Citrus Sinensis ID: 009897

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520---
MGKGEGCQITLDQQLSLSCFTVFSSGPKMERKIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWSQTIESTKLQTPKSFYQFSDFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWGGTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKGPEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAEVANRNGVRYPCTLLFKTVHWMVPDYFLWSTFRSLNRWTELIIHNPGEGFFSWLLALSLSPLLWLSSKVVESCLKWTFPLKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVIDGETTPLVTDIVIFATGYKSDEKLKNIFKSTYFQKQITGSSAPLYREGIHPQIPQLAILGYADSPSILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSMRLYAGESYRRSCVSVLLQKYSNDQLCKDMGCNSKKEKMVFG
cccccHHHHHHHHHHHcccccccccccccccEEEEEcccHHHHHHHHHHHHcccccEEEcccccccccccccccccEEccccccccccccccccccccccccHHHHHHHHHHHHHHccccccEEEccEEEEEEEccccccccccccccccccccccccccEEEEEEEcccccccEEEEEEcEEEEEEccccccccccccccccccccccccEEEEcccccccccccccEEEEEcccccHHHHHHHHHHHccccccEEEEcccEEEEccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEcccHHHHHcccccEEEEcccEEEEEcccEEEccccEEEEccEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEccccccHHHHHHHcccccccHHHccc
ccccHHHHHHHHHHHHcccccccccccHHHcEEEEEEccHcHHHHHHHHHHcccccEEEEccccccHHHHHHHEEEEEccccccEcccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEEEEEEEccccHHHHHHHHHHcccccccccccEEEEEEEEcccccccEEEEEEEEEEEEcccccccccccccccccccHHcccEEEEcHHHccccHHccccEEEEEEccccHHHHHHHHHHHHcccEEEEEEEccccEEEEcccccccccccccHHHHEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccccHHHHHHccccccccccccccEEEEEEEEEccccEEEcccEEEEEcccEcccccEEEEEcccccccccHHccccccccEEcccccEEEEEEEcccccccEEEEEEccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEHHHccHHHHHHHcccccHHHHHcc
mgkgegcqitldqQLSLscftvfssgpkmeRKIAIIGAGVSGLLACKYtlengfkpIVFEarsgiggvwsqtiestklqtpksfyqfsdfawpnsvtetfpdhNKVMEYLQAYAAHFnlfpsikfdtkvtsidrlvpsdedehswdlwggtgkpfsssgkwnVTVQEARNvssateayQVDFVILCIgrysdlpntpdfpmnkgpevfdgkvLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAEVAnrngvrypctllfktvhwmvpdyFLWSTFRSLNRWTELiihnpgegFFSWLLALSLSPLLWLSSKVVESCLkwtfplkkynmipghsfLNQISSCMftvlprnfydrvqggglslmksrsftfcknglvidgettplVTDIVIFATGYKSDEKLKNIFKSTYFqkqitgssaplyregihpqipqlailgyadspsilrTTEMRSKCLAHFlagnsnlptiKEMEHNVMNWEKSMRLYAGESYRRSCVSVLLQKYsndqlckdmgcnskkekmvfg
mgkgegcqitldqqlslSCFTVFSSGPKMERKIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWSQTIESTKLQTPKSFYQFSDFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVpsdedehswdlwGGTGKPFSSSGKWNVTVQEARnvssateayQVDFVILCIGRYSDLPNTPDFPMNKGPEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAEvanrngvrypCTLLFKTVHWMVPDYFLWSTFRSLNRWTELIIHNPGEGFFSWLLALSLSPLLWLSSKVVESCLKWTFPLKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGlvidgettplVTDIVIFATGYKSDEKLKNIFKSTYFQKQITGSSAPLYREGIHPQIPQLAILGYADSPSILRTTEMRSKCLAHFLagnsnlptiKEMEHNVMNWEKSMRLYAGESYRRSCVSVLLQKysndqlckdmgcnskkekmvfg
MGKGEGCQITLDQQLSLSCFTVFSSGPKMERKIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWSQTIESTKLQTPKSFYQFSDFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWGGTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKGPEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAEVANRNGVRYPCTLLFKTVHWMVPDYFLWSTFRSLNRWTELIIHNPGEGFFswllalslspllwlssKVVESCLKWTFPLKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVIDGETTPLVTDIVIFATGYKSDEKLKNIFKSTYFQKQITGSSAPLYREGIHPQIPQLAILGYADSPSILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSMRLYAGESYRRSCVSVLLQKYSNDQLCKDMGCNSKKEKMVFG
******CQITLDQQLSLSCFTVFSSGPKMERKIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWSQTIESTKLQTPKSFYQFSDFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWGGTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPM**GPEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAEVANRNGVRYPCTLLFKTVHWMVPDYFLWSTFRSLNRWTELIIHNPGEGFFSWLLALSLSPLLWLSSKVVESCLKWTFPLKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVIDGETTPLVTDIVIFATGYKSDEKLKNIFKSTYFQKQITGSSAPLYREGIHPQIPQLAILGYADSPSILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSMRLYAGESYRRSCVSVLLQKYSNDQLCKD*************
********ITLDQQLS***************KIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWSQTIESTKLQTPKSFYQFSDFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWGGTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKGPEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAEVANRNGVRYPCTLLFKTVHWMVPDYFLWSTFRSLNRWTELIIHNPGEGFFSWLLALSLSPLLWLSSKVVESCLKWTFPLKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVIDGETTPLVTDIVIFATGYKSDEKLKNIFKSTYFQKQITGSSAPLYREGIHPQIPQLAILGYADSPSILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSMRLYAGESYRRSCVSVLLQKYSNDQLCKDMGCNSKKEKMVFG
MGKGEGCQITLDQQLSLSCFTVFSSGPKMERKIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWSQTIESTKLQTPKSFYQFSDFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWGGTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKGPEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAEVANRNGVRYPCTLLFKTVHWMVPDYFLWSTFRSLNRWTELIIHNPGEGFFSWLLALSLSPLLWLSSKVVESCLKWTFPLKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVIDGETTPLVTDIVIFATGYKSDEKLKNIFKSTYFQKQITGSSAPLYREGIHPQIPQLAILGYADSPSILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSMRLYAGESYRRSCVSVLLQKYSNDQLCKDMGCNSKKEKMVFG
****EGCQITLDQQLSLSCFTVFSSGPKMERKIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWSQTIESTKLQTPKSFYQFSDFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWGGTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKGPEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAEVANRNGVRYPCTLLFKTVHWMVPDYFLWSTFRSLNRWTELIIHNPGEGFFSWLLALSLSPLLWLSSKVVESCLKWTFPLKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVIDGETTPLVTDIVIFATGYKSDEKLKNIFKSTYFQKQITGSSAPLYREGIHPQIPQLAILGYADSPSILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSMRLYAGESYRRSCVSVLLQKYSNDQLCKDMGCNSKKEKMVFG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKGEGCQITLDQQLSLSCFTVFSSGPKMERKIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWSQTIESTKLQTPKSFYQFSDFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWGGTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKGPEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAEVANRNGVRYPCTLLFKTVHWMVPDYFLWSTFRSLNRWTELIIHNPGEGFFSWLLALSLSPLLWLSSKVVESCLKWTFPLKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVIDGETTPLVTDIVIFATGYKSDEKLKNIFKSTYFQKQITGSSAPLYREGIHPQIPQLAILGYADSPSILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSMRLYAGESYRRSCVSVLLQKYSNDQLCKDMGCNSKKEKMVFG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query523 2.2.26 [Sep-21-2011]
Q9LMA1530 Probable flavin-containin yes no 0.904 0.892 0.376 9e-87
Q9FKE7459 Putative flavin-containin no no 0.831 0.947 0.349 6e-76
P97501534 Dimethylaniline monooxyge no no 0.739 0.724 0.266 5e-28
P17635535 Dimethylaniline monooxyge no no 0.759 0.742 0.268 1e-27
P36366535 Dimethylaniline monooxyge no no 0.759 0.742 0.268 3e-27
Q9EQ76531 Dimethylaniline monooxyge no no 0.739 0.728 0.262 3e-26
Q6IRI9535 Dimethylaniline monooxyge no no 0.806 0.788 0.254 6e-26
Q8K4C0533 Dimethylaniline monooxyge no no 0.774 0.759 0.254 2e-25
P49109533 Dimethylaniline monooxyge no no 0.783 0.769 0.251 2e-25
P97872533 Dimethylaniline monooxyge no no 0.751 0.737 0.268 5e-25
>sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  321 bits (823), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 187/497 (37%), Positives = 279/497 (56%), Gaps = 24/497 (4%)

Query: 32  KIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVW-SQTIESTKLQTPKSFYQFSDF 90
           ++AIIGAGVSGL A K  + +   P VFEA   +GGVW S T E+TKLQ+ +  Y+FSDF
Sbjct: 12  RVAIIGAGVSGLAAAKNLVHHN--PTVFEASDSVGGVWRSCTYETTKLQSARVDYEFSDF 69

Query: 91  AWPNSVTET-FPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWG 149
            WPN+  +T FP + ++++YL++YA HF+L   +KF +KV  + R +   E     DL G
Sbjct: 70  PWPNNRDDTTFPPYLEILDYLESYAKHFDLLKFMKFGSKVIEV-RFIGDGETPQMVDL-G 127

Query: 150 GTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKGPEVFD 209
             G        W V VQ     S   + +  +FV++C G+Y D+P  P FP  KGPE+F 
Sbjct: 128 AYGNLLPGKPVWEVAVQIGD--SGDIQWHAFEFVVVCTGKYGDVPRIPAFPAKKGPEMFQ 185

Query: 210 GKVLHSMN-----DDLAAELINGKRVTVIGFQKSAVDVAAE--VANRNGVRYPCTLLFKT 262
           GKV+HSM+      + A+ L++GK+V VIGF+KSA+D+A E  +AN+      CT++ +T
Sbjct: 186 GKVMHSMDYCKLEKEEASTLLSGKKVAVIGFKKSAIDLALESALANQGEGGKACTMVVRT 245

Query: 263 VHWMVPDYFLWST----FRSLNRWTELIIHNPGEGFFSWLLALSLSPLLWLSSKVVESCL 318
            HW +P Y++W      F S +R ++ +   P + F   L  L  S L  + SK +ES +
Sbjct: 246 THWGIPHYWVWGLPFFLFYS-SRASQFLHDRPNQSFLRTLFCLLFSLLRAVVSKFIESYV 304

Query: 319 KWTFPLKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVID 378
            W  PL+KY + P HSF    +SC   ++P NF++    G +   KS  + F + G+V +
Sbjct: 305 LWKLPLEKYGLKPNHSFEEDYASCQMAIIPENFFEEADKGMIRFKKSSKWWFYEEGIVFE 364

Query: 379 GETTPLVTDIVIFATGYKSDEKLKNIFKSTYFQ-KQITGSSAPLYREGIHPQIPQLAILG 437
             TT L  D+VI ATGY   +KLK I    +    +      PLYR  IHP IP +  +G
Sbjct: 365 DGTT-LEADVVILATGYDGKKKLKAIVPEPFRTWLEFPSGVMPLYRGTIHPLIPNMGFVG 423

Query: 438 YADSPSILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSMRLYAGESYRRSCVSV 497
           Y  S S L T+E+RS  L+  +     LP+ ++M    +  E  +   +   Y+R C+S 
Sbjct: 424 YVQSSSNLHTSELRSMWLSRLVDEKFRLPSKEKMLDQFLK-EMEVTRNSSRFYKRHCIST 482

Query: 498 LLQKYSNDQLCKDMGCN 514
              ++++D +C DMG N
Sbjct: 483 FSIQHADD-MCNDMGLN 498
Required for the establishment of systemic acquired resistance (SAR). Not involved in local defense mechanisms. Confers a salicylic acid-dependent (SA) resistance to virulent pathogens such as P.syringae pv tomato and H.parasitica.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: -
>sp|Q9FKE7|FMO2_ARATH Putative flavin-containing monooxygenase 2 OS=Arabidopsis thaliana GN=FMO2 PE=3 SV=2 Back     alignment and function description
>sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 Back     alignment and function description
>sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 Back     alignment and function description
>sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 Back     alignment and function description
>sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 Back     alignment and function description
>sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 Back     alignment and function description
>sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 Back     alignment and function description
>sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query523
224086032518 predicted protein [Populus trichocarpa] 0.946 0.955 0.708 0.0
225457530515 PREDICTED: probable flavin-containing mo 0.933 0.947 0.667 0.0
297745542574 unnamed protein product [Vitis vinifera] 0.933 0.850 0.667 0.0
255539204517 dimethylaniline monooxygenase, putative 0.902 0.912 0.693 0.0
225428149517 PREDICTED: probable flavin-containing mo 0.933 0.943 0.569 1e-166
297744536 690 unnamed protein product [Vitis vinifera] 0.933 0.707 0.565 1e-164
225428155517 PREDICTED: probable flavin-containing mo 0.933 0.943 0.565 1e-164
225428153517 PREDICTED: probable flavin-containing mo 0.933 0.943 0.563 1e-164
225428147517 PREDICTED: probable flavin-containing mo 0.938 0.949 0.543 1e-160
255572700517 dimethylaniline monooxygenase, putative 0.940 0.951 0.547 1e-160
>gi|224086032|ref|XP_002307786.1| predicted protein [Populus trichocarpa] gi|222857235|gb|EEE94782.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/500 (70%), Positives = 413/500 (82%), Gaps = 5/500 (1%)

Query: 29  MERKIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWSQTIESTKLQTPKSFYQFS 88
           ME+KIAIIGAG+SGLLACK+ LE GF PIVFEARSGIGGVWSQTIESTKLQ PK  YQFS
Sbjct: 1   MEKKIAIIGAGISGLLACKHILEKGFSPIVFEARSGIGGVWSQTIESTKLQIPKKMYQFS 60

Query: 89  DFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLW 148
           DFAWP SVTETFPD  +VMEY++AYA HFN+ P I+F+ KVT ID +VP +ED  SWDLW
Sbjct: 61  DFAWPPSVTETFPDDEQVMEYIKAYAVHFNILPRIRFNCKVTCIDYVVPGNEDFPSWDLW 120

Query: 149 GGTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKGPEVF 208
           GGTG PFS +G+WNVTVQ+AR+ ++  E YQ+DFVILCIG+YSDLPN PDFP+N GPEVF
Sbjct: 121 GGTGWPFSPTGRWNVTVQDARDPTAPVEVYQLDFVILCIGKYSDLPNIPDFPLNSGPEVF 180

Query: 209 DGKVLHSMN-----DDLAAELINGKRVTVIGFQKSAVDVAAEVANRNGVRYPCTLLFKTV 263
           +GKVLHSM+     +D AAEL+  KRVT+IGFQKSAVD+A EVA+RNGV +PCTL+F+TV
Sbjct: 181 NGKVLHSMDYAAMANDCAAELVTNKRVTIIGFQKSAVDIATEVADRNGVDHPCTLIFRTV 240

Query: 264 HWMVPDYFLWSTFRSLNRWTELIIHNPGEGFFSWLLALSLSPLLWLSSKVVESCLKWTFP 323
           HW+VPDYF+  TF+SLNR+TE ++H P +GFF WLL + LSPLLW+ SK+VE+ LK   P
Sbjct: 241 HWIVPDYFIALTFKSLNRFTEFMVHKPDQGFFIWLLVILLSPLLWIFSKLVEAYLKRKQP 300

Query: 324 LKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVIDGETTP 383
           LKKYNM+P H FL QISSCMFTVLP NFYD+V+ G L L KS+SF FCKNGLVID E TP
Sbjct: 301 LKKYNMVPEHGFLKQISSCMFTVLPANFYDKVEEGSLVLKKSQSFNFCKNGLVIDSEETP 360

Query: 384 LVTDIVIFATGYKSDEKLKNIFKSTYFQKQITGSSAPLYREGIHPQIPQLAILGYADSPS 443
           + TDIVIFATGYKSDEKLKNIFKS+YFQK IT S AP YRE IHPQI QLAILGYADSP+
Sbjct: 361 IATDIVIFATGYKSDEKLKNIFKSSYFQKCITESLAPFYRECIHPQIAQLAILGYADSPA 420

Query: 444 ILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSMRLYAGESYRRSCVSVLLQKYS 503
            L TTEM+SK LAHFLAG   LPTI EME ++  WEK M+ YA ESY+RSC+SVLLQ Y 
Sbjct: 421 FLYTTEMKSKWLAHFLAGKFKLPTIGEMEADMKKWEKCMKYYANESYKRSCISVLLQIYC 480

Query: 504 NDQLCKDMGCNSKKEKMVFG 523
           NDQ+CKDMG N +++K +  
Sbjct: 481 NDQICKDMGFNPRRKKWLLA 500

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225457530|ref|XP_002272190.1| PREDICTED: probable flavin-containing monooxygenase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745542|emb|CBI40707.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255539204|ref|XP_002510667.1| dimethylaniline monooxygenase, putative [Ricinus communis] gi|223551368|gb|EEF52854.1| dimethylaniline monooxygenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225428149|ref|XP_002278617.1| PREDICTED: probable flavin-containing monooxygenase 1 [Vitis vinifera] gi|297744539|emb|CBI37801.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297744536|emb|CBI37798.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225428155|ref|XP_002278690.1| PREDICTED: probable flavin-containing monooxygenase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225428153|ref|XP_002278651.1| PREDICTED: probable flavin-containing monooxygenase 1 [Vitis vinifera] gi|297744537|emb|CBI37799.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225428147|ref|XP_002278596.1| PREDICTED: probable flavin-containing monooxygenase 1 [Vitis vinifera] gi|297744540|emb|CBI37802.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255572700|ref|XP_002527283.1| dimethylaniline monooxygenase, putative [Ricinus communis] gi|223533376|gb|EEF35127.1| dimethylaniline monooxygenase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query523
TAIR|locus:2202155530 FMO1 "AT1G19250" [Arabidopsis 0.904 0.892 0.366 2.8e-82
UNIPROTKB|Q5LPA2495 SPO2946 "Monooxygenase domain 0.642 0.678 0.259 1.7e-32
TIGR_CMR|SPO_2946495 SPO_2946 "monooxygenase domain 0.642 0.678 0.259 1.7e-32
UNIPROTKB|F1S246538 LOC100151788 "Dimethylaniline 0.359 0.349 0.373 1.1e-31
RGD|1595097538 LOC685351 "similar to flavin c 0.363 0.353 0.358 1.2e-27
UNIPROTKB|E2RFU7540 LOC478994 "Dimethylaniline mon 0.359 0.348 0.339 7.7e-26
UNIPROTKB|F1N007534 F1N007 "Dimethylaniline monoox 0.441 0.432 0.319 3e-25
MGI|MGI:1100496534 Fmo3 "flavin containing monoox 0.369 0.361 0.344 3.7e-25
UNIPROTKB|E1C6W6506 FMO4 "Dimethylaniline monooxyg 0.365 0.377 0.343 7.7e-25
RGD|1595083543 Fmo9 "flavin containing monoox 0.357 0.344 0.336 1.9e-24
TAIR|locus:2202155 FMO1 "AT1G19250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 825 (295.5 bits), Expect = 2.8e-82, P = 2.8e-82
 Identities = 182/497 (36%), Positives = 273/497 (54%)

Query:    32 KIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVW-SQTIESTKLQTPKSFYQFSDF 90
             ++AIIGAGVSGL A K  + +   P VFEA   +GGVW S T E+TKLQ+ +  Y+FSDF
Sbjct:    12 RVAIIGAGVSGLAAAKNLVHHN--PTVFEASDSVGGVWRSCTYETTKLQSARVDYEFSDF 69

Query:    91 AWPNSVTET-FPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWG 149
              WPN+  +T FP + ++++YL++YA HF+L   +KF +KV  + R +   E     DL G
Sbjct:    70 PWPNNRDDTTFPPYLEILDYLESYAKHFDLLKFMKFGSKVIEV-RFIGDGETPQMVDL-G 127

Query:   150 GTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKGPEVFD 209
               G        W V VQ   +      A++  FV++C G+Y D+P  P FP  KGPE+F 
Sbjct:   128 AYGNLLPGKPVWEVAVQIGDSGDIQWHAFE--FVVVCTGKYGDVPRIPAFPAKKGPEMFQ 185

Query:   210 GKVLHSMN-----DDLAAELINGKRVTVIGFQKSAVDVAAE--VANRNGVRYPCTLLFKT 262
             GKV+HSM+      + A+ L++GK+V VIGF+KSA+D+A E  +AN+      CT++ +T
Sbjct:   186 GKVMHSMDYCKLEKEEASTLLSGKKVAVIGFKKSAIDLALESALANQGEGGKACTMVVRT 245

Query:   263 VHWMVPDYFLWST----FRSLNRWTELIIHNPGEGFFXXXXXXXXXXXXXXXXKVVESCL 318
              HW +P Y++W      F S +R ++ +   P + F                 K +ES +
Sbjct:   246 THWGIPHYWVWGLPFFLFYS-SRASQFLHDRPNQSFLRTLFCLLFSLLRAVVSKFIESYV 304

Query:   319 KWTFPLKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVID 378
              W  PL+KY + P HSF    +SC   ++P NF++    G +   KS  + F + G+V +
Sbjct:   305 LWKLPLEKYGLKPNHSFEEDYASCQMAIIPENFFEEADKGMIRFKKSSKWWFYEEGIVFE 364

Query:   379 GETTPLVTDIVIFATGYKSDEKLKNIFKSTYFQ-KQITGSSAPLYREGIHPQIPQLAILG 437
               TT L  D+VI ATGY   +KLK I    +    +      PLYR  IHP IP +  +G
Sbjct:   365 DGTT-LEADVVILATGYDGKKKLKAIVPEPFRTWLEFPSGVMPLYRGTIHPLIPNMGFVG 423

Query:   438 YADSPSILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSMRLYAGESYRRSCVSV 497
             Y  S S L T+E+RS  L+  +     LP+ ++M    +  E  +   +   Y+R C+S 
Sbjct:   424 YVQSSSNLHTSELRSMWLSRLVDEKFRLPSKEKMLDQFLK-EMEVTRNSSRFYKRHCIST 482

Query:   498 LLQKYSNDQLCKDMGCN 514
                ++++D +C DMG N
Sbjct:   483 FSIQHADD-MCNDMGLN 498
GO:0004497 "monooxygenase activity" evidence=ISS
GO:0004499 "N,N-dimethylaniline monooxygenase activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0031227 "intrinsic to endoplasmic reticulum membrane" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009626 "plant-type hypersensitive response" evidence=IMP
GO:0009870 "defense response signaling pathway, resistance gene-dependent" evidence=IMP
GO:0051707 "response to other organism" evidence=IEP
GO:0010204 "defense response signaling pathway, resistance gene-independent" evidence=IMP
GO:0042742 "defense response to bacterium" evidence=IMP
GO:0050832 "defense response to fungus" evidence=IMP
GO:0009627 "systemic acquired resistance" evidence=IEP
GO:0071456 "cellular response to hypoxia" evidence=IEP
UNIPROTKB|Q5LPA2 SPO2946 "Monooxygenase domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2946 SPO_2946 "monooxygenase domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|F1S246 LOC100151788 "Dimethylaniline monooxygenase [N-oxide-forming]" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1595097 LOC685351 "similar to flavin containing monooxygenase 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFU7 LOC478994 "Dimethylaniline monooxygenase [N-oxide-forming]" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N007 F1N007 "Dimethylaniline monooxygenase [N-oxide-forming]" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1100496 Fmo3 "flavin containing monooxygenase 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6W6 FMO4 "Dimethylaniline monooxygenase [N-oxide-forming]" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1595083 Fmo9 "flavin containing monooxygenase 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LMA1FMO1_ARATH1, ., 1, 4, ., 1, 3, ., -0.37620.90430.8924yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.13LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.V.2067.1
hypothetical protein (510 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query523
pfam00743532 pfam00743, FMO-like, Flavin-binding monooxygenase- 1e-34
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 6e-28
pfam13738202 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulp 7e-16
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 1e-14
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 5e-06
pfam13454153 pfam13454, NAD_binding_9, FAD-NAD(P)-binding 1e-05
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 3e-05
TIGR04046400 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxido 3e-05
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 5e-05
PRK07233434 PRK07233, PRK07233, hypothetical protein; Provisio 6e-05
TIGR00292254 TIGR00292, TIGR00292, thiazole biosynthesis enzyme 1e-04
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 1e-04
pfam01946229 pfam01946, Thi4, Thi4 family 1e-04
PLN02612567 PLN02612, PLN02612, phytoene desaturase 1e-04
PLN02976 1713 PLN02976, PLN02976, amine oxidase 2e-04
PRK07208479 PRK07208, PRK07208, hypothetical protein; Provisio 2e-04
PRK12814652 PRK12814, PRK12814, putative NADPH-dependent gluta 2e-04
TIGR02731453 TIGR02731, phytoene_desat, phytoene desaturase 2e-04
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 5e-04
PRK13984604 PRK13984, PRK13984, putative oxidoreductase; Provi 7e-04
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 7e-04
COG3349485 COG3349, COG3349, Uncharacterized conserved protei 7e-04
COG1148622 COG1148, HdrA, Heterodisulfide reductase, subunit 0.002
PLN02576496 PLN02576, PLN02576, protoporphyrinogen oxidase 0.002
PRK098531019 PRK09853, PRK09853, putative selenate reductase su 0.003
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 0.003
PLN02487569 PLN02487, PLN02487, zeta-carotene desaturase 0.003
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 0.003
COG2907447 COG2907, COG2907, Predicted NAD/FAD-binding protei 0.003
PLN02529738 PLN02529, PLN02529, lysine-specific histone demeth 0.004
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information 
 Score =  136 bits (344), Expect = 1e-34
 Identities = 132/497 (26%), Positives = 202/497 (40%), Gaps = 110/497 (22%)

Query: 31  RKIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVW--SQTIE--------STKLQT 80
           +K+A+IGAGVSGL + K  LE G +P  FE    IGG+W  ++ +E        S    +
Sbjct: 2   KKVAVIGAGVSGLSSIKCCLEEGLEPTCFERSDDIGGLWRFTEHVEEGRASIYKSVVTNS 61

Query: 81  PKSFYQFSDFAWPNSVTETFPD---HNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVP 137
            K    FSDF +P    E +P+   ++K +EYL+ +A HF+L   I+F T V S+     
Sbjct: 62  SKEMSCFSDFPFP----EDYPNFMHNSKFLEYLRMFAKHFDLLKYIQFKTTVCSV----- 112

Query: 138 SDEDEHSWDLWGGTGKP-FSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNT 196
                        T +P FS+SG+W V  +      SA      D V++C G ++  P+ 
Sbjct: 113 -------------TKRPDFSTSGQWEVVTEHEGKQESAV----FDAVMVCTGHHT-NPHL 154

Query: 197 P--DFPMNKGPEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAE--------- 245
           P   FP   G   F G+  HS  D    E   GKRV VIG   S  D+A E         
Sbjct: 155 PLESFP---GINKFKGQYFHS-RDYKHPEGFQGKRVLVIGLGNSGGDIAVELSRTAAQVF 210

Query: 246 VANRNGVRYPCTLLFKTVHWMVPDYFLWSTFRSLNRWTELIIHNPGEGFFSWLLALSLSP 305
           ++ R G      +L +   W  P   L +T     R+   + +       +WL       
Sbjct: 211 LSTRTG----SWVLSRVSDWGYPWDMLLTT-----RFCSFLRNILPTRISNWL------- 254

Query: 306 LLWLSSKVVESCLKWTFPLKKYNMIPGHSFLNQISSCMFTV---LPRNFYDRVQGGGLSL 362
                   +E  L   F  + Y + P +  L +       V   LP    +R+  G +  
Sbjct: 255 --------MERQLNKRFNHENYGLSPKNGKLAK----EPIVNDELP----NRILCGAVK- 297

Query: 363 MKSRSFTFCKNGLVIDGETTPLVTDIVIFATGYKS-----DEKLKNIFKSTYFQKQITGS 417
           +K     F +   + +  T     D+VIFATGY       +E L  +  +          
Sbjct: 298 VKPSVKEFTETSAIFEDGTVEEDIDVVIFATGYTFSFPFLEESLVKVETNKIS------- 350

Query: 418 SAPLYREGIHPQI--PQLAILGYADS-PSILRTTEMRSKCLAHFLAGNSNLPTIKEMEHN 474
              LY+    P +  P LAI+G      SI+ T E++++       G   LP+  +M   
Sbjct: 351 ---LYKYVFPPNLEKPTLAIIGLIQPLGSIIPTVELQARWAVRVFKGLCKLPSSSKMMEE 407

Query: 475 VMNWEKSMRLYAGESYR 491
           +   ++      G S  
Sbjct: 408 ITEKKEKKIKRFGFSQS 424

This family includes FMO proteins, cyclohexanone mono-oxygenase and a number of different mono-oxygenases. Length = 532
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|222355 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|222141 pfam13454, NAD_binding_9, FAD-NAD(P)-binding Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|234447 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxidoreductase, MSMEG_0569 family Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|145231 pfam01946, Thi4, Thi4 family Back     alignment and domain information
>gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase Back     alignment and domain information
>gnl|CDD|215527 PLN02976, PLN02976, amine oxidase Back     alignment and domain information
>gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215314 PLN02576, PLN02576, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|225459 COG2907, COG2907, Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 523
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 100.0
PLN02172461 flavin-containing monooxygenase FMO GS-OX 100.0
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 100.0
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 100.0
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.97
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.97
PRK10262321 thioredoxin reductase; Provisional 99.96
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.95
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.95
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.95
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.95
PLN02507499 glutathione reductase 99.95
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.94
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.94
PRK06116450 glutathione reductase; Validated 99.94
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.94
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.94
PRK13512438 coenzyme A disulfide reductase; Provisional 99.94
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.94
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 99.94
PRK14694468 putative mercuric reductase; Provisional 99.94
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.94
PRK06370463 mercuric reductase; Validated 99.93
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.93
TIGR02053463 MerA mercuric reductase. This model represents the 99.93
PTZ00058561 glutathione reductase; Provisional 99.93
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.93
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.93
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.93
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.93
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.93
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.93
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.93
PRK14727479 putative mercuric reductase; Provisional 99.93
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.93
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.93
PRK13748561 putative mercuric reductase; Provisional 99.93
PTZ00052499 thioredoxin reductase; Provisional 99.93
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.93
PTZ00318424 NADH dehydrogenase-like protein; Provisional 99.92
PRK07846451 mycothione reductase; Reviewed 99.92
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.92
PLN02546558 glutathione reductase 99.92
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.92
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 99.92
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.92
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.92
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.92
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.92
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.91
PRK12831464 putative oxidoreductase; Provisional 99.91
PTZ00153 659 lipoamide dehydrogenase; Provisional 99.91
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.91
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.91
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.91
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.9
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 99.9
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.9
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 99.89
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.89
PRK12814652 putative NADPH-dependent glutamate synthase small 99.88
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.88
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.88
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.86
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.86
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.86
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.85
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.85
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.85
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.84
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.83
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.83
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 99.82
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 99.82
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.82
PRK13984604 putative oxidoreductase; Provisional 99.81
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.81
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.8
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.8
PLN02852491 ferredoxin-NADP+ reductase 99.79
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.79
PRK09897534 hypothetical protein; Provisional 99.75
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.72
PTZ00188506 adrenodoxin reductase; Provisional 99.61
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.6
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.59
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.58
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.56
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.51
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.42
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 99.4
COG2081408 Predicted flavoproteins [General function predicti 99.34
KOG2755334 consensus Oxidoreductase [General function predict 99.22
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.21
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.2
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.15
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.14
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.13
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.12
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.11
PRK06847375 hypothetical protein; Provisional 99.1
PRK06834488 hypothetical protein; Provisional 99.08
PRK08013400 oxidoreductase; Provisional 99.07
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.07
PRK09126392 hypothetical protein; Provisional 99.06
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.06
PLN02463447 lycopene beta cyclase 99.06
PRK10157428 putative oxidoreductase FixC; Provisional 99.06
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.06
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.05
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.04
PRK08244493 hypothetical protein; Provisional 99.03
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.02
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.02
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.0
PRK06753373 hypothetical protein; Provisional 99.0
PRK08163396 salicylate hydroxylase; Provisional 98.98
PRK06184502 hypothetical protein; Provisional 98.98
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.98
PRK10015429 oxidoreductase; Provisional 98.97
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.97
PRK07236386 hypothetical protein; Provisional 98.96
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.96
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.96
PRK07190487 hypothetical protein; Provisional 98.95
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.94
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.94
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.93
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.93
PRK07588391 hypothetical protein; Provisional 98.93
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.92
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.92
PRK06126545 hypothetical protein; Provisional 98.92
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.92
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.91
PLN02697529 lycopene epsilon cyclase 98.9
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.9
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.9
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.89
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.89
PRK06185407 hypothetical protein; Provisional 98.89
PRK07045388 putative monooxygenase; Reviewed 98.84
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.83
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.82
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.82
PRK11445351 putative oxidoreductase; Provisional 98.81
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.81
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.81
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.81
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.8
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.79
PRK06475400 salicylate hydroxylase; Provisional 98.79
PLN02661357 Putative thiazole synthesis 98.77
PRK07538413 hypothetical protein; Provisional 98.77
PRK05868372 hypothetical protein; Validated 98.77
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.76
PRK06996398 hypothetical protein; Provisional 98.75
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.74
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.74
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.73
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.72
PRK11728393 hydroxyglutarate oxidase; Provisional 98.7
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.7
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.67
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.66
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.64
PRK08274466 tricarballylate dehydrogenase; Validated 98.63
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.6
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.59
COG0579429 Predicted dehydrogenase [General function predicti 98.57
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.56
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.55
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.55
PRK08294634 phenol 2-monooxygenase; Provisional 98.54
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.53
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.53
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.52
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.5
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.5
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.5
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.49
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.49
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.49
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.49
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.49
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 98.47
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 98.47
PRK07121492 hypothetical protein; Validated 98.47
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.47
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 98.46
PRK06116450 glutathione reductase; Validated 98.45
PLN02985514 squalene monooxygenase 98.45
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.44
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 98.43
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.43
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.42
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 98.42
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.42
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.42
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.42
TIGR02053463 MerA mercuric reductase. This model represents the 98.42
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 98.42
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.4
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.4
PRK08401466 L-aspartate oxidase; Provisional 98.4
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.39
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 98.38
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.38
PRK08275554 putative oxidoreductase; Provisional 98.38
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.37
PRK06175433 L-aspartate oxidase; Provisional 98.37
PRK06370463 mercuric reductase; Validated 98.36
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.36
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.36
PRK07804541 L-aspartate oxidase; Provisional 98.35
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 98.35
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 98.35
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.35
PLN02507499 glutathione reductase 98.34
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.34
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.34
PRK07208479 hypothetical protein; Provisional 98.33
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.33
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.33
PRK07846451 mycothione reductase; Reviewed 98.33
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.32
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.32
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 98.32
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 98.31
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.31
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.31
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.3
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.3
PRK12842574 putative succinate dehydrogenase; Reviewed 98.29
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.29
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.28
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 98.28
PRK13512438 coenzyme A disulfide reductase; Provisional 98.28
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.27
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.27
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.27
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.26
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.26
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.26
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.25
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.25
PRK12839572 hypothetical protein; Provisional 98.25
PTZ00367567 squalene epoxidase; Provisional 98.25
PRK14727479 putative mercuric reductase; Provisional 98.25
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.24
PLN02815594 L-aspartate oxidase 98.24
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 98.23
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 98.22
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 98.21
PRK14694468 putative mercuric reductase; Provisional 98.21
PRK08071510 L-aspartate oxidase; Provisional 98.19
PLN02464627 glycerol-3-phosphate dehydrogenase 98.19
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.18
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.18
PRK13748561 putative mercuric reductase; Provisional 98.17
PTZ00058561 glutathione reductase; Provisional 98.17
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 98.16
PTZ00052499 thioredoxin reductase; Provisional 98.16
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.16
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.15
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.15
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.15
PRK05257494 malate:quinone oxidoreductase; Validated 98.14
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.13
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.13
COG2907447 Predicted NAD/FAD-binding protein [General functio 98.13
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 98.12
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.12
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.12
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.12
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.12
PRK07395553 L-aspartate oxidase; Provisional 98.1
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.09
PLN02546558 glutathione reductase 98.09
PRK09077536 L-aspartate oxidase; Provisional 98.08
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.08
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.07
KOG1298509 consensus Squalene monooxygenase [Lipid transport 98.06
PLN02268435 probable polyamine oxidase 98.06
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.06
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 98.05
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.04
PTZ00153659 lipoamide dehydrogenase; Provisional 98.02
PRK07233434 hypothetical protein; Provisional 98.02
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.01
PRK10262321 thioredoxin reductase; Provisional 98.01
COG3349485 Uncharacterized conserved protein [Function unknow 98.0
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.98
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.98
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.93
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.93
PLN02576496 protoporphyrinogen oxidase 97.93
PRK07512513 L-aspartate oxidase; Provisional 97.93
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 97.93
PLN02676487 polyamine oxidase 97.93
PLN02568539 polyamine oxidase 97.92
COG2081 408 Predicted flavoproteins [General function predicti 97.91
PLN02529738 lysine-specific histone demethylase 1 97.9
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.9
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 97.89
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.89
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.85
PRK12416463 protoporphyrinogen oxidase; Provisional 97.85
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.84
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 97.83
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.82
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.81
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.8
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.79
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.79
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 97.79
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.75
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.71
PRK13977576 myosin-cross-reactive antigen; Provisional 97.7
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.68
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.64
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.62
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.59
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.56
PLN02328808 lysine-specific histone demethylase 1 homolog 97.56
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.54
PLN02976 1713 amine oxidase 97.54
PLN02487569 zeta-carotene desaturase 97.53
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 97.51
PLN02612567 phytoene desaturase 97.5
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 97.44
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.43
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.42
PLN03000 881 amine oxidase 97.38
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.37
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 97.37
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.36
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.32
PRK12831464 putative oxidoreductase; Provisional 97.28
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.24
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.23
PLN02463 447 lycopene beta cyclase 97.21
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 97.18
PLN02852 491 ferredoxin-NADP+ reductase 97.18
KOG2852380 consensus Possible oxidoreductase [General functio 97.18
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 97.16
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.1
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.07
PRK06847375 hypothetical protein; Provisional 97.06
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 97.05
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 97.03
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.0
KOG2853509 consensus Possible oxidoreductase [General functio 96.96
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 96.95
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 96.91
PLN02172461 flavin-containing monooxygenase FMO GS-OX 96.89
PRK12814652 putative NADPH-dependent glutamate synthase small 96.88
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 96.84
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.84
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 96.8
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 96.8
PTZ00188 506 adrenodoxin reductase; Provisional 96.77
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.71
PRK02106560 choline dehydrogenase; Validated 96.69
COG3573552 Predicted oxidoreductase [General function predict 96.69
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.68
PRK12779944 putative bifunctional glutamate synthase subunit b 96.67
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 96.64
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 96.63
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 96.61
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 96.54
PLN02697 529 lycopene epsilon cyclase 96.52
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 96.5
PRK05868372 hypothetical protein; Validated 96.45
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 96.44
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.44
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 96.43
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 96.38
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 96.37
PRK07236386 hypothetical protein; Provisional 96.26
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 96.18
PRK07588391 hypothetical protein; Provisional 96.18
PLN02785587 Protein HOTHEAD 96.16
PRK09897 534 hypothetical protein; Provisional 96.14
PRK08163396 salicylate hydroxylase; Provisional 96.07
PRK13984604 putative oxidoreductase; Provisional 96.06
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 96.04
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 96.03
KOG3851 446 consensus Sulfide:quinone oxidoreductase/flavo-bin 96.01
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.96
PRK06753373 hypothetical protein; Provisional 95.95
PRK12771564 putative glutamate synthase (NADPH) small subunit; 95.95
PRK09126392 hypothetical protein; Provisional 95.95
COG2303542 BetA Choline dehydrogenase and related flavoprotei 95.92
KOG4716503 consensus Thioredoxin reductase [Posttranslational 95.78
PRK06834 488 hypothetical protein; Provisional 95.77
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 95.77
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 95.72
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 95.71
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 95.71
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 95.7
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 95.66
KOG2960328 consensus Protein involved in thiamine biosynthesi 95.65
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.62
PRK07045388 putative monooxygenase; Reviewed 95.55
KOG2755334 consensus Oxidoreductase [General function predict 95.54
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 95.53
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.52
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.51
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 95.49
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 95.44
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 95.43
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 95.41
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 95.25
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 95.24
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 95.24
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.23
PRK10157 428 putative oxidoreductase FixC; Provisional 95.18
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 95.16
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.13
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 95.13
PRK06567 1028 putative bifunctional glutamate synthase subunit b 95.08
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 95.07
KOG1800 468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 95.06
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 94.93
PRK06184 502 hypothetical protein; Provisional 94.9
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 94.86
TIGR00275 400 flavoprotein, HI0933 family. The model when search 94.85
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 94.83
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 94.82
PRK06475 400 salicylate hydroxylase; Provisional 94.74
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 94.69
PRK11445351 putative oxidoreductase; Provisional 94.66
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 94.61
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 94.61
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.59
PRK06718202 precorrin-2 dehydrogenase; Reviewed 94.59
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 94.51
PRK08013 400 oxidoreductase; Provisional 94.5
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 94.48
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 94.45
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 94.34
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 94.32
PRK07190 487 hypothetical protein; Provisional 94.31
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 94.28
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.24
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 94.19
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.13
PRK08401 466 L-aspartate oxidase; Provisional 94.11
PRK08244 493 hypothetical protein; Provisional 94.1
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.06
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 94.06
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 94.0
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 93.99
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 93.98
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 93.97
PRK05562223 precorrin-2 dehydrogenase; Provisional 93.9
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 93.87
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 93.86
PRK06719157 precorrin-2 dehydrogenase; Validated 93.84
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 93.68
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.54
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 93.51
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.51
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 93.48
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 93.44
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.43
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 93.41
PRK06996398 hypothetical protein; Provisional 93.39
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 93.3
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 93.27
KOG2614 420 consensus Kynurenine 3-monooxygenase and related f 93.26
PRK10015 429 oxidoreductase; Provisional 93.17
PRK06249313 2-dehydropantoate 2-reductase; Provisional 93.13
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 93.12
KOG03992142 consensus Glutamate synthase [Amino acid transport 93.12
KOG4405547 consensus GDP dissociation inhibitor [Signal trans 93.03
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 92.96
PRK07538 413 hypothetical protein; Provisional 92.95
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 92.76
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 92.72
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 92.66
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 92.66
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 92.65
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.58
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 92.43
PRK08229341 2-dehydropantoate 2-reductase; Provisional 92.39
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 92.31
PRK05708305 2-dehydropantoate 2-reductase; Provisional 92.14
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.06
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 92.03
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.03
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 91.94
PRK04148134 hypothetical protein; Provisional 91.92
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 91.89
KOG1238623 consensus Glucose dehydrogenase/choline dehydrogen 91.89
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.86
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 91.86
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.83
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 91.83
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information 
Probab=100.00  E-value=3.1e-71  Score=581.16  Aligned_cols=434  Identities=29%  Similarity=0.526  Sum_probs=263.3

Q ss_pred             CcEEEECCChHHHHHHHHHHHCCCceEEEccCCCCCccccc----------ccCcccccCCcCceeeCCCCCCCCCCCCC
Q 009897           31 RKIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWSQ----------TIESTKLQTPKSFYQFSDFAWPNSVTETF  100 (523)
Q Consensus        31 ~~v~IIGaG~aGl~aA~~l~~~g~~v~v~e~~~~~GG~w~~----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  100 (523)
                      |+|+|||||++||++|++|++.|+++++||+++++||+|++          .|+++++|+++++|.|+|+|+|++ .+.|
T Consensus         2 krVaVIGaG~sGL~a~k~l~e~g~~~~~fE~~~~iGG~W~~~~~~~~g~~~~y~sl~~n~sk~~~~fsdfp~p~~-~p~f   80 (531)
T PF00743_consen    2 KRVAVIGAGPSGLAAAKNLLEEGLEVTCFEKSDDIGGLWRYTENPEDGRSSVYDSLHTNTSKEMMAFSDFPFPED-YPDF   80 (531)
T ss_dssp             -EEEEE--SHHHHHHHHHHHHTT-EEEEEESSSSSSGGGCHSTTCCCSEGGGSTT-B-SS-GGGSCCTTS-HCCC-CSSS
T ss_pred             CEEEEECccHHHHHHHHHHHHCCCCCeEEecCCCCCccCeeCCcCCCCccccccceEEeeCchHhcCCCcCCCCC-CCCC
Confidence            78999999999999999999999999999999999999984          589999999999999999999976 5789


Q ss_pred             CChhHHHHHHHHHHHHhCCCCceEeccEEEEEEeCCCCCcccccccccCCCCCCCCCCCCeEEEEeecccCCcceeEEEe
Q 009897          101 PDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWGGTGKPFSSSGKWNVTVQEARNVSSATEAYQV  180 (523)
Q Consensus       101 ~~~~~~~~yl~~~~~~~~l~~~i~~~~~V~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~  180 (523)
                      ++++++.+||++||++|++.++|+||++|++|++..  |.               ...++|+|++++.    ++.++..|
T Consensus        81 ~~~~~v~~Yl~~Ya~~f~L~~~I~fnt~V~~v~~~~--d~---------------~~~~~W~V~~~~~----g~~~~~~f  139 (531)
T PF00743_consen   81 PSHSEVLEYLESYAEHFGLRKHIRFNTEVVSVERDP--DF---------------SATGKWEVTTEND----GKEETEEF  139 (531)
T ss_dssp             EBHHHHHHHHHHHHHHTTGGGGEETSEEEEEEEEET--TT---------------T-ETEEEEEETTT----TEEEEEEE
T ss_pred             CCHHHHHHHHHHHHhhhCCcceEEEccEEeEeeecc--cc---------------CCCceEEEEeecC----CeEEEEEe
Confidence            999999999999999999999999999999999864  10               1246899987543    23447789


Q ss_pred             CEEEEeeeecCCCCCCCC--CCCCCCCCCCCccEEecCCCCchhhhcCCCEEEEEcCCCCHHHHHHHHHHhcCCccCEEE
Q 009897          181 DFVILCIGRYSDLPNTPD--FPMNKGPEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAEVANRNGVRYPCTL  258 (523)
Q Consensus       181 d~vVlAtG~~s~~p~~p~--~p~~~g~~~~~g~~~h~~~~~~~~~~~~~k~V~VvG~G~sg~d~a~~l~~~~~~~~~Vt~  258 (523)
                      |+||+|||++ ..|++|.  +|   |++.|+|+++||.+|+++ +.++||+|+|||+|.||+|+|.+++..++   +|++
T Consensus       140 D~VvvatG~~-~~P~~P~~~~~---G~e~F~G~i~HS~~yr~~-~~f~gKrVlVVG~g~Sg~DIa~el~~~a~---~v~~  211 (531)
T PF00743_consen  140 DAVVVATGHF-SKPNIPEPSFP---GLEKFKGEIIHSKDYRDP-EPFKGKRVLVVGGGNSGADIAVELSRVAK---KVYL  211 (531)
T ss_dssp             CEEEEEE-SS-SCESB-----C---TGGGHCSEEEEGGG--TG-GGGTTSEEEEESSSHHHHHHHHHHTTTSC---CEEE
T ss_pred             CeEEEcCCCc-CCCCCChhhhh---hhhcCCeeEEccccCcCh-hhcCCCEEEEEeCCHhHHHHHHHHHHhcC---CeEE
Confidence            9999999999 6999995  88   999999999999999988 77999999999999999999999999865   4999


Q ss_pred             EEeeceeEecCccCCC---cchhhHHHHHHHhcCCCchhHHHHHhhhhchHHHHHHHHHHHHHHhcCCcccCCCCCCCcc
Q 009897          259 LFKTVHWMVPDYFLWS---TFRSLNRWTELIIHNPGEGFFSWLLALSLSPLLWLSSKVVESCLKWTFPLKKYNMIPGHSF  335 (523)
Q Consensus       259 ~~r~~~~~~p~~~~~~---~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~p~~~~  335 (523)
                      +.|++.|++|+....|   +....+|+..++....            .   .++.+...++.++..+....+++.|.+..
T Consensus       212 s~R~~~wv~pr~~~~G~P~D~~~~~R~~~~l~~~l------------p---~~~~~~~~~~~l~~~~~~~~~gl~p~~~~  276 (531)
T PF00743_consen  212 STRRGAWVLPRYWDNGYPFDMVFSTRFSSFLQKNL------------P---ESLSNWLLEKKLNKRFDHENYGLKPKHRF  276 (531)
T ss_dssp             ECC-----------------------------------------------------------------------------
T ss_pred             EEecccccccccccccccccccccccccccccccc------------c---ccccccccccccccccccccccccccccc
Confidence            9999999999875434   3334444433322110            0   11112223334444455566777777665


Q ss_pred             cccccCcceeecCcchhhhccCCCEEEEecCceEEecCcEEEcCCceeeeccEEEEecCCCCCccccccccchhhhhhhc
Q 009897          336 LNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVIDGETTPLVTDIVIFATGYKSDEKLKNIFKSTYFQKQIT  415 (523)
Q Consensus       336 ~~~~~~~~~~~~~~~~~~~~~~g~v~v~~~~i~~~~~~~v~l~dG~~~~~~D~VI~ATG~~~~~~l~~~~~~~~l~~~~~  415 (523)
                      .     +..+.+++++.+.+.+|+|+++ ..|.++++++|+|.||++..++|+||+||||+.++++++   ...+.  ..
T Consensus       277 ~-----~~~~~ind~l~~~i~~G~i~vk-~~I~~~~~~~v~F~DGs~~e~vD~II~~TGY~~~fpFL~---~~~~~--~~  345 (531)
T PF00743_consen  277 F-----SQHPTINDELPNRIRSGRIKVK-PDIKRFTENSVIFEDGSTEEDVDVIIFCTGYKFSFPFLD---ESLIK--VD  345 (531)
T ss_dssp             ---------------------------E-E-EEEE-SSEEEETTSEEEEE-SEEEE---EE---TTB----TTTT---S-
T ss_pred             c-----cccccccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccc---ccccc--cc
Confidence            3     4457789999999999999976 558999999999999998347999999999999887543   22111  11


Q ss_pred             CCCcccccccccCCC--CCeEEecccCCCC-chhhHHHHHHHHHHHHcCCCCCCCHHHHHHHHHHHHHHHHHhhCCCCCC
Q 009897          416 GSSAPLYREGIHPQI--PQLAILGYADSPS-ILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSMRLYAGESYRR  492 (523)
Q Consensus       416 ~~~~~ly~~~~~~~~--p~l~~iG~~~~~~-~~~~ae~Qa~~~a~~l~g~~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~  492 (523)
                      .+...||+++|+|++  |+|+|||++.+.+ .++++|+||||+|++|+|+.+||+.++|.+++.++.+++.+.... ..+
T Consensus       346 ~~~~~LYk~vfp~~~~~ptLafIG~~~~~g~~fp~~ElQArw~a~v~sG~~~LPs~~~M~~~i~~~~~~~~~~~~~-~~~  424 (531)
T PF00743_consen  346 DNRVRLYKHVFPPNLDHPTLAFIGLVQPFGSIFPIFELQARWAARVFSGRVKLPSKEEMMEEIEEEQEWRAKRFGF-SPR  424 (531)
T ss_dssp             SSSSSEETTTEETETTSTTEEESS-SBSSS-HHHHHHHHHHHHHHHHTTSS----HHHHHHHHHHHHHHHHT--SH-HHH
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc-ccc
Confidence            223489999999975  8999999987653 578999999999999999999999999999999887776544321 233


Q ss_pred             CceeeecccchHHHHHhHcCCCCCcccccc
Q 009897          493 SCVSVLLQKYSNDQLCKDMGCNSKKEKMVF  522 (523)
Q Consensus       493 ~~~~~~~~~~y~d~L~~d~g~~~~~~~~~~  522 (523)
                      ++...+ +..|+|+|++++|+.|+.++.|+
T Consensus       425 ~~~~~d-~~~y~deLA~~iG~~P~~~~l~~  453 (531)
T PF00743_consen  425 HTIQVD-YIDYMDELAREIGCKPNFWKLFL  453 (531)
T ss_dssp             HHHHHH-HHHHHHTTS--------------
T ss_pred             cccccc-ccccccccccccccccccccccc
Confidence            555555 89999999999999999887665

Using an NADPH cofactor and FAD prosthetic group, these microsomal proteins catalyse the oxygenation of nucleophilic nitrogen, sulphur, phosphorous and selenium atoms in a range of structurally diverse compounds. FMOs have been implicated in the metabolism of a number of pharmaceuticals, pesticides and toxicants. In man, lack of hepatic FMO-catalysed trimethylamine metabolism results in trimethylaminuria (fish odour syndrome). Five mammalian forms of FMO are now known and have been designated FMO1-FMO5 [, , , , ]. This is a recent nomenclature based on comparison of amino acid sequences, and has been introduced in an attempt to eliminate confusion inherent in multiple, laboratory-specific designations and tissue-based classifications []. Following the determination of the complete nucleotide sequence of Saccharomyces cerevisiae (Baker's yeast) [], a novel gene was found to encode a protein with similarity to mammalian monooygenases.; GO: 0004499 flavin-containing monooxygenase activity, 0050660 flavin adenine dinucleotide binding, 0050661 NADP binding, 0055114 oxidation-reduction process; PDB: 2GVC_E 1VQW_B 2GV8_B 2XVI_B 2XVH_B 2XLS_A 2XLR_A 2XLU_D 2XLP_B 2XVE_A ....
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query523
4ap1_A549 Oxidized Steroid Monooxygenase Bound To Nadp Length 5e-10
4ap3_A549 Oxidized Steroid Monooxygenase Bound To Nadp Length 6e-10
4aos_A549 Oxidized Steroid Monooxygenase Bound To Nadp Length 6e-10
2ylx_A542 Snapshots Of Enzymatic Baeyer-Villiger Catalysis: O 8e-09
1w4x_A542 Phenylacetone Monooxygenase, A Baeyer-villiger Mono 9e-09
2ylw_A542 Snapshots Of Enzymatic Baeyer-Villiger Catalysis: O 9e-09
2ylz_A542 Snapshots Of Enzymatic Baeyer-Villiger Catalysis: O 9e-09
3ucl_A573 Cyclohexanone-Bound Crystal Structure Of Cyclohexan 5e-08
3gwd_A540 Closed Crystal Structure Of Cyclohexanone Monooxyge 5e-08
2xvi_A464 Crystal Structure Of The Mutant Bacterial Flavin Co 6e-08
2xve_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 9e-08
2xlp_A461 Joint-Functions Of Protein Residues And Nadp(H) In 1e-07
2xls_A461 Joint-Functions Of Protein Residues And Nadp(H) In 1e-07
2vq7_A461 Bacterial Flavin-Containing Monooxygenase In Comple 1e-07
2xlr_A461 Joint-Functions Of Protein Residues And Nadp(H) In 1e-07
2gv8_A447 Crystal Structure Of Flavin-Containing Monooxygenas 1e-07
1vqw_A457 Crystal Structure Of A Protein With Similarity To F 2e-07
2xvf_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 2e-07
4a9w_A357 Flavin-Containing Monooxygenase From Stenotrophomon 4e-06
2yg6_A453 Structure-Based Redesign Of Cofactor Binding In Put 2e-05
2yg5_A453 Structure-Based Redesign Of Cofactor Binding In Put 7e-05
2yg3_A453 Structure-Based Redesign Of Cofactor Binding In Put 7e-05
2yg7_A453 Structure-Based Redesign Of Cofactor Binding In Put 7e-05
3uov_A545 Crystal Structure Of Otemo (Fad Bound Form 1) Lengt 3e-04
3rha_A482 The Crystal Structure Of Oxidoreductase From Arthro 6e-04
>pdb|4AP1|A Chain A, Oxidized Steroid Monooxygenase Bound To Nadp Length = 549 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 90/216 (41%), Gaps = 43/216 (19%)
Query: 33  IAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVW---SQTIESTKLQTPKSFYQFS- 88
           + ++GAG++GL A       G     FEA SG+GGVW           +++    Y FS 
Sbjct: 24  VVVVGAGIAGLYAIHRFRSQGLTVRAFEAASGVGGVWYWNRYPGARCDVESIDYSYSFSP 83
Query: 89  ----DFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHS 144
               ++ W    +E +    +++ YL+  A  F+L   I+FDT+VTS      +  DE  
Sbjct: 84  ELEQEWNW----SEKYATQPEILAYLEHVADRFDLRRDIRFDTRVTS------AVLDEEG 133
Query: 145 WDLWGGTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKG 204
                          +W V       VS+        F+++  G  S+  NTP F    G
Sbjct: 134 L--------------RWTVRTDRGDEVSAR-------FLVVAAGPLSNA-NTPAF---DG 168
Query: 205 PEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAV 240
            + F G ++H+           GKRV VIG   S +
Sbjct: 169 LDRFTGDIVHTARWPHDGVDFTGKRVGVIGTGSSGI 204
>pdb|4AP3|A Chain A, Oxidized Steroid Monooxygenase Bound To Nadp Length = 549 Back     alignment and structure
>pdb|4AOS|A Chain A, Oxidized Steroid Monooxygenase Bound To Nadp Length = 549 Back     alignment and structure
>pdb|2YLX|A Chain A, Snapshots Of Enzymatic Baeyer-Villiger Catalysis: Oxygen Activation And Intermediate Stabilization: Asp66ala Mutant In Complex With Nadp And Mes Length = 542 Back     alignment and structure
>pdb|1W4X|A Chain A, Phenylacetone Monooxygenase, A Baeyer-villiger Monooxygenase Length = 542 Back     alignment and structure
>pdb|2YLW|A Chain A, Snapshots Of Enzymatic Baeyer-Villiger Catalysis: Oxygen Activation And Intermediate Stabilization: Arg337lys Mutant In Complex With Mes Length = 542 Back     alignment and structure
>pdb|2YLZ|A Chain A, Snapshots Of Enzymatic Baeyer-Villiger Catalysis: Oxygen Activation And Intermediate Stabilization: Met446gly Mutant Length = 542 Back     alignment and structure
>pdb|3UCL|A Chain A, Cyclohexanone-Bound Crystal Structure Of Cyclohexanone Monooxygenase In The Rotated Conformation Length = 573 Back     alignment and structure
>pdb|3GWD|A Chain A, Closed Crystal Structure Of Cyclohexanone Monooxygenase Length = 540 Back     alignment and structure
>pdb|2XVI|A Chain A, Crystal Structure Of The Mutant Bacterial Flavin Containing Monooxygenase (Y207s) Length = 464 Back     alignment and structure
>pdb|2XVE|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure
>pdb|2XLP|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen- Activation By Flavin-Containing Monooxygenase: Asn78ser Mutant Length = 461 Back     alignment and structure
>pdb|2XLS|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78lys Mutant Length = 461 Back     alignment and structure
>pdb|2VQ7|A Chain A, Bacterial Flavin-Containing Monooxygenase In Complex With Nadp: Native Data Length = 461 Back     alignment and structure
>pdb|2XLR|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78asp Mutant Length = 461 Back     alignment and structure
>pdb|2GV8|A Chain A, Crystal Structure Of Flavin-Containing Monooxygenase (Fmo) From S.Pombe And Nadph Cofactor Complex Length = 447 Back     alignment and structure
>pdb|1VQW|A Chain A, Crystal Structure Of A Protein With Similarity To Flavin- Containing Monooxygenases And To Mammalian Dimethylalanine Monooxygenases Length = 457 Back     alignment and structure
>pdb|2XVF|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure
>pdb|4A9W|A Chain A, Flavin-Containing Monooxygenase From Stenotrophomonas Maltophilia Length = 357 Back     alignment and structure
>pdb|2YG6|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: P15i-A394c Double Mutant Length = 453 Back     alignment and structure
>pdb|2YG5|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c Mutant Length = 453 Back     alignment and structure
>pdb|2YG3|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: Wild Type Enzyme Length = 453 Back     alignment and structure
>pdb|2YG7|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c-A396t-Q431g Triple Mutant Length = 453 Back     alignment and structure
>pdb|3UOV|A Chain A, Crystal Structure Of Otemo (Fad Bound Form 1) Length = 545 Back     alignment and structure
>pdb|3RHA|A Chain A, The Crystal Structure Of Oxidoreductase From Arthrobacter Aurescens Length = 482 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query523
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 3e-45
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 2e-38
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 6e-07
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 9e-37
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 1e-09
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 5e-25
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 1e-24
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 1e-24
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 2e-24
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 4e-24
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 1e-23
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 1e-09
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 1e-08
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 2e-08
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 3e-08
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 1e-07
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 3e-07
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 5e-07
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 1e-06
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 1e-06
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 2e-06
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 2e-06
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 2e-06
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 2e-06
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 4e-06
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 5e-06
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 5e-06
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 6e-06
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 9e-06
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 1e-05
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 2e-05
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 3e-05
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 5e-05
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 5e-05
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 5e-04
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 6e-05
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 6e-05
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 1e-04
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 2e-04
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 3e-04
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 4e-04
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 5e-04
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 6e-04
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 6e-04
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 6e-04
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 7e-04
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 7e-04
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
 Score =  161 bits (409), Expect = 3e-45
 Identities = 57/282 (20%), Positives = 96/282 (34%), Gaps = 43/282 (15%)

Query: 29  MERK-IAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWSQTIESTKLQTPKSFYQF 87
           M+   + +IG G SGL A  +   +G   ++ +A +  GG W     S  L +P  +   
Sbjct: 1   MDSVDVVVIGGGQSGLSAGYFLRRSGLSYVILDAEASPGGAWQHAWHSLHLFSPAGWSSI 60

Query: 88  SDFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDL 147
             +  P S    +P   +V+ YL  Y   + L   +    +V  +              +
Sbjct: 61  PGWPMPAS-QGPYPARAEVLAYLAQYEQKYAL--PVLRPIRVQRVSH------FGERLRV 111

Query: 148 WGGTGKPFSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKGPEV 207
                                  V+     +    VI   G + +   TP++    G E 
Sbjct: 112 -----------------------VARDGRQWLARAVISATGTWGE-AYTPEYQ---GLES 144

Query: 208 FDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVAAEVANRNGVRYPCTLLFKTVHWMV 267
           F G  LHS +    A    G RV +IG   S   + AEV+    V     +      ++ 
Sbjct: 145 FAGIQLHSAHYSTPAPF-AGMRVAIIGGGNSGAQILAEVST---VAETTWITQHEPAFLA 200

Query: 268 PDYFLWSTF-RSLNRWT-ELIIHNPGEGFFSWLLALSLSPLL 307
            D      F R+  RW  +     P      +   + + P+L
Sbjct: 201 DDVDGRVLFERATERWKAQQEGREPDLPPGGFGDIVMVPPVL 242
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query523
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 100.0
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 100.0
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 100.0
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 100.0
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 100.0
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 100.0
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 100.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 100.0
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.98
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.98
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.97
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.97
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.97
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.97
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.97
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.97
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.96
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.96
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.96
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.96
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.96
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.96
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.96
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.95
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.95
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.95
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.95
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.95
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.95
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.95
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.95
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.95
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.95
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.95
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.95
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.95
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.95
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.95
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.95
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.94
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.94
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 99.94
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.94
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.94
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.94
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.94
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.94
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.94
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.94
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.94
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.94
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.94
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.94
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.93
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.93
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.93
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.93
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.93
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.93
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.93
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.93
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.93
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.93
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.93
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.93
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.93
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.93
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.93
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.93
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.93
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.93
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.92
4dna_A463 Probable glutathione reductase; structural genomic 99.92
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.92
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.92
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.91
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.91
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.91
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.91
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.9
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 99.9
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.9
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.9
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.89
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.89
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.88
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.87
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.84
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.82
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 99.82
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.8
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.39
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.24
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.24
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.2
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.19
2cul_A232 Glucose-inhibited division protein A-related PROT 99.18
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.18
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.16
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.15
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 99.14
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.14
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.14
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.14
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.13
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.12
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.12
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.11
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.11
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.11
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.09
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.08
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.08
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.07
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.07
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.05
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.05
2bry_A497 NEDD9 interacting protein with calponin homology a 99.04
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.03
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 99.01
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.01
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.01
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.01
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 99.0
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.98
3dme_A369 Conserved exported protein; structural genomics, P 98.96
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.96
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.95
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.95
3atr_A453 Conserved archaeal protein; saturating double bond 98.94
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.92
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.92
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.92
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.91
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.9
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.86
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.85
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.83
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.82
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.79
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.79
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.77
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.77
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.75
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.75
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.74
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.72
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.72
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.67
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.67
2cul_A232 Glucose-inhibited division protein A-related PROT 98.66
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.65
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.65
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.63
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.63
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.63
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.62
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 98.6
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.6
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.59
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.59
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.59
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.58
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.58
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.56
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.55
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.54
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.54
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.53
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.53
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.52
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.52
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.5
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.5
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.49
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.48
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.47
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.47
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.46
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.46
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.45
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.43
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.42
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.4
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.39
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.39
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.39
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.38
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.38
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.38
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.37
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.37
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.37
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.37
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.37
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.36
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.35
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.34
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.34
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.33
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.33
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.33
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.32
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.31
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.31
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.3
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.3
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.28
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.28
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.26
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.26
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.25
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.24
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.24
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.23
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.23
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.22
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.21
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.21
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.2
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.19
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.19
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.17
4dna_A463 Probable glutathione reductase; structural genomic 98.17
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.16
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.15
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.15
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 98.14
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.12
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.11
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 98.1
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 98.09
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.08
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.07
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.07
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.06
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 98.06
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.05
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.03
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.02
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.97
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.96
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.96
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.95
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.94
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.93
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.93
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 97.92
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.9
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.9
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.9
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.89
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.88
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.88
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.85
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.84
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.83
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.83
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.82
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.81
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.8
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.76
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.75
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 97.73
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.73
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.71
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.71
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.69
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.68
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.66
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.66
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 97.63
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.62
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.61
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.5
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.5
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.5
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.45
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.41
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.35
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.31
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.3
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.22
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.2
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.19
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.15
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.13
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.07
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.05
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.0
2bry_A 497 NEDD9 interacting protein with calponin homology a 96.99
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 96.91
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.87
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 96.81
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.75
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 96.72
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.69
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 96.64
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.58
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 96.58
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 96.53
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.5
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 96.49
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 96.48
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 96.37
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.29
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.29
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.26
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.25
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 96.24
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.18
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.17
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 96.16
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.09
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.09
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 96.07
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 96.03
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 96.02
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 95.98
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 95.88
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 95.83
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 95.8
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 95.79
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.68
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.68
4hb9_A 412 Similarities with probable monooxygenase; flavin, 95.68
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.59
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 95.58
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 95.53
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 95.51
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 95.46
3atr_A 453 Conserved archaeal protein; saturating double bond 95.38
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.35
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.34
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.07
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 94.99
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 94.8
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 94.69
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.68
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 94.63
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 94.52
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 94.42
3c85_A183 Putative glutathione-regulated potassium-efflux S 94.29
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 94.29
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.17
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 94.14
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 94.1
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 94.07
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 93.92
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 93.92
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 93.8
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 93.79
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 93.48
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 93.47
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 93.43
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.38
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 93.33
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 93.23
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 93.2
3ius_A286 Uncharacterized conserved protein; APC63810, silic 93.11
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 92.9
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 92.85
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 92.81
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 92.79
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 92.59
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 92.57
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 92.48
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.4
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 92.35
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 92.32
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 92.31
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 92.27
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 92.17
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 92.16
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 92.12
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 92.11
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 92.1
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 92.09
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 92.06
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 92.06
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 92.03
3qha_A296 Putative oxidoreductase; seattle structural genomi 91.98
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 91.95
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 91.91
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 91.9
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 91.9
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 91.89
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 91.7
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 91.63
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 91.62
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 91.6
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 91.55
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 91.53
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 91.5
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 91.38
4ezb_A317 Uncharacterized conserved protein; structural geno 91.32
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 91.28
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 91.26
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 91.13
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 91.08
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 91.06
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 91.03
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 90.99
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 90.97
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 90.9
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 90.85
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 90.84
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 90.81
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 90.79
3l6d_A306 Putative oxidoreductase; structural genomics, prot 90.77
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 90.75
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 90.72
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 90.69
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 90.67
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 90.62
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 90.59
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 90.53
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 90.49
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 90.34
1vpd_A299 Tartronate semialdehyde reductase; structural geno 90.33
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 90.2
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 90.17
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 90.14
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 90.03
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 90.01
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 90.0
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 89.92
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 89.91
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 89.87
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 89.84
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 89.82
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 89.82
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 89.76
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 89.7
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 89.62
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 89.56
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 89.47
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 89.43
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 89.43
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 89.4
3slg_A372 PBGP3 protein; structural genomics, seattle struct 89.37
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 89.29
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 89.27
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 89.22
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 89.2
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 89.2
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 89.18
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 89.15
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 89.08
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 89.08
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 88.98
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 88.89
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 88.84
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 88.79
2rir_A300 Dipicolinate synthase, A chain; structural genomic 88.77
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 88.73
3tl2_A315 Malate dehydrogenase; center for structural genomi 88.69
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 88.67
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 88.64
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 88.64
3ouz_A446 Biotin carboxylase; structural genomics, center fo 88.63
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 88.61
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 88.57
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 88.56
4g65_A461 TRK system potassium uptake protein TRKA; structur 88.46
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 88.34
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 88.34
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 88.18
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 88.16
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 88.11
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 88.08
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 88.06
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 88.04
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 87.99
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 87.91
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 87.88
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 87.87
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 87.86
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 87.82
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 87.82
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 87.76
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 87.74
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 87.71
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 87.65
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 87.65
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 87.62
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 87.55
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 87.53
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 87.51
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 87.5
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 87.49
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 87.47
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 87.46
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 87.43
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 87.42
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 87.26
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 87.24
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 87.23
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-49  Score=417.10  Aligned_cols=365  Identities=20%  Similarity=0.288  Sum_probs=289.5

Q ss_pred             CCCcEEEECCChHHHHHHHHHHH---CCCc---eEEEccCCCCCccccc----------------ccCcccccCCcCcee
Q 009897           29 MERKIAIIGAGVSGLLACKYTLE---NGFK---PIVFEARSGIGGVWSQ----------------TIESTKLQTPKSFYQ   86 (523)
Q Consensus        29 ~~~~v~IIGaG~aGl~aA~~l~~---~g~~---v~v~e~~~~~GG~w~~----------------~~~~~~~~~~~~~~~   86 (523)
                      |.+||+|||||++|+++|+.|++   .|++   |+|||+++.+||+|.+                .|+.++.+.++..+.
T Consensus         1 M~~~V~IIGaG~aGl~aA~~L~~~~~~G~~~~~V~v~E~~~~~GG~w~~~~~~g~~~~g~~~~~~~y~~l~~~~~~~~~~   80 (464)
T 2xve_A            1 MATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLE   80 (464)
T ss_dssp             --CEEEEECCSHHHHHHHHHHHHHHHTTCCCCEEEEECSSSSSCGGGSCCSCCSBCTTSSBCCCCCCTTCBCSSCGGGTC
T ss_pred             CCCcEEEECccHHHHHHHHHHHhhhhcCCCCCcEEEEEcCCCCCCEeecCCCCCccccCCCCcCccccchhhcCChhhcc
Confidence            45799999999999999999999   9999   9999999999999985                356677888888899


Q ss_pred             eCCCCCCCC---CCCCCCChhHHHHHHHHHHHHhCCCCceEeccEEEEEEeCCCCCcccccccccCCCCCCCCCCCCeEE
Q 009897           87 FSDFAWPNS---VTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWGGTGKPFSSSGKWNV  163 (523)
Q Consensus        87 ~~~~~~~~~---~~~~~~~~~~~~~yl~~~~~~~~l~~~i~~~~~V~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v  163 (523)
                      |++++++..   +...++++.++.+|++++++++++...++++++|+++++..                    ..+.|.|
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~gv~~~i~~~~~V~~v~~~~--------------------~~~~~~V  140 (464)
T 2xve_A           81 FADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNE--------------------DSQTFTV  140 (464)
T ss_dssp             BTTBCHHHHHSSCCCSSCBHHHHHHHHHHHHHHHTCGGGEECSEEEEEEEEET--------------------TTTEEEE
T ss_pred             cCCCCCCcccCCCCCCCCCHHHHHHHHHHHHHHcCCcceEEeCCEEEEEEEcC--------------------CCCcEEE
Confidence            998887531   13678899999999999999999855599999999999865                    1247999


Q ss_pred             EEeecccCCcceeEEEeCEEEEeeeecCCCCCCCCCCCCCCCCCCCccEEecCCCCchhhhcCCCEEEEEcCCCCHHHHH
Q 009897          164 TVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFPMNKGPEVFDGKVLHSMNDDLAAELINGKRVTVIGFQKSAVDVA  243 (523)
Q Consensus       164 ~~~~~~~~~~~~~~~~~d~vVlAtG~~s~~p~~p~~p~~~g~~~~~g~~~h~~~~~~~~~~~~~k~V~VvG~G~sg~d~a  243 (523)
                      ++.++.  +++..++.||+||+|||++ +.|++|++|   |++.|.|.++|+.++.+. ..+.+|+|+|||+|.||+|+|
T Consensus       141 ~~~~~~--~g~~~~~~~d~VVvAtG~~-s~p~~p~ip---G~~~~~g~~~hs~~~~~~-~~~~~k~VvVVG~G~sg~eiA  213 (464)
T 2xve_A          141 TVQDHT--TDTIYSEEFDYVVCCTGHF-STPYVPEFE---GFEKFGGRILHAHDFRDA-LEFKDKTVLLVGSSYSAEDIG  213 (464)
T ss_dssp             EEEETT--TTEEEEEEESEEEECCCSS-SSBCCCCCB---TTTTCCSEEEEGGGCCCG-GGGTTSEEEEECCSTTHHHHH
T ss_pred             EEEEcC--CCceEEEEcCEEEECCCCC-CCCccCCCC---CcccCCceEEehhhhCCH-hHcCCCEEEEEcCCCCHHHHH
Confidence            987642  1223478999999999998 589999999   998899999999999876 457899999999999999999


Q ss_pred             HHHHHhcCCccCEEEEEeeceeEecCccCCCcchhhHHHHHHHhcCCCchhHHHHHhhhhchHHHHHHHHHHHHHHhcCC
Q 009897          244 AEVANRNGVRYPCTLLFKTVHWMVPDYFLWSTFRSLNRWTELIIHNPGEGFFSWLLALSLSPLLWLSSKVVESCLKWTFP  323 (523)
Q Consensus       244 ~~l~~~~~~~~~Vt~~~r~~~~~~p~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  323 (523)
                      .+|++.+.+   |+++.|++.. ++..                                                     
T Consensus       214 ~~l~~~g~~---V~li~~~~~~-~~~~-----------------------------------------------------  236 (464)
T 2xve_A          214 SQCYKYGAK---KLISCYRTAP-MGYK-----------------------------------------------------  236 (464)
T ss_dssp             HHHHHTTCS---EEEEECSSCC-CCCC-----------------------------------------------------
T ss_pred             HHHHHhCCe---EEEEEECCCC-CCCC-----------------------------------------------------
Confidence            999998754   9999987541 0000                                                     


Q ss_pred             cccCCCCCCCcccccccCcceeecCcchhhhccCCCEEEEecCceEEecCcEEEcCCceeeeccEEEEecCCCCCccccc
Q 009897          324 LKKYNMIPGHSFLNQISSCMFTVLPRNFYDRVQGGGLSLMKSRSFTFCKNGLVIDGETTPLVTDIVIFATGYKSDEKLKN  403 (523)
Q Consensus       324 ~~~~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~g~v~v~~~~i~~~~~~~v~l~dG~~~~~~D~VI~ATG~~~~~~l~~  403 (523)
                                             +         ..+|+++ ..|+++++++|+++||++ +++|.||+||||++++++++
T Consensus       237 -----------------------~---------~~~V~~~-~~V~~i~~~~V~~~dG~~-i~~D~Vi~atG~~p~~~~l~  282 (464)
T 2xve_A          237 -----------------------W---------PENWDER-PNLVRVDTENAYFADGSS-EKVDAIILCTGYIHHFPFLN  282 (464)
T ss_dssp             -----------------------C---------CTTEEEC-SCEEEECSSEEEETTSCE-EECSEEEECCCBCCCCTTBC
T ss_pred             -----------------------C---------CCceEEc-CCeEEEeCCEEEECCCCE-EeCCEEEECCCCCCCCCCcC
Confidence                                   0         1346665 567888888999999998 99999999999999987644


Q ss_pred             c-ccchhhhhhhcCCCcccccccccCCCCCeEEecccCCCCchhhHHHHHHHHHHHHcCCCCCCCHHHHHHHHHHHHHHH
Q 009897          404 I-FKSTYFQKQITGSSAPLYREGIHPQIPQLAILGYADSPSILRTTEMRSKCLAHFLAGNSNLPTIKEMEHNVMNWEKSM  482 (523)
Q Consensus       404 ~-~~~~~l~~~~~~~~~~ly~~~~~~~~p~l~~iG~~~~~~~~~~ae~Qa~~~a~~l~g~~~lp~~~~~~~~~~~~~~~~  482 (523)
                      . ++.. .++.  +...++|+++++++.|||||+|.+.....++.++.||+|+|++|.|+.+||+.++|.++++++.+. 
T Consensus       283 ~~~gl~-~~~~--~~v~~~~~~~~~t~~p~i~aiGd~~~~~~~~~a~~qa~~~a~~l~G~~~lP~~~~m~~~~~~~~~~-  358 (464)
T 2xve_A          283 DDLRLV-TNNR--LWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREK-  358 (464)
T ss_dssp             TTTCCC-CCSS--SCCSSEETTTEESSSTTEEECSCSCCSSCHHHHHHHHHHHHHHHTTSSCCCCHHHHHHHHHHHHHH-
T ss_pred             cccccc-cCCC--cccccccceEecCCCCCEEEEeCcccccchHHHHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHHHH-
Confidence            2 1111 1110  011268999999999999999998777778999999999999999999999999999998887652 


Q ss_pred             HHhhCCCCCCCceeeecccchHHHHHhHcCCCCCccc
Q 009897          483 RLYAGESYRRSCVSVLLQKYSNDQLCKDMGCNSKKEK  519 (523)
Q Consensus       483 ~~~~~~~~~~~~~~~~~~~~y~d~L~~d~g~~~~~~~  519 (523)
                      .+.... ..++..  + +..|+|+|++++|+++.++.
T Consensus       359 ~~~~~~-~~~~~~--~-~~~Y~~~l~~~~g~~~~~~~  391 (464)
T 2xve_A          359 ELTLVT-AEEMYT--Y-QGDYIQNLIDMTDYPSFDIP  391 (464)
T ss_dssp             HHTCCS-HHHHHH--H-HHHHHHHHHTTSSSCCCCHH
T ss_pred             hhccCC-CCCccc--c-HHHHHHHHHHHcCCCCCChH
Confidence            221100 011111  1 46799999999999987653
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 523
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 2e-17
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 2e-15
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 4e-04
d1w4xa2235 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {T 5e-15
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 2e-08
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 9e-08
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 2e-07
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 3e-07
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 4e-07
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 7e-07
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 8e-07
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 2e-06
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 3e-06
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 6e-06
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 6e-06
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 9e-06
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 4e-05
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 9e-05
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 1e-04
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 1e-04
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 2e-04
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 2e-04
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 2e-04
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 2e-04
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 4e-04
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 6e-04
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 7e-04
d2gv8a2107 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase 9e-04
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 0.001
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 0.001
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 0.002
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 0.002
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 0.002
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Phenylacetone monooxygenase
species: Thermobifida fusca [TaxId: 2021]

 Score = 81.0 bits (199), Expect = 2e-17
 Identities = 34/155 (21%), Positives = 57/155 (36%), Gaps = 8/155 (5%)

Query: 32  KIAIIGAGVSGLLACKYTLENGFKPIVFEARSGIGGVWS-QTIESTKLQTPKSFYQFSDF 90
            + ++GAG SGL A     E G    V E    +GGVW        +       Y +S  
Sbjct: 9   DVLVVGAGFSGLYALYRLRELGRSVHVIETAGDVGGVWYWNRYPGARCDIESIEYCYSFS 68

Query: 91  A---WPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDL 147
                  + TE +    +++ Y+   A  F+L   I F T VT+       DE  ++W +
Sbjct: 69  EEVLQEWNWTERYASQPEILRYINFVADKFDLRSGITFHTTVTAAAF----DEATNTWTV 124

Query: 148 WGGTGKPFSSSGKWNVTVQEARNVSSATEAYQVDF 182
               G    +      + Q +  ++ A     +  
Sbjct: 125 DTNHGDRIRARYLIMASGQLSDALTGALFKIDIRG 159
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 235 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 107 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query523
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.96
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.95
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 99.79
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.75
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.65
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.49
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.48
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.45
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.39
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.37
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.3
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.28
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.28
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.23
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.22
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.22
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.22
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.21
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.21
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.21
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.21
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.21
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.19
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.18
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.17
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.17
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.16
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.16
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.16
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.14
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.14
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.13
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.13
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.13
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.12
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.12
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.11
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.11
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.1
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.1
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.09
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.08
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.07
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.06
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.05
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.05
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.02
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.01
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.0
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.99
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.99
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.99
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.99
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.98
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.98
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.97
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.97
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.96
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.96
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.95
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.94
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.93
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.93
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.93
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.92
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.92
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.9
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.9
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.89
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.86
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.86
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.85
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.82
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.82
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.81
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.81
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.78
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.75
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.75
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.74
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.71
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.69
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.69
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.66
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.63
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.63
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.59
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.57
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.57
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.56
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.56
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.56
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.55
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.54
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.53
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.52
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.47
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.47
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.46
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.46
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.42
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.41
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.39
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.34
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.33
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.33
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.31
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.31
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.25
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.24
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.1
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.1
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.07
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.0
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.0
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.98
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.98
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.94
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.92
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.91
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.89
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.88
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.87
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.86
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.84
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.83
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.8
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 97.79
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.77
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.76
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.65
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.62
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.61
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 97.6
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.59
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 97.55
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.43
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.36
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.35
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.3
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.28
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.27
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.19
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.16
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.15
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.04
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.03
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.01
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.96
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.95
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 96.92
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.9
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.84
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.78
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.53
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 96.5
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.43
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.17
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.99
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.98
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.97
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.96
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.96
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.93
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.92
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 95.84
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 95.61
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.45
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.42
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.3
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 95.26
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.2
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.19
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.1
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.04
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.85
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.74
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 94.72
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 94.63
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 94.45
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.43
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 94.41
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.31
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 94.16
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.97
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 93.84
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.71
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.59
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 93.58
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 93.24
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 93.21
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 93.09
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 92.97
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.85
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 92.79
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 92.78
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.76
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 92.76
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 92.67
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 92.63
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 92.52
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 92.49
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.46
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 92.46
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.44
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 92.38
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 92.38
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 92.27
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.22
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.05
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.02
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 92.01
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.9
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 91.79
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.73
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 91.68
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 91.64
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 91.49
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 91.4
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 91.29
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 91.18
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.98
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 90.86
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.79
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 90.74
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 90.48
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 90.16
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 90.14
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 90.08
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 89.89
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 89.85
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 89.78
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 89.44
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 89.31
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 89.22
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 89.16
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 89.16
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 89.14
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 89.09
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 89.0
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.81
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 88.75
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 88.63
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 88.42
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 88.31
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 88.17
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 88.01
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 87.96
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 87.82
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 87.72
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 87.52
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 87.39
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 86.96
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 86.9
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 86.71
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 86.6
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 86.35
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 85.95
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 85.82
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 85.4
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 85.2
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 85.17
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 85.03
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 84.97
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 84.89
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 84.79
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 84.66
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 84.49
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 84.29
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 84.03
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 83.35
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 83.18
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 82.74
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 82.6
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 82.39
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 82.05
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 81.95
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 81.43
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 81.13
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 80.95
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 80.7
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 80.3
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 80.06
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 80.05
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 80.04
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Flavin-dependent monoxygenase SPBP16F5.08c
species: Schizosaccharomyces pombe [TaxId: 4896]

Probab=99.96  E-value=3.2e-29  Score=249.28  Aligned_cols=143  Identities=34%  Similarity=0.535  Sum_probs=119.8

Q ss_pred             CcEEEECCChHHHHHHHHHHHCC--CceEEEccCCCCCccccc-c---------------------------------cC
Q 009897           31 RKIAIIGAGVSGLLACKYTLENG--FKPIVFEARSGIGGVWSQ-T---------------------------------IE   74 (523)
Q Consensus        31 ~~v~IIGaG~aGl~aA~~l~~~g--~~v~v~e~~~~~GG~w~~-~---------------------------------~~   74 (523)
                      |+|+|||||+|||++|++|+++|  .+|+||||++.+||+|.. .                                 |.
T Consensus         5 KrVaIIGaG~sGl~~A~~L~~~~~~~~v~vfEk~~~iGG~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~y~   84 (335)
T d2gv8a1           5 RKIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNYTSTLSNKLPVPSTNPILTTEPIVGPAALPVYPSPLYR   84 (335)
T ss_dssp             CEEEEECCSHHHHHHHHHHHTTTCCSEEEEECSSSSSSTTCSCCSCCCSCCCSSBCCTTCCCCCBCCSSSCCBCCCCCCT
T ss_pred             CeEEEECcCHHHHHHHHHHHHhCCCCCEEEEECCCCCCCcccccCCCCcccCCcccccccccccccccccccccccccch
Confidence            78999999999999999999876  589999999999999974 2                                 34


Q ss_pred             cccccCCcCceeeCCCCCCCCCCCCCCChhHHHHHHHHHHHHhCCCCceEeccEEEEEEeCCCCCcccccccccCCCCCC
Q 009897           75 STKLQTPKSFYQFSDFAWPNSVTETFPDHNKVMEYLQAYAAHFNLFPSIKFDTKVTSIDRLVPSDEDEHSWDLWGGTGKP  154 (523)
Q Consensus        75 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yl~~~~~~~~l~~~i~~~~~V~~v~~~~~~~~~~~~~~~~~~~~~~  154 (523)
                      .+..+++...+.|+++++++. ...|+++.++.+|++.+++.++.  .|+|+++|++|++..                  
T Consensus        85 ~l~~~~~~~~~~~~~~~~~~~-~~~f~~~~~~~~yl~~~~~~~~~--~I~~~t~V~~v~~~~------------------  143 (335)
T d2gv8a1          85 DLQTNTPIELMGYCDQSFKPQ-TLQFPHRHTIQEYQRIYAQPLLP--FIKLATDVLDIEKKD------------------  143 (335)
T ss_dssp             TCBCSSCHHHHSCTTCCCCTT-CCSSCBHHHHHHHHHHHHGGGGG--GEECSEEEEEEEEET------------------
T ss_pred             hhhcCCcHhhhhhhhhcCCcc-cccCCchHHHHHHHHHHHHHhhh--cccCceEEEEEEecC------------------
Confidence            455666777778888888765 57899999999999999998776  899999999999875                  


Q ss_pred             CCCCCCeEEEEeecccCCcceeEEEeCEEEEeeeecCCCCCCCCCC
Q 009897          155 FSSSGKWNVTVQEARNVSSATEAYQVDFVILCIGRYSDLPNTPDFP  200 (523)
Q Consensus       155 ~~~~~~~~v~~~~~~~~~~~~~~~~~d~vVlAtG~~s~~p~~p~~p  200 (523)
                          ++|.|++++.+. .++...+.||+||+|||++ +.|++|.++
T Consensus       144 ----~~w~Vt~~~~~~-~~~~~~~~~d~VI~AtG~~-s~p~~~~~~  183 (335)
T d2gv8a1         144 ----GSWVVTYKGTKA-GSPISKDIFDAVSICNGHY-EVPYTGYLY  183 (335)
T ss_dssp             ----TEEEEEEEESST-TCCEEEEEESEEEECCCSS-SSBCCCBCC
T ss_pred             ----CEEEEEEEecCC-CCeEEEEEeeEEEEccccc-ccceecccc
Confidence                689999987652 2344567899999999999 588887654
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure