~~~~~~~~~~~~~W~~~~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~~~----------------~~~~  100 (524)
                      .++|+.||++||+++.+|.+.+.+|+   .+.+||.|.||+|++ .++|+.|+|+++.+.                ++.+
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~  102 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSN  102 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecCCCccccCChHHhCCCCCCEEECCC
Confidence            45799999999999988877889997   577899999999974 468999999886431                3455


Q ss_pred             CcceeecCcccc-CCCCCCEEEccCCCCCCC---------------------CCccccCCCCCCCEEEccCCCCCccCCc
Q 009835          101 TVLKGTISPALL-KLHDLRHLDLSNNHFGGS---------------------PLPEFIGSLSRLRYLNLSCGTSLLKVPR  158 (524)
Q Consensus       101 ~~l~~~~~~~l~-~l~~L~~L~Ls~n~l~~~---------------------~~p~~l~~l~~L~~L~L~~n~~~~~~p~  158 (524)
                      |.+.+.+|..+. .+++|++|+|++|.+++.                     .+|..++.+++|++|+|++|.+.+.+|.
T Consensus       103 n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~  182 (968)
T PLN00113        103 NQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPN  182 (968)
T ss_pred             CccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCCh
Confidence            566666665544 555555555555544332                     1344455555555555555555555555


Q ss_pred             cccCCCCCcEEEccCCCCCCCCCchhcCCCCCCcEEEccCCCCCCCCCchHhhhcccCCCEEEeeCCCCCCCCCCc----
Q 009835          159 PFQYLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLTKSSDWFQVVAKLRSLKTLVLHSCALPPINPSS----  234 (524)
Q Consensus       159 ~~~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~----  234 (524)
                      .++++++|++|++++|.+.... +..+.++++|++|++++|.+.+..  +..+.++++|++|++++|.+.+..|..    
T Consensus       183 ~~~~l~~L~~L~L~~n~l~~~~-p~~l~~l~~L~~L~L~~n~l~~~~--p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l  259 (968)
T PLN00113        183 SLTNLTSLEFLTLASNQLVGQI-PRELGQMKSLKWIYLGYNNLSGEI--PYEIGGLTSLNHLDLVYNNLTGPIPSSLGNL  259 (968)
T ss_pred             hhhhCcCCCeeeccCCCCcCcC-ChHHcCcCCccEEECcCCccCCcC--ChhHhcCCCCCEEECcCceeccccChhHhCC
Confidence            5555555555555555544221 233445555555555555544321  234444445555555544444333320    


Q ss_pred             ------------------hhhhcccCcccEEEccCCCCCCCCCCchhhhccccccEEEeeccccccccchhhhcccccce
Q 009835          235 ------------------IWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRNIQYLNLGFNSLQGSIPEAFQLMVSLRF  296 (524)
Q Consensus       235 ------------------~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~  296 (524)
                                        ..+... ++|++|++++|.+.+ .+|..+.... +|+.|++++|.+++.+|..+..+++|+.
T Consensus       260 ~~L~~L~L~~n~l~~~~p~~l~~l-~~L~~L~Ls~n~l~~-~~p~~~~~l~-~L~~L~l~~n~~~~~~~~~~~~l~~L~~  336 (968)
T PLN00113        260 KNLQYLFLYQNKLSGPIPPSIFSL-QKLISLDLSDNSLSG-EIPELVIQLQ-NLEILHLFSNNFTGKIPVALTSLPRLQV  336 (968)
T ss_pred             CCCCEEECcCCeeeccCchhHhhc-cCcCEEECcCCeecc-CCChhHcCCC-CCcEEECCCCccCCcCChhHhcCCCCCE
Confidence                              022222 555555555555544 3444443333 6666777777666666667777777777


Q ss_pred             EeecCcccccccchhhcCCCCCCEEEccCCCCCC
Q 009835          297 LYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSG  330 (524)
Q Consensus       297 L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~  330 (524)
                      |++++|.+.+.+|..++.+++|+.|++++|.+++
T Consensus       337 L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~  370 (968)
T PLN00113        337 LQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTG  370 (968)
T ss_pred             EECcCCCCcCcCChHHhCCCCCcEEECCCCeeEe
Confidence            7777777776666655555555555555555443



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query524
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-12
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-08
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-08
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Iteration: 1

Score = 69.7 bits (169), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 49/132 (37%), Positives = 68/132 (51%), Gaps = 13/132 (9%) Query: 260 YPWLFNLSRNIQYLNL----GFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKM 315 YP +L+ N+ YLN G N+L G IP A + L +LY+T + G IP F ++ Sbjct: 66 YPIPSSLA-NLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQI 124 Query: 316 CSLNRLCLPYNKLSGDLSEMIQNLSGGCTMNSLEGVCLEGNDITGPLPD-LGGFSSL-KI 373 +L L YN LSG L I +L +L G+ +GN I+G +PD G FS L Sbjct: 125 KTLVTLDFSYNALSGTLPPSISSLP------NLVGITFDGNRISGAIPDSYGSFSKLFTS 178 Query: 374 LVLGENRLNGTI 385 + + NRL G I Sbjct: 179 MTISRNRLTGKI 190
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query524
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-75
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-51
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-47
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-59
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-35
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-34
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-30
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-27
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-15
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-10
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  250 bits (641), Expect = 9e-75
 Identities = 108/396 (27%), Positives = 178/396 (44%), Gaps = 38/396 (9%)

Query: 36  CIDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCKWRGVRCSNKTGHVKVLNLRRSDD 95
            +  E   L++FK  L D+  +L  W   +  ++ C + GV C +    V  ++L     
Sbjct: 9   SLYREIHQLISFKDVLPDK-NLLPDW---SSNKNPCTFDGVTCRD--DKVTSIDLS---- 58

Query: 96  ENSRGTVLKGTISPALLKLHDLRHLDLSNNHFGGSPLPEFIGSLSRLRYLNLSCGTSLLK 155
            +    V    +S +LL L  L  L LSN+H  GS +  F    + L  L+LS  +    
Sbjct: 59  -SKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGS-VSGF-KCSASLTSLDLSRNSLSGP 115

Query: 156 VPRPFQ--YLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLTKS-SDWFQVVA 212
           V         SGL +L++ ++ L   G +     L+SL  LDLS  +++ +    + +  
Sbjct: 116 VTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSD 175

Query: 213 KLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRNIQY 272
               LK L +    +       +       ++E LD+S NN   S+  P+L + S  +Q+
Sbjct: 176 GCGELKHLAISGNKI----SGDVDVSRC-VNLEFLDVSSNNF--STGIPFLGDCS-ALQH 227

Query: 273 LNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDL 332
           L++  N L G    A      L+ L ++SN+  G IP     + SL  L L  NK +G++
Sbjct: 228 LDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEI 285

Query: 333 SEMIQNLSGGCTMNSLEGVCLEGNDITGPLPD-LGGFSSLKILVLGENRLNGTI-DKSLS 390
            +    LSG C   +L G+ L GN   G +P   G  S L+ L L  N  +G +   +L 
Sbjct: 286 PD---FLSGACD--TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLL 340

Query: 391 QLLKLESLSLGRNSFTGKIP-----LGTQLQSFNAS 421
           ++  L+ L L  N F+G++P     L   L + + S
Sbjct: 341 KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLS 376


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query524
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.35
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.28
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.25
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.22
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.13
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.8
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.66
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.56
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.47
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.45
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.71
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.55
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.99
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.44
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 89.59
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 88.95
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 85.91
2l9u_A40 Receptor tyrosine-protein kinase ERBB-3; transmenb 81.47
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.1e-47  Score=418.03  Aligned_cols=173  Identities=35%  Similarity=0.586  Sum_probs=137.4

Q ss_pred             ccccEEEeeccccccccchhhhcccccceEeecCcccccccchhhcCCCCCCEEEccCCCCCCchhHHHHhccC------
Q 009835          268 RNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDLSEMIQNLSG------  341 (524)
Q Consensus       268 ~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~------  341 (524)
                      ++|++|++++|++++.+|.+++.+++|++|++++|++++.+|..+..+++|++|++++|.+++.+|..+.....      
T Consensus       490 ~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~  569 (768)
T 3rgz_A          490 TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANF  569 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCST
T ss_pred             CCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhc
Confidence            37888888888888888888888888888888888877777777777777766666666666555543322100      


Q ss_pred             --------------------------------------------------------------------------------
Q 009835          342 --------------------------------------------------------------------------------  341 (524)
Q Consensus       342 --------------------------------------------------------------------------------  341 (524)
                                                                                                      
T Consensus       570 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip  649 (768)
T 3rgz_A          570 IAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP  649 (768)
T ss_dssp             TCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCC
T ss_pred             cccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCC
Confidence                                                                                            


Q ss_pred             --CCCCCCccEEEcCCCCCccCCCC-CCCCCCCcEEEccCCcCccccchhhhcCCCCCEEECcCCcCeeeCCCCCccccc
Q 009835          342 --GCTMNSLEGVCLEGNDITGPLPD-LGGFSSLKILVLGENRLNGTIDKSLSQLLKLESLSLGRNSFTGKIPLGTQLQSF  418 (524)
Q Consensus       342 --~~~~~~L~~L~Ls~n~l~~~~~~-~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~l~~N~l~~~~p~~~~~~~~  418 (524)
                        ...+++|+.|+|++|+++|.+|. ++++++|++|||++|+++|.+|..+.++++|++||+++|+++|.+|...++.++
T Consensus       650 ~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~  729 (768)
T 3rgz_A          650 KEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETF  729 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGS
T ss_pred             HHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccC
Confidence              01234788888888888887776 888999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccCCCCCCCCCCCCCCCCC
Q 009835          419 NASVYAGNPELCGLPLPNKCPDE  441 (524)
Q Consensus       419 ~~~~~~gn~~~C~~~~~~~c~~~  441 (524)
                      ....+.|||.+||.|.. .|...
T Consensus       730 ~~~~~~gN~~Lcg~~l~-~C~~~  751 (768)
T 3rgz_A          730 PPAKFLNNPGLCGYPLP-RCDPS  751 (768)
T ss_dssp             CGGGGCSCTEEESTTSC-CCCSC
T ss_pred             CHHHhcCCchhcCCCCc-CCCCC
Confidence            99999999999999886 78654



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2l9u_A Receptor tyrosine-protein kinase ERBB-3; transmenbrane dimer, membrane protein, EGFR; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 524
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 93.7 bits (231), Expect = 1e-21
 Identities = 83/403 (20%), Positives = 134/403 (33%), Gaps = 98/403 (24%)

Query: 36  CIDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCC--KWRGVRCSNKTGHVKVLNLRRS 93
           C  ++++ALL  K+ L +    LSSW       DCC   W GV C   T   +V      
Sbjct: 3   CNPQDKQALLQIKKDLGNP-TTLSSW---LPTTDCCNRTWLGVLCDTDTQTYRV------ 52

Query: 94  DDENSRGTVLKGTISPALLKLHDLRHLDLSNNHFGGS-PLPEFIGSLSRLRYLNLSCGTS 152
                                    +LDLS  +     P+P  + +L  L +L +    +
Sbjct: 53  ------------------------NNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINN 88

Query: 153 LLKVPRPFQYLSGLVYLHLENSNLFSLGSLQWLSHLSSLRHLDLSYINLTKSSDWFQVVA 212
           L+    P                                +   L Y+ +T ++    +  
Sbjct: 89  LVGPIPPAIA-----------------------------KLTQLHYLYITHTNVSGAIPD 119

Query: 213 KLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLSRNIQY 272
            L  +KTLV    +   ++ +     +   ++  +    N + S ++     + S+    
Sbjct: 120 FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRI-SGAIPDSYGSFSKLFTS 178

Query: 273 LNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDL 332
           + +  N L G IP  F  +                     G    L        K+    
Sbjct: 179 MTISRNRLTGKIPPTFANLNLAFVDL--------SRNMLEGDASVLFGSDKNTQKIHLAK 230

Query: 333 SEMIQNLSGGCTMNSLEGVCLEGNDITGPLPDLGGFSSLKILVLGENRLNGTIDKSLSQL 392
           + +  +L       +L G+ L  N I G LP                         L+QL
Sbjct: 231 NSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQ-----------------------GLTQL 267

Query: 393 LKLESLSLGRNSFTGKIPLGTQLQSFNASVYAGNPELCGLPLP 435
             L SL++  N+  G+IP G  LQ F+ S YA N  LCG PLP
Sbjct: 268 KFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP 310


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query524
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.68
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.39
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.35
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.04
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.85
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.67
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.39
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.6e-41  Score=331.79  Aligned_cols=304  Identities=31%  Similarity=0.487  Sum_probs=216.2

Q ss_pred             CCCHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCc--ccceEeCCCC--CcEEEEEcCCCCCCCCCCCccee--ecC
Q 009835           35 RCIDEEREALLTFKQSLVDEYGVLSSWGKDNDKRDCCK--WRGVRCSNKT--GHVKVLNLRRSDDENSRGTVLKG--TIS  108 (524)
Q Consensus        35 ~~~~~~~~~l~~~~~~~~~~~~~~~~W~~~~~~~~~c~--w~gv~c~~~~--~~v~~L~L~~~~~~~~~~~~l~~--~~~  108 (524)
                      -|.++|++||++||+++.+|. .+.+|.   .+.|||.  |.||+|+...  .||+.|+|+++        .+.|  .+|
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~--------~l~g~~~lp   69 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL--------NLPKPYPIP   69 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECC--------CCSSCEECC
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCCC--------CCCCCCCCC
Confidence            499999999999999999874 688997   5789994  9999998643  48999999985        5555  678


Q ss_pred             ccccCCCCCCEEEccC-CCCCCCCCccccCCCCCCCEEEccCCCCCccCCccccCCCCCcEEEccCCCCCCCCCchhcCC
Q 009835          109 PALLKLHDLRHLDLSN-NHFGGSPLPEFIGSLSRLRYLNLSCGTSLLKVPRPFQYLSGLVYLHLENSNLFSLGSLQWLSH  187 (524)
Q Consensus       109 ~~l~~l~~L~~L~Ls~-n~l~~~~~p~~l~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~  187 (524)
                      ++++++++|++|+|++ |.+.+. +|..|+++++|++|+|++|++.+..+..+..+.+|+++++++|.+..         
T Consensus        70 ~~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~---------  139 (313)
T d1ogqa_          70 SSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSG---------  139 (313)
T ss_dssp             GGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEES---------
T ss_pred             hHHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccccccc---------
Confidence            8888888888888886 677775 77777777777777777777776666656555555555555544331         


Q ss_pred             CCCCcEEEccCCCCCCCCCchHhhhcccCCCEEEeeCCCCCCCCCCchhhhcccCcccEEEccCCCCCCCCCCchhhhcc
Q 009835          188 LSSLRHLDLSYINLTKSSDWFQVVAKLRSLKTLVLHSCALPPINPSSIWHFNLSTSIETLDLSDNNLPSSSVYPWLFNLS  267 (524)
Q Consensus       188 l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~~  267 (524)
                                      ..  +..+.++                           +.++++++++|.+.+ .+|..+....
T Consensus       140 ----------------~~--p~~l~~l---------------------------~~L~~l~l~~n~l~~-~ip~~~~~l~  173 (313)
T d1ogqa_         140 ----------------TL--PPSISSL---------------------------PNLVGITFDGNRISG-AIPDSYGSFS  173 (313)
T ss_dssp             ----------------CC--CGGGGGC---------------------------TTCCEEECCSSCCEE-ECCGGGGCCC
T ss_pred             ----------------cC--chhhccC---------------------------cccceeecccccccc-cccccccccc
Confidence                            10  1122232                           333333333333333 3333333333


Q ss_pred             ccccEEEeeccccccccchhhhcccccceEeecCcccccccchhhcCCCCCCEEEccCCCCCCchhHHHHhccCCCCCCC
Q 009835          268 RNIQYLNLGFNSLQGSIPEAFQLMVSLRFLYLTSNELEGGIPKFFGKMCSLNRLCLPYNKLSGDLSEMIQNLSGGCTMNS  347 (524)
Q Consensus       268 ~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~~~~~~~  347 (524)
                      ..++.+++++|++++..|..+..+..+ .++++++...+.+|..+..+++                              
T Consensus       174 ~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~------------------------------  222 (313)
T d1ogqa_         174 KLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKN------------------------------  222 (313)
T ss_dssp             TTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSC------------------------------
T ss_pred             ccccccccccccccccccccccccccc-cccccccccccccccccccccc------------------------------
Confidence            234666666776666666555554333 4666666666555555555444                              


Q ss_pred             ccEEEcCCCCCccCCCCCCCCCCCcEEEccCCcCccccchhhhcCCCCCEEECcCCcCeeeCCCCCcccccccccccCCC
Q 009835          348 LEGVCLEGNDITGPLPDLGGFSSLKILVLGENRLNGTIDKSLSQLLKLESLSLGRNSFTGKIPLGTQLQSFNASVYAGNP  427 (524)
Q Consensus       348 L~~L~Ls~n~l~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~l~~N~l~~~~p~~~~~~~~~~~~~~gn~  427 (524)
                      ++.+++++|.+.+.++.+..+++|+.|+|++|+++|.+|..++++++|++|+|++|+++|.+|....+..+....+.+|+
T Consensus       223 l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         223 TQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSS
T ss_pred             ccccccccccccccccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCc
Confidence            55555555555555555667889999999999999999999999999999999999999999988888899999999999


Q ss_pred             CCCCCCCCCCC
Q 009835          428 ELCGLPLPNKC  438 (524)
Q Consensus       428 ~~C~~~~~~~c  438 (524)
                      .+||.|.+ .|
T Consensus       303 ~l~g~plp-~c  312 (313)
T d1ogqa_         303 CLCGSPLP-AC  312 (313)
T ss_dssp             EEESTTSS-CC
T ss_pred             cccCCCCC-CC
Confidence            99998875 56



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure