Citrus Sinensis ID: 009940

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520--

MANYNVALILKNPLNDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIKLNHIQGEKSEPTISIQGSEKINLGKFDIESALNQILEQLGFGVRDGGEWKLWKCVEEPEFGPGLTIHTVYIMGKLLDGNQILQEGCKWMSTQSCINCLAEVKPSTDRVGPLVVIGLLNDLVQWRKWKVPPTLSYQEYPPGVILVPMQSRTAKPFLTTNLIVFAPDSVSDDCGNHRFVAQGEALIVDPGCRSEFHEELLKVVASLPRKLIVFVTHHHRDHVDGLSIIQKCNPDAILLAHENTMRRIGKDDWSLGYTSVSGSEDICVGGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVLDITAGGNMTDYFQSTYKFLELSPHALIPMHGRVNLWPKHMLCGYLKNRRAREAAILQAIENGVETLFDIVANVYSEVPRSFWIPAASNVRLHVDHLADQNKLPKEFSILKFRKTCGLHFLLRWAWTYLRFQVRYQKLSMSKLLIGGAAVAGFAVFFSIRNKLISQ

ccccEEEHHHccccccccEEEEEEccccccccccccccccccccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHHccccccccccEEEEEccccccccccccEEEEEEcEEccccHHHHHccccccHHHHHHHHHcccccccccccEEEEccccHHHHccccccccccccccccccEEEEccccccccccEEEEEEEEccccccccccEEEEEccccEEEEccccccHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHccccEEEccccHHHHcccccccccccccccccEEEEccEEEEEEEccccccccEEEEEcccccEEEccEEEcccEEEEcccccccHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHcHHHHHHHHHHcccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccEEEEEEEHHHHccc

cccEEEEEEEEccccccEEEEEEccccccccccHccccccccccccccccccHccccccccEEEEEcccccccccccHHHHHHHHHHHccccccccccEEEEEEEEccccccccccEEEEEEEEccccccccccccccccHHHHHHHHHcccccccccccEEEEEEEccccccccccccccccccccccccEcccccccccccccEEEEEEccccccccccccEEEEEcccEEEEccccccHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHccccEEEccccccccccccccccccEEcccccEEEEccEEEEEEEccccccccEEEEEccccEEEEccEEEcccEEEEEccccccHHHHHHHHHHHHHccccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHccc

MANYNVALILknplndsefllvkqtpppkfndeeydsyvdsdlwdlpaiklnhiqgekseptisiqgsekinlgkfDIESALNQILEQLgfgvrdggewklwkcveepefgpgltiHTVYIMGKLLDGNQILQEGCkwmstqscinclaevkpstdrvgpLVVIGLLNDLVQwrkwkvpptlsyqeyppgvilvpmqsrtakpflttnlivfapdsvsddcgnhrfVAQGealivdpgcrsEFHEELLKVVASLPRKLIVFVTHhhrdhvdglsiiqkcNPDAILLAHENTMrrigkddwslgytsvsgsedicvggqrltvvfspghtdgHVALLHASTNslivgdhcvgqgsavlditaggnmtdYFQSTYKFlelsphalipmhgrvnlwpkhmlcGYLKNRRAREAAILQAIENGVETLFDIVANVYsevprsfwipaasnvrlhvdhladqnklpKEFSILKFRKTCGLHFLLRWAWTYLRFQVRYQKLSMSKLLIGGAAVAGFAVFFSIRNKLISQ

MANYNVALIlknplndsefLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIKLNhiqgekseptisiqGSEKINLGKFDIESALNQILEQLGFGVRDGGEWKLWKCVEEPEFGPGLTIHTVYIMGKLLDGNQILQEGCKWMSTQSCINCLAEVKPSTDRVGPLVVIGLLNDLVQWRKWKVpptlsyqeypPGVILVPMQSRTAKPFLTTNLIVFAPDSVSDDCGNHRFVAQGEALIVDPGCRSEFHEELLKVVASLPRKLIVFVTHHHRDHVDGLSIIQKCNPDAILLAHENTMRRIGKDDWSLGYTSVSGSEDICVGGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVLDITAGGNMTDYFQSTYKFLELSPHALIPMHGRVNLWPKHMLCGYLKNRRAREAAILQAIENGVETLFDIVANVYSEVPRSFWIPAASNVRLHVDHLADQNKLPKEFSILKFRKTCGLHFLLRWAWTYLRFQVRYQKLSMSKLLIGGAAVAGFAVFFSIRNKLISQ

***YNVALILKNPLNDSEFLLVK**********EYDSYVDSDLWDLPAIKLNHIQ*********IQGSEKINLGKFDIESALNQILEQLGFGVRDGGEWKLWKCVEEPEFGPGLTIHTVYIMGKLLDGNQILQEGCKWMSTQSCINCLAEVKPSTDRVGPLVVIGLLNDLVQWRKWKVPPTLSYQEYPPGVILVPMQSRTAKPFLTTNLIVFAPDSVSDDCGNHRFVAQGEALIVDPGCRSEFHEELLKVVASLPRKLIVFVTHHHRDHVDGLSIIQKCNPDAILLAHENTMRRIGKDDWSLGYTSVSGSEDICVGGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVLDITAGGNMTDYFQSTYKFLELSPHALIPMHGRVNLWPKHMLCGYLKNRRAREAAILQAIENGVETLFDIVANVYSEVPRSFWIPAASNVRLHVDHLADQNKLPKEFSILKFRKTCGLHFLLRWAWTYLRFQVRYQKLSMSKLLIGGAAVAGFAVFFSIRNKL***

***YNVALILKNPLNDSEFL*****************YVDSDLWDLPAIKL*************IQGSEKINLGKFDIESALNQILEQLGFGVRDGGEWKLWKCVEEPEFGPGLTIHTVYIMGKLLDGNQILQEGCKWMSTQSCINCLAEVKPSTDRVGPLVVIGLLNDLVQ******P*TLSYQEYPPGVILVPMQSRTAKPFLTTNLIVFAPDSVSDDCGNHRFVAQGEALIVDPGCRSEFHEELLKVVASLPRKLIVFVTHHHRDHVDGLSIIQKCNPDAILLAHENTMRRIGKDDWSLGYTSVSGSEDICVGGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVLDITAGGNMTDYFQSTYKFLELSPHALIPMHGRVNLWPKHMLCGYLKNRRAREAAILQAIENGVETLFDIVANVYSEVPRSFWIPAASNVRLHVDHLADQNKLPKEFSILKFRKTCGLHFLLRWAWTYLRFQVRYQKLSMSKLLIGGAAVAGFAVFFSIRNKLI**

*ANYNVALILKNPLNDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIKLNHIQGEKSEPTISIQGSEKINLGKFDIESALNQILEQLGFGVRDGGEWKLWKCVEEPEFGPGLTIHTVYIMGKLLDGNQILQEGCKWMSTQSCINCLAEVKPSTDRVGPLVVIGLLNDLVQWRKWKVPPTLSYQEYPPGVILVPMQSRTAKPFLTTNLIVFAPDSVSDDCGNHRFVAQGEALIVDPGCRSEFHEELLKVVASLPRKLIVFVTHHHRDHVDGLSIIQKCNPDAILLAHENT**RIGKDDWSLGYTSVSGSEDICVGGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVLDITAGGNMTDYFQSTYKFLELSPHALIPMHGRVNLWPKHMLCGYLKNRRAREAAILQAIENGVETLFDIVANVYSEVPRSFWIPAASNVRLHVDHLADQNKLPKEFSILKFRKTCGLHFLLRWAWTYLRFQVRYQKLSMSKLLIGGAAVAGFAVFFSIRNKLIS*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		522	2.2.26 [Sep-21-2011]
Q5XGR8		287	Beta-lactamase-like prote	N/A	no	0.377	0.686	0.309	3e-19
Q0V9A9		289	Beta-lactamase-like prote	yes	no	0.379	0.685	0.313	1e-18
Q1LZ83		288	Beta-lactamase-like prote	yes	no	0.373	0.677	0.294	2e-17
Q561R9		288	Beta-lactamase-like prote	yes	no	0.375	0.680	0.279	1e-15
Q9VLS9		292	Beta-lactamase-like prote	yes	no	0.363	0.650	0.292	2e-15
Q99KR3		288	Beta-lactamase-like prote	yes	no	0.369	0.670	0.258	3e-14
Q6NYF0		289	Beta-lactamase-like prote	yes	no	0.344	0.622	0.319	2e-13
Q53H82		288	Beta-lactamase-like prote	yes	no	0.333	0.604	0.279	1e-12
Q95Q18		295	Beta-lactamase-like prote	yes	no	0.400	0.708	0.278	4e-12
Q7NG34		252	Hydroxyacylglutathione hy	yes	no	0.296	0.615	0.275	3e-07

>sp\|Q5XGR8\|LACB2_XENLA Beta-lactamase-like protein 2 OS=Xenopus laevis GN=lactb2 PE=2 SV=1	Back alignment and function desciption

 Score = 97.1 bits (240), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 102/213 (47%), Gaps = 16/213 (7%)

Query: 260 VFVTHHHRDHVDGLS-----IIQKCNPDAILLAHENTMRRIGKDDWSLGYTSVSGSEDIC 314
           + VTH H DHV G++     I++ CN     L        +  D     Y  +   + I 
Sbjct: 74  IIVTHWHVDHVGGIADISRDIMKGCNFSINKLPRNPHQEEVIADH---KYNYLKDGDIIT 130

Query: 315 VGGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVLDITAGGNMTDYFQSTYK 374
             G  L V+++PGHTD H+AL     N++  GD  +G+G+AV +     ++ DY +S  K
Sbjct: 131 TEGATLRVLYTPGHTDDHMALELLEENAIFSGDCILGEGTAVFE-----DLYDYMKSLEK 185

Query: 375 FLELSPHALIPMHGRVNLWPKHMLCGYLKNRRAREAAILQAIENGVETLF---DIVANVY 431
            LE+    + P HG V L  +  +  Y+ +R ARE  ILQA++      F   D+V  VY
Sbjct: 186 LLEMKADKIYPGHGPVVLGARAKIQEYISHRHAREQQILQALQENRGKSFTSMDLVKIVY 245

Query: 432 SEVPRSFWIPAASNVRLHVDHLADQNKLPKEFS 464
            + P      A  N+  H+  L  + K+ +E S
Sbjct: 246 KDTPEYLHKAAEFNLTHHLQKLKKEGKISEEQS 278

Xenopus laevis (taxid: 8355)
EC: 3EC: .EC: -EC: .EC: -EC: .EC: -

>sp\|Q0V9A9\|LACB2_XENTR Beta-lactamase-like protein 2 OS=Xenopus tropicalis GN=lactb2 PE=2 SV=1	Back alignment and function description

>sp\|Q1LZ83\|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1	Back alignment and function description

>sp\|Q561R9\|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1	Back alignment and function description

>sp\|Q9VLS9\|LACB2_DROME Beta-lactamase-like protein 2 homolog OS=Drosophila melanogaster GN=CG12375 PE=1 SV=1	Back alignment and function description

>sp\|Q99KR3\|LACB2_MOUSE Beta-lactamase-like protein 2 OS=Mus musculus GN=Lactb2 PE=1 SV=1	Back alignment and function description

>sp\|Q6NYF0\|LACB2_DANRE Beta-lactamase-like protein 2 OS=Danio rerio GN=lactb2 PE=2 SV=1	Back alignment and function description

>sp\|Q53H82\|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2	Back alignment and function description

>sp\|Q95Q18\|LACB2_CAEEL Beta-lactamase-like protein 2 homolog OS=Caenorhabditis elegans GN=Y53F4B.39 PE=3 SV=1	Back alignment and function description

>sp\|Q7NG34\|GLO2_GLOVI Hydroxyacylglutathione hydrolase OS=Gloeobacter violaceus (strain PCC 7421) GN=gloB PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		522
224111644		485	predicted protein [Populus trichocarpa]	0.886	0.954	0.702	0.0
255572132		526	catalytic, putative [Ricinus communis] g	0.988	0.980	0.667	0.0
225424037		488	PREDICTED: uncharacterized protein LOC10	0.896	0.959	0.697	0.0
357444701		555	Beta-lactamase-like protein [Medicago tr	0.973	0.915	0.605	0.0
356575570		488	PREDICTED: uncharacterized protein LOC10	0.902	0.965	0.643	0.0
297845624		780	hypothetical protein ARALYDRAFT_313393 [	0.938	0.628	0.608	1e-173
18395656		524	Metallo-beta-lactamase domain-containing	0.988	0.984	0.585	1e-173
11761474		786	unknown protein [Arabidopsis thaliana]	0.938	0.623	0.606	1e-172
357133030		519	PREDICTED: uncharacterized protein LOC10	0.917	0.922	0.558	1e-159
326533008		525	predicted protein [Hordeum vulgare subsp	0.900	0.895	0.552	1e-156

>gi\|224111644\|ref\|XP_002315930.1\| predicted protein [Populus trichocarpa] gi\|222864970\|gb\|EEF02101.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/464 (70%), Positives = 393/464 (84%), Gaps = 1/464 (0%)

Query: 1   MANYNVALILKNPLNDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIKLNHIQGEKSE 60
           MA YN+ALILKNP +++EFLL KQ PPPKF  EEYD++VDSDLWDLP+ KL+  +GE   
Sbjct: 1   MATYNLALILKNPSDEAEFLLAKQNPPPKFGIEEYDTFVDSDLWDLPSTKLDLEEGELES 60

Query: 61  PTISIQGSEKINLGKFDIESALNQILEQLGFGVRDGGEWKLWKCVEEPEFGPGLTIHTVY 120
            +I I+G E+ +LGKFD+ESA++++LEQ+GF V DGGEW+  K VEE EFGPGL +H VY
Sbjct: 61  SSIVIEGLERTDLGKFDVESAISKVLEQVGFKVNDGGEWRFLKLVEEAEFGPGLPVHRVY 120

Query: 121 IMGKLLDGNQILQEGCKWMSTQSCINCLAEVKPSTDRVGPLVVIGLLNDLVQWRKWKVPP 180
           I+GKLL GNQ L E CKWMS QSC++ L +VK S+DRVGPLVV+GL+ND  Q  + KV  
Sbjct: 121 IVGKLLPGNQNLPELCKWMSIQSCLSLLVDVKKSSDRVGPLVVLGLINDSAQSSE-KVNT 179

Query: 181 TLSYQEYPPGVILVPMQSRTAKPFLTTNLIVFAPDSVSDDCGNHRFVAQGEALIVDPGCR 240
            L YQEYPPGVI+VPM+SRTAKPF TTNL++FAP+SV ++  ++ FVA G+ALIVDPGCR
Sbjct: 180 ALHYQEYPPGVIIVPMKSRTAKPFHTTNLVIFAPESVKNESEDYNFVAHGDALIVDPGCR 239

Query: 241 SEFHEELLKVVASLPRKLIVFVTHHHRDHVDGLSIIQKCNPDAILLAHENTMRRIGKDDW 300
           ++FHEELL++VA+L +KL++FVTHHH DHVDGLS+IQKCNP+A LLAHENTM RI KDDW
Sbjct: 240 ADFHEELLQIVAALSKKLVIFVTHHHGDHVDGLSVIQKCNPNATLLAHENTMCRIRKDDW 299

Query: 301 SLGYTSVSGSEDICVGGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVLDIT 360
           SLG+ SVSG EDIC+GGQRL ++F+PGHTDGH+ALLH  T+SLIVGDHCVGQGSA+LD+ 
Sbjct: 300 SLGHISVSGGEDICIGGQRLNIIFAPGHTDGHLALLHVETHSLIVGDHCVGQGSALLDVA 359

Query: 361 AGGNMTDYFQSTYKFLELSPHALIPMHGRVNLWPKHMLCGYLKNRRAREAAILQAIENGV 420
           +GGNM DYF+STYKF+EL+PH LIPMHGRVNLWPKHMLCGYLKNRR+RE +IL+AIENG 
Sbjct: 360 SGGNMADYFRSTYKFIELAPHVLIPMHGRVNLWPKHMLCGYLKNRRSRELSILEAIENGA 419

Query: 421 ETLFDIVANVYSEVPRSFWIPAASNVRLHVDHLADQNKLPKEFS 464
           +TLFDIVA+VYS V RS W  AASNVRLHVDHL  QNKLPK  S
Sbjct: 420 KTLFDIVADVYSGVDRSLWYHAASNVRLHVDHLNQQNKLPKVIS 463

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255572132\|ref\|XP_002527006.1\| catalytic, putative [Ricinus communis] gi\|223533641\|gb\|EEF35378.1\| catalytic, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225424037\|ref\|XP_002282946.1\| PREDICTED: uncharacterized protein LOC100247470 [Vitis vinifera] gi\|297737790\|emb\|CBI26991.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357444701\|ref\|XP_003592628.1\| Beta-lactamase-like protein [Medicago truncatula] gi\|355481676\|gb\|AES62879.1\| Beta-lactamase-like protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356575570\|ref\|XP_003555912.1\| PREDICTED: uncharacterized protein LOC100778510 [Glycine max]	Back alignment and taxonomy information

>gi\|297845624\|ref\|XP_002890693.1\| hypothetical protein ARALYDRAFT_313393 [Arabidopsis lyrata subsp. lyrata] gi\|297336535\|gb\|EFH66952.1\| hypothetical protein ARALYDRAFT_313393 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|18395656\|ref\|NP_564232.1\| Metallo-beta-lactamase domain-containing protein [Arabidopsis thaliana] gi\|51968784\|dbj\|BAD43084.1\| unknown protein [Arabidopsis thaliana] gi\|332192493\|gb\|AEE30614.1\| Metallo-beta-lactamase domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|11761474\|gb\|AAG28819.2\|AC079374_22 unknown protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|357133030\|ref\|XP_003568131.1\| PREDICTED: uncharacterized protein LOC100840116 [Brachypodium distachyon]	Back alignment and taxonomy information

>gi\|326533008\|dbj\|BAJ89349.1\| predicted protein [Hordeum vulgare subsp. vulgare]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		522
TAIR\|locus:505006146		524	AT1G25375 "AT1G25375" [Arabido	0.938	0.935	0.606	1.1e-158
DICTYBASE\|DDB_G0278253		569	DDB_G0278253 [Dictyostelium di	0.273	0.251	0.383	7.7e-26
UNIPROTKB\|Q1LZ83		288	LACTB2 "Beta-lactamase-like pr	0.369	0.670	0.301	1.4e-18
UNIPROTKB\|F1RU12		288	LACTB2 "Uncharacterized protei	0.369	0.670	0.301	2.9e-17
UNIPROTKB\|O69645		264	MT3778 "Metallo-beta-lactamase	0.417	0.825	0.277	2.9e-17
FB\|FBgn0031987		292	CG12375 [Drosophila melanogast	0.371	0.664	0.298	1e-16
UNIPROTKB\|E1BZM4		288	LACTB2 "Uncharacterized protei	0.379	0.687	0.280	1e-16
UNIPROTKB\|Q53H82		288	LACTB2 "Beta-lactamase-like pr	0.369	0.670	0.291	1e-16
RGD\|1307876		288	Lactb2 "lactamase, beta 2" [Ra	0.446	0.809	0.269	1.3e-16
ZFIN\|ZDB-GENE-040426-2257		289	zgc:77065 "zgc:77065" [Danio r	0.371	0.671	0.312	4.3e-16

TAIR\|locus:505006146 AT1G25375 "AT1G25375" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1546 (549.3 bits), Expect = 1.1e-158, P = 1.1e-158
 Identities = 300/495 (60%), Positives = 372/495 (75%)

Query:     1 MANYNVALILKNPLNDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIKLNHIQ-GEKS 59
             M N  +ALI+K+P +D EFLL KQ  P KF DE YDS+VDSDLWDLP+  L  ++ G +S
Sbjct:     1 MGNLKLALIIKSPRDDVEFLLEKQKQPAKFGDEAYDSFVDSDLWDLPSTDLQALEDGVRS 60

Query:    60 EPTISIQGS--EKINLGKFDIESALNQILEQLGFGVRDGGEWKLWKCVEEPEFGPGLTIH 117
               +ISI  S  E+++L  FD ES L  +LE LG  + D GEW+  + VEEPEFGP   + 
Sbjct:    61 GFSISILDSCSEEVDLMNFDFESTLILLLENLGIDISDVGEWRFVRSVEEPEFGPDSCVR 120

Query:   118 TVYIMGKLLDGNQILQEGCKWMSTQSCINCLAEVKPSTDRVGPLVVIGLLNDLVQWRKWK 177
             T +I GKLL+ +Q LQ+ CKWMS +SC + L +VK  +DRVGPLV++GL +   Q  K K
Sbjct:   121 TCFISGKLLNTDQSLQDNCKWMSMESCFDSLIDVKLGSDRVGPLVLLGLGDGSRQSMKHK 180

Query:   178 VPPTLSYQEYPPGVILVPMQSRTAKPFLTTNLIVFAPDSVSDDCGNHRFVAQGEALIVDP 237
             +  +L+ QEYPPGV++VPM S+T KPF TTNL+VFAP++   D     FVA G+ALIVDP
Sbjct:   181 LSSSLAIQEYPPGVMIVPMHSKTLKPFRTTNLVVFAPENGLGDHQGADFVAHGDALIVDP 240

Query:   238 GCRSEFHEELLKVVASLPRKLIVFVTHHHRDHVDGLSIIQKCNPDAILLAHENTMRRIGK 297
             GC S+ H EL K+V +LPRKLIVFVTHHHRDH+DGLS IQ+ NPDAIL+AH  T  RIG 
Sbjct:   241 GCLSKLHVELKKIVDALPRKLIVFVTHHHRDHIDGLSAIQESNPDAILVAHAKTRHRIG- 299

Query:   298 DDWSLGYTSVSGSEDICVGGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVL 357
               WS  YT VSG E+I V GQ+LTV+F+PGHTDGH++LLH ST SLIVGDHCVGQGSA L
Sbjct:   300 -GWSGNYTPVSGGENIYVNGQKLTVIFAPGHTDGHMSLLHTSTQSLIVGDHCVGQGSAFL 358

Query:   358 DITAGGNMTDYFQSTYKFLELSPHALIPMHGRVNLWPKHMLCGYLKNRRAREAAILQAIE 417
             DI AGGNMTDYFQSTYKFLELSP+ +IPMHGRVNLWPKHMLCGYLKNRR+RE +IL+A  
Sbjct:   359 DIRAGGNMTDYFQSTYKFLELSPNVVIPMHGRVNLWPKHMLCGYLKNRRSREKSILKATV 418

Query:   418 NGVETLFDIVANVYSEVPRSFWIPAASNVRLHVDHLADQNKLPKEFSILKFRKTCGLHFL 477
             +G +TL+DIVA VYS V R FW  A+SNVRLH++ LA +NKLP+ FSI KF+ +CGL F 
Sbjct:   419 DGAQTLYDIVAKVYSSVDRKFWWAASSNVRLHIEKLAVENKLPEGFSIQKFKASCGLRFA 478

Query:   478 LRWAWTYLRFQVRYQ 492
             +R    Y+  ++ ++
Sbjct:   479 IRCTVGYIISKIPFK 493

GO:0003824 "catalytic activity" evidence=ISS

GO:0008152 "metabolic process" evidence=ISS

GO:0016787 "hydrolase activity" evidence=IEA

GO:0009536 "plastid" evidence=IDA

DICTYBASE\|DDB_G0278253 DDB_G0278253 [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|Q1LZ83 LACTB2 "Beta-lactamase-like protein 2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RU12 LACTB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|O69645 MT3778 "Metallo-beta-lactamase superfamily protein" [Mycobacterium tuberculosis (taxid:1773)]	Back alignment and assigned GO terms

FB\|FBgn0031987 CG12375 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BZM4 LACTB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q53H82 LACTB2 "Beta-lactamase-like protein 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|1307876 Lactb2 "lactamase, beta 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-2257 zgc:77065 "zgc:77065" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		522
COG0491		252	COG0491, GloB, Zn-dependent hydrolases, including	9e-22
smart00849		177	smart00849, Lactamase_B, Metallo-beta-lactamase su	3e-17
TIGR03413		248	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrol	3e-12
pfam00753		148	pfam00753, Lactamase_B, Metallo-beta-lactamase sup	2e-10
PRK10241		251	PRK10241, PRK10241, hydroxyacylglutathione hydrola	7e-06
pfam12706		197	pfam12706, Lactamase_B_2, Beta-lactamase superfami	0.001

>gnl\|CDD\|223565 COG0491, GloB, Zn-dependent hydrolases, including glyoxylases [General function prediction only]	Back alignment and domain information

 Score = 94.5 bits (234), Expect = 9e-22
 Identities = 47/246 (19%), Positives = 87/246 (35%), Gaps = 23/246 (9%)

Query: 196 MQSRTAKPFLTTNLIVFAPDSVSDDCGNHRFVAQGEALIVDPGCRSEFHEELLKVVASLP 255
           +                    +S +        +G A+++D G      E LL+ +A+L 
Sbjct: 1   LTKILRVSLDGITAFPIGVGPLSGNSVYLLVDGEGGAVLIDTGLGDADAEALLEALAALG 60

Query: 256 RKL-IVFVTHHHRDHVDGLSIIQKCNPDAILLAHENTMRRIGKDDWSLGYTSVSGS---- 310
             +  + +TH H DH+ G +++++    A ++A       + ++       +        
Sbjct: 61  LDVDAILLTHGHFDHIGGAAVLKEAFGAAPVIAPAEVPLLLREEILRKAGVTAEAYAAPG 120

Query: 311 ----------EDICVGGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVLDIT 360
                     +++ +GG  L V+ +PGHT GH+  L      L  GD      + V  + 
Sbjct: 121 ASPLRALEDGDELDLGGLELEVLHTPGHTPGHIVFLLEDGGVLFTGDTLFAGDTGVGRLD 180

Query: 361 A-GGNMTDYFQSTYKFLELSPHALIPMHGRVNLWPKHMLCGYLKNRRAREAAILQAIENG 419
             GG+      S  + L L     +       + P H    Y    RA      + +E  
Sbjct: 181 LPGGDAAQLLASLRRLLLLLLPDTL-------VLPGHGPDEYDPAARALALTAPRLLEVA 233

Query: 420 VETLFD 425
             TL D
Sbjct: 234 ETTLGD 239

Length = 252

>gnl\|CDD\|214854 smart00849, Lactamase_B, Metallo-beta-lactamase superfamily	Back alignment and domain information

>gnl\|CDD\|234201 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase	Back alignment and domain information

>gnl\|CDD\|216099 pfam00753, Lactamase_B, Metallo-beta-lactamase superfamily	Back alignment and domain information

>gnl\|CDD\|182327 PRK10241, PRK10241, hydroxyacylglutathione hydrolase; Provisional	Back alignment and domain information

>gnl\|CDD\|221727 pfam12706, Lactamase_B_2, Beta-lactamase superfamily domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		522
PLN02398		329	hydroxyacylglutathione hydrolase	99.95
TIGR03413		248	GSH_gloB hydroxyacylglutathione hydrolase. Members	99.94
PLN02469		258	hydroxyacylglutathione hydrolase	99.94
PRK10241		251	hydroxyacylglutathione hydrolase; Provisional	99.93
PRK11921		394	metallo-beta-lactamase/flavodoxin domain-containin	99.92
PLN02962		251	hydroxyacylglutathione hydrolase	99.92
PRK05452		479	anaerobic nitric oxide reductase flavorubredoxin;	99.92
KOG0813		265	consensus Glyoxylase [General function prediction	99.91
COG0491		252	GloB Zn-dependent hydrolases, including glyoxylase	99.86
COG0426		388	FpaA Uncharacterized flavoproteins [Energy product	99.84
smart00849		183	Lactamase_B Metallo-beta-lactamase superfamily. Ap	99.81
PF00753		194	Lactamase_B: Metallo-beta-lactamase superfamily; I	99.79
PF14597		199	Lactamase_B_5: Metallo-beta-lactamase superfamily;	99.75
KOG0814		237	consensus Glyoxylase [General function prediction	99.74
COG2015		655	Alkyl sulfatase and related hydrolases [Secondary	99.64
TIGR00649		422	MG423 conserved hypothetical protein. Contains an	99.44
PRK11539		755	ComEC family competence protein; Provisional	99.24
PRK00685		228	metal-dependent hydrolase; Provisional	99.23
COG1237		259	Metal-dependent hydrolases of the beta-lactamase s	99.13
COG0595		555	mRNA degradation ribonucleases J1/J2 (metallo-beta	99.13
TIGR00361		662	ComEC_Rec2 DNA internalization-related competence	99.11
PRK02113		252	putative hydrolase; Provisional	99.07
TIGR03675		630	arCOG00543 arCOG00543 universal archaeal KH-domain	99.07
PRK11244		250	phnP carbon-phosphorus lyase complex accessory pro	99.06
TIGR02649		303	true_RNase_BN ribonuclease BN. Members of this pro	99.04
TIGR03307		238	PhnP phosphonate metabolism protein PhnP. This fam	99.02
TIGR02651		299	RNase_Z ribonuclease Z. Processing of the 3-prime	99.02
TIGR02108		302	PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B.	98.94
PRK05184		302	pyrroloquinoline quinone biosynthesis protein PqqB	98.92
PRK04286		298	hypothetical protein; Provisional	98.9
COG2333		293	ComEC Predicted hydrolase (metallo-beta-lactamase	98.89
PF12706		194	Lactamase_B_2: Beta-lactamase superfamily domain;	98.87
PRK02126		334	ribonuclease Z; Provisional	98.86
PRK11709		355	putative L-ascorbate 6-phosphate lactonase; Provis	98.85
COG1236		427	YSH1 Predicted exonuclease of the beta-lactamase f	98.74
KOG4736		302	consensus Uncharacterized conserved protein [Funct	98.73
COG1782		637	Predicted metal-dependent RNase, consists of a met	98.51
PRK00055		270	ribonuclease Z; Reviewed	98.25
PF13483		163	Lactamase_B_3: Beta-lactamase superfamily domain;	98.21
COG2220		258	Predicted Zn-dependent hydrolases of the beta-lact	98.15
PF00293		134	NUDIX: NUDIX domain; InterPro: IPR000086 The gener	98.11
TIGR02650		277	RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me	98.04
COG2248		304	Predicted hydrolase (metallo-beta-lactamase superf	97.74
cd04664		129	Nudix_Hydrolase_7 Members of the Nudix hydrolase s	97.73
KOG1136		501	consensus Predicted cleavage and polyadenylation s	97.67
cd04666		122	Nudix_Hydrolase_9 Members of the Nudix hydrolase s	97.66
COG1234		292	ElaC Metal-dependent hydrolases of the beta-lactam	97.65
cd04691		117	Nudix_Hydrolase_32 Members of the Nudix hydrolase	97.65
cd03430		144	GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann	97.62
cd03426		157	CoAse Coenzyme A pyrophosphatase (CoAse), a member	97.57
cd03673		131	Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy	97.56
cd03428		130	Ap4A_hydrolase_human_like Diadenosine tetraphospha	97.53
cd04700		142	DR1025_like DR1025 from Deinococcus radiodurans, a	97.52
cd04679		125	Nudix_Hydrolase_20 Members of the Nudix hydrolase	97.5
cd04694		143	Nudix_Hydrolase_35 Members of the Nudix hydrolase	97.47
PRK15434		159	GDP-mannose mannosyl hydrolase NudD; Provisional	97.47
cd04683		120	Nudix_Hydrolase_24 Members of the Nudix hydrolase	97.46
cd03427		137	MTH1 MutT homolog-1 (MTH1) is a member of the Nudi	97.45
cd04696		125	Nudix_Hydrolase_37 Members of the Nudix hydrolase	97.43
cd04684		128	Nudix_Hydrolase_25 Contains a crystal structure of	97.43
cd04693		127	Nudix_Hydrolase_34 Members of the Nudix hydrolase	97.43
KOG1135		764	consensus mRNA cleavage and polyadenylation factor	97.4
cd04661		132	MRP_L46 Mitochondrial ribosomal protein L46 (MRP L	97.36
cd04695		131	Nudix_Hydrolase_36 Members of the Nudix hydrolase	97.36
cd03672		145	Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt	97.3
cd03675		134	Nudix_Hydrolase_2 Contains a crystal structure of	97.28
COG1235		269	PhnP Metal-dependent hydrolases of the beta-lactam	97.28
cd03424		137	ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase)	97.28
PRK09438		148	nudB dihydroneopterin triphosphate pyrophosphatase	97.22
cd04678		129	Nudix_Hydrolase_19 Members of the Nudix hydrolase	97.16
cd04687		128	Nudix_Hydrolase_28 Members of the Nudix hydrolase	97.13
cd04690		118	Nudix_Hydrolase_31 Members of the Nudix hydrolase	97.13
cd02885		165	IPP_Isomerase Isopentenyl diphosphate (IPP) isomer	97.12
cd04682		122	Nudix_Hydrolase_23 Members of the Nudix hydrolase	97.11
cd04673		122	Nudix_Hydrolase_15 Members of the Nudix hydrolase	97.08
cd04697		126	Nudix_Hydrolase_38 Members of the Nudix hydrolase	97.08
cd04688		126	Nudix_Hydrolase_29 Members of the Nudix hydrolase	97.07
cd03671		147	Ap4A_hydrolase_plant_like Diadenosine tetraphospha	97.05
PRK15472		141	nucleoside triphosphatase NudI; Provisional	97.03
PRK10546		135	pyrimidine (deoxy)nucleoside triphosphate pyrophos	97.01
TIGR00052		185	nudix-type nucleoside diphosphatase, YffH/AdpP fam	97.0
cd04692		144	Nudix_Hydrolase_33 Members of the Nudix hydrolase	96.98
PRK00714		156	RNA pyrophosphohydrolase; Reviewed	96.97
KOG1137		668	consensus mRNA cleavage and polyadenylation factor	96.96
cd04681		130	Nudix_Hydrolase_22 Members of the Nudix hydrolase	96.95
cd04699		129	Nudix_Hydrolase_39 Members of the Nudix hydrolase	96.9
cd04672		123	Nudix_Hydrolase_14 Members of the Nudix hydrolase	96.84
cd04680		120	Nudix_Hydrolase_21 Members of the Nudix hydrolase	96.78
cd04669		121	Nudix_Hydrolase_11 Members of the Nudix hydrolase	96.75
cd03425		124	MutT_pyrophosphohydrolase The MutT pyrophosphohydr	96.74
PRK15393		180	NUDIX hydrolase YfcD; Provisional	96.72
cd04671		123	Nudix_Hydrolase_13 Members of the Nudix hydrolase	96.72
cd04686		131	Nudix_Hydrolase_27 Members of the Nudix hydrolase	96.71
cd04677		132	Nudix_Hydrolase_18 Members of the Nudix hydrolase	96.7
PRK10776		129	nucleoside triphosphate pyrophosphohydrolase; Prov	96.68
cd03429		131	NADH_pyrophosphatase NADH pyrophosphatase, a membe	96.68
cd04676		129	Nudix_Hydrolase_17 Members of the Nudix hydrolase	96.66
cd04511		130	Nudix_Hydrolase_4 Members of the Nudix hydrolase s	96.6
TIGR02150		158	IPP_isom_1 isopentenyl-diphosphate delta-isomerase	96.57
cd04670		127	Nudix_Hydrolase_12 Members of the Nudix hydrolase	96.57
PF02112		335	PDEase_II: cAMP phosphodiesterases class-II; Inter	96.57
PRK03759		184	isopentenyl-diphosphate delta-isomerase; Provision	96.54
cd02883		123	Nudix_Hydrolase Nudix hydrolase is a superfamily o	96.5
PRK05379		340	bifunctional nicotinamide mononucleotide adenylylt	96.43
PRK10729		202	nudF ADP-ribose pyrophosphatase NudF; Provisional	96.38
cd03674		138	Nudix_Hydrolase_1 Members of the Nudix hydrolase s	96.26
KOG1361		481	consensus Predicted hydrolase involved in interstr	96.23
PLN02325		144	nudix hydrolase	96.07
cd04689		125	Nudix_Hydrolase_30 Members of the Nudix hydrolase	96.06
TIGR00586		128	mutt mutator mutT protein. All proteins in this fa	96.05
PRK10707		190	putative NUDIX hydrolase; Provisional	96.01
cd03676		180	Nudix_hydrolase_3 Members of the Nudix hydrolase s	95.81
PF14234		285	DUF4336: Domain of unknown function (DUF4336)	95.43
PRK11762		185	nudE adenosine nucleotide hydrolase NudE; Provisio	95.42
cd04667		112	Nudix_Hydrolase_10 Members of the Nudix hydrolase	95.26
PRK15009		191	GDP-mannose pyrophosphatase NudK; Provisional	95.09
cd04685		133	Nudix_Hydrolase_26 Members of the Nudix hydrolase	94.81
PRK00241		256	nudC NADH pyrophosphatase; Reviewed	94.79
PRK08999		312	hypothetical protein; Provisional	94.62
PLN02709		222	nudix hydrolase	94.48
cd04662		126	Nudix_Hydrolase_5 Members of the Nudix hydrolase s	94.46
cd03670		186	ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase)	94.4
cd04665		118	Nudix_Hydrolase_8 Members of the Nudix hydrolase s	94.04
KOG3798		343	consensus Predicted Zn-dependent hydrolase (beta-l	93.7
cd04674		118	Nudix_Hydrolase_16 Members of the Nudix hydrolase	93.57
COG1051		145	ADP-ribose pyrophosphatase [Nucleotide transport a	92.9
cd03431		118	DNA_Glycosylase_C DNA glycosylase (MutY in bacteri	92.39
cd04663		126	Nudix_Hydrolase_6 Members of the Nudix hydrolase s	91.24
KOG2121		746	consensus Predicted metal-dependent hydrolase (bet	90.67
COG5212		356	PDE1 Low-affinity cAMP phosphodiesterase [Signal t	89.66
PLN03143		291	nudix hydrolase; Provisional	89.41
PLN02791		770	Nudix hydrolase homolog	88.99
PF13691		63	Lactamase_B_4: tRNase Z endonuclease	88.6
PLN02552		247	isopentenyl-diphosphate delta-isomerase	84.93
PF01022		47	HTH_5: Bacterial regulatory protein, arsR family;	84.28
PHA02943		165	hypothetical protein; Provisional	81.8
PF14815		114	NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3	80.41

>PLN02398 hydroxyacylglutathione hydrolase	Back alignment and domain information

Probab=99.95  E-value=9.3e-27  Score=237.29  Aligned_cols=178  Identities=19%  Similarity=0.251  Sum_probs=140.8

Q ss_pred             CCeEEEcCCCCChHHHHHHHHHHhCC-CccEEEEcCCCccccCCHHHHHHhCCCCEEEEcHhHHHHhccCCCCCCceecC
Q 009940          230 GEALIVDPGCRSEFHEELLKVVASLP-RKLIVFVTHHHRDHVDGLSIIQKCNPDAILLAHENTMRRIGKDDWSLGYTSVS  308 (522)
Q Consensus       230 g~~iLIDtG~~~~~~~~L~~~~~~~~-~i~~IiiTH~H~DHiGG~~~l~~~~p~a~V~a~~~~~~~l~~~~~~~~~~~l~  308 (522)
                      +.+++||||....    +.+.+++.+ .+++|++||+|.||+||+..|++.+ +++||+++.+...+..     ....+.
T Consensus        98 ~~~~vVDP~~a~~----vl~~l~~~g~~L~~ILlTH~H~DH~GG~~~L~~~~-ga~V~g~~~~~~~i~~-----~d~~v~  167 (329)
T PLN02398         98 GTVGVVDPSEAVP----VIDALSRKNRNLTYILNTHHHYDHTGGNLELKARY-GAKVIGSAVDKDRIPG-----IDIVLK  167 (329)
T ss_pred             CEEEEEcCCCHHH----HHHHHHhcCCCceEEEECCCCchhhCCHHHHHHhc-CCEEEEehHHhhhccC-----CcEEeC
Confidence            3589999985433    344444433 4679999999999999999999987 7999999887655432     246788


Q ss_pred             CCceEEECCEEEEEEeCCCCCCCCeEEEeCCCCEEEEcccccCCCCcccccCCCCCHHHHHHHHHHHhcCCCcE-EEcCC
Q 009940          309 GSEDICVGGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVLDITAGGNMTDYFQSTYKFLELSPHA-LIPMH  387 (522)
Q Consensus       309 ~g~~l~lgg~~l~vi~tPGHT~g~i~l~~~~~~vLftGD~l~~~~~~~~~~~~~~~~~~~~~SL~~l~~l~~~~-ivPgH  387 (522)
                      +|+++.+||.+++++++||||+||++|++++.++||+||++|..+.+..   +.++..++++||++|.+++.++ |+|||
T Consensus       168 dGd~i~lgg~~l~vi~tPGHT~GhI~~~~~~~~vLFtGDtLf~~g~Gr~---feg~~~~~~~SL~rL~~L~~~t~VypGH  244 (329)
T PLN02398        168 DGDKWMFAGHEVLVMETPGHTRGHISFYFPGSGAIFTGDTLFSLSCGKL---FEGTPEQMLSSLQKIISLPDDTNIYCGH  244 (329)
T ss_pred             CCCEEEECCeEEEEEeCCCcCCCCEEEEECCCCEEEECCCcCCCCcCCC---CCCCHHHHHHHHHHHHcCCCCeEEECCC
Confidence            9999999999999999999999999999998899999999998766543   6789999999999999998886 78999


Q ss_pred             CCCcCChHHH--HHHHHHHHHHHHHHHHHHHHcCC
Q 009940          388 GRVNLWPKHM--LCGYLKNRRAREAAILQAIENGV  420 (522)
Q Consensus       388 G~~~~~~~~~--i~~~l~~~~~r~~~il~~l~~g~  420 (522)
                      |....+..-.  ++-......++.+++.+.-+++.
T Consensus       245 gyt~~Nl~Fa~~vep~n~~l~~~~~~v~~~r~~~~  279 (329)
T PLN02398        245 EYTLSNSKFALSIEPNNEVLQSYAAHVAHLRSKGL  279 (329)
T ss_pred             CChhcchhhHhhhCCChHHHHHHHHHHHHHHHcCC
Confidence            9987665433  33334455566666666666553

>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase	Back alignment and domain information

>PLN02469 hydroxyacylglutathione hydrolase	Back alignment and domain information

>PRK10241 hydroxyacylglutathione hydrolase; Provisional	Back alignment and domain information

>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional	Back alignment and domain information

>PLN02962 hydroxyacylglutathione hydrolase	Back alignment and domain information

>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional	Back alignment and domain information

>KOG0813 consensus Glyoxylase [General function prediction only]	Back alignment and domain information

>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only]	Back alignment and domain information

>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion]	Back alignment and domain information

>smart00849 Lactamase_B Metallo-beta-lactamase superfamily	Back alignment and domain information

>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain []	Back alignment and domain information

>PF14597 Lactamase_B_5: Metallo-beta-lactamase superfamily; PDB: 2P97_B	Back alignment and domain information

>KOG0814 consensus Glyoxylase [General function prediction only]	Back alignment and domain information

>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR00649 MG423 conserved hypothetical protein	Back alignment and domain information

>PRK11539 ComEC family competence protein; Provisional	Back alignment and domain information

>PRK00685 metal-dependent hydrolase; Provisional	Back alignment and domain information

>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only]	Back alignment and domain information

>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair]	Back alignment and domain information

>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2	Back alignment and domain information

>PRK02113 putative hydrolase; Provisional	Back alignment and domain information

>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein	Back alignment and domain information

>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional	Back alignment and domain information

>TIGR02649 true_RNase_BN ribonuclease BN	Back alignment and domain information

>TIGR03307 PhnP phosphonate metabolism protein PhnP	Back alignment and domain information

>TIGR02651 RNase_Z ribonuclease Z	Back alignment and domain information

>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B	Back alignment and domain information

>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional	Back alignment and domain information

>PRK04286 hypothetical protein; Provisional	Back alignment and domain information

>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only]	Back alignment and domain information

>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A	Back alignment and domain information

>PRK02126 ribonuclease Z; Provisional	Back alignment and domain information

>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional	Back alignment and domain information

>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4736 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only]	Back alignment and domain information

>PRK00055 ribonuclease Z; Reviewed	Back alignment and domain information

>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A	Back alignment and domain information

>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only]	Back alignment and domain information

>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family []	Back alignment and domain information

>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type	Back alignment and domain information

>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only]	Back alignment and domain information

>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>KOG1136 consensus Predicted cleavage and polyadenylation specificity factor (CPSF subunit) [RNA processing and modification]	Back alignment and domain information

>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only]	Back alignment and domain information

>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes	Back alignment and domain information

>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities	Back alignment and domain information

>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional	Back alignment and domain information

>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function	Back alignment and domain information

>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>KOG1135 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT2 (CPSF subunit) [RNA processing and modification]	Back alignment and domain information

>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily	Back alignment and domain information

>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex	Back alignment and domain information

>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function	Back alignment and domain information

>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only]	Back alignment and domain information

>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate	Back alignment and domain information

>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional	Back alignment and domain information

>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway	Back alignment and domain information

>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily	Back alignment and domain information

>PRK15472 nucleoside triphosphatase NudI; Provisional	Back alignment and domain information

>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional	Back alignment and domain information

>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family	Back alignment and domain information

>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK00714 RNA pyrophosphohydrolase; Reviewed	Back alignment and domain information

>KOG1137 consensus mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit) [RNA processing and modification]	Back alignment and domain information

>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi)	Back alignment and domain information

>PRK15393 NUDIX hydrolase YfcD; Provisional	Back alignment and domain information

>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional	Back alignment and domain information

>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP	Back alignment and domain information

>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1	Back alignment and domain information

>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PF02112 PDEase_II: cAMP phosphodiesterases class-II; InterPro: IPR000396 Cyclic-AMP phosphodiesterase (3	Back alignment and domain information

>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional	Back alignment and domain information

>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional	Back alignment and domain information

>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional	Back alignment and domain information

>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>KOG1361 consensus Predicted hydrolase involved in interstrand cross-link repair [Replication, recombination and repair]	Back alignment and domain information

>PLN02325 nudix hydrolase	Back alignment and domain information

>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>TIGR00586 mutt mutator mutT protein	Back alignment and domain information

>PRK10707 putative NUDIX hydrolase; Provisional	Back alignment and domain information

>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PF14234 DUF4336: Domain of unknown function (DUF4336)	Back alignment and domain information

>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional	Back alignment and domain information

>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional	Back alignment and domain information

>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>PRK00241 nudC NADH pyrophosphatase; Reviewed	Back alignment and domain information

>PRK08999 hypothetical protein; Provisional	Back alignment and domain information

>PLN02709 nudix hydrolase	Back alignment and domain information

>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P	Back alignment and domain information

>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>KOG3798 consensus Predicted Zn-dependent hydrolase (beta-lactamase superfamily) [General function prediction only]	Back alignment and domain information

>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread AoxoG residues to CG by removing the inappropriately paired adenine base from the DNA backbone	Back alignment and domain information

>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X	Back alignment and domain information

>KOG2121 consensus Predicted metal-dependent hydrolase (beta-lactamase superfamily) [General function prediction only]	Back alignment and domain information

>COG5212 PDE1 Low-affinity cAMP phosphodiesterase [Signal transduction mechanisms]	Back alignment and domain information

>PLN03143 nudix hydrolase; Provisional	Back alignment and domain information

>PLN02791 Nudix hydrolase homolog	Back alignment and domain information

>PF13691 Lactamase_B_4: tRNase Z endonuclease	Back alignment and domain information

>PLN02552 isopentenyl-diphosphate delta-isomerase	Back alignment and domain information

>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities	Back alignment and domain information

>PHA02943 hypothetical protein; Provisional	Back alignment and domain information

>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		522
4ad9_A		289	Crystal Structure Of Human Lactb2. Length = 289		8e-14

>pdb|4AD9|A Chain A, Crystal Structure Of Human Lactb2. Length = 289

Back alignment and structure

Iteration: 1

Score = 75.1 bits (183), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 52/186 (27%), Positives = 84/186 (45%), Gaps = 12/186 (6%) Query: 260 VFVTHHHRDHVDGLS-IIQKCNPDAILLAHE---NTMRRIGKDDWSLGYTSVSGSEDICV 315 + VTH HRDH G+ I + N D + N R + Y + + I Sbjct: 74 IVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKT 133 Query: 316 GGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVLDITAGGNMTDYFQSTYKF 375 G L V+++PGHTD H+ALL N++ GD +G+G+ V + ++ DY S + Sbjct: 134 EGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFE-----DLYDYMNSLKEL 188 Query: 376 LELSPHALIPMHGRVNLWPKHMLCGYLKNRRAREAAILQAIENGVE---TLFDIVANVYS 432 L++ + P HG V + + Y+ +R RE IL E T+ ++V +Y Sbjct: 189 LKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYK 248 Query: 433 EVPRSF 438 P + Sbjct: 249 NTPENL 254

PyMOL of 4ad9

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		522
4ad9_A		289	Lactb2, beta-lactamase-like protein 2; hydrolase,	1e-53
2zo4_A		317	Metallo-beta-lactamase family protein; hydrolase;	4e-30
3adr_A		261	Putative uncharacterized protein ST1585; quorum se	3e-25
1a7t_A		232	Metallo-beta-lactamase; hydrolase (beta-lactamase)	2e-22
3l6n_A		219	Metallo-beta-lactamase; zinc, hydolase, antibiotic	6e-22
2y8b_A		265	Metallo-B-lactamase; hydrolase, cephalosporins, an	2e-21
1m2x_A		223	Class B carbapenemase BLAB-1; alpha-beta/BETA-alph	2e-20
1mqo_A		227	Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd	9e-20
4eyb_A		270	Beta-lactamase NDM-1; metallo beta lactamase, anti	3e-19
1jjt_A		228	IMP-1 metallo beta-lactamase; metallo-beta-lactama	9e-19
2vw8_A		303	PA1000, PQSE; quinolone signal response protein, s	2e-18
1sml_A		269	Protein (penicillinase); metallo-beta-lactamase, a	8e-17
2xf4_A		210	Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A	8e-16
2fhx_A		246	SPM-1; metallo-beta-lactamase, dinuclear zinc, ant	3e-15
3m8t_A		294	'BLR6230 protein; subclass B3 beta-lactamase, zinc	4e-15
1k07_A		263	FEZ-1 beta-lactamase; monomer with alpha-beta/BETA	6e-15
2zwr_A		207	Metallo-beta-lactamase superfamily protein; hydrol	7e-15
1xm8_A		254	Glyoxalase II; structural genomics, protein struct	2e-14
4ax1_B		303	Metallo-beta-lactamase AIM-1; hydrolase, antibioti	2e-14
2p97_A		201	Hypothetical protein; putative metal-dependent hyd	6e-14
3q6v_A		233	Beta-lactamase; metalloenzyme, alpha-beta, hydrola	8e-14
3r2u_A		466	Metallo-beta-lactamase family protein; structural	2e-13
2qed_A		258	Hydroxyacylglutathione hydrolase; metallo-B- super	2e-13
1qh5_A		260	Glyoxalase II, protein (hydroxyacylglutathione hyd	4e-13
3iog_A		227	Beta-lactamase; hydrolase, antibiotic resistance,	1e-12
3tp9_A		474	Beta-lactamase and rhodanese domain protein; struc	2e-11
1ztc_A		221	Hypothetical protein TM0894; structural genomics,	4e-11
2gcu_A		245	Putative hydroxyacylglutathione hydrolase 3; ethyl	1e-09
2p18_A		311	Glyoxalase II; metalloprotein, beta sandwich, alph	6e-09
4efz_A		298	Metallo-beta-lactamase family protein; structural	7e-09
3dha_A		254	N-acyl homoserine lactone hydrolase; zinc bimetall	7e-07
2ohh_A		404	Type A flavoprotein FPRA; beta-lactamase like doma	1e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
2q9u_A		414	A-type flavoprotein; flavodoxin like, beta lactama	3e-05
2r2d_A		276	AGR_PTI_140P, Zn-dependent hydrolases; lactonase,	3e-05
1ycg_A		398	Nitric oxide reductase; DIIRON site, oxidoreductas	3e-05
3aj3_A		274	MLR6805 protein, 4-pyridoxolactonase; Zn-protein,	1e-04
1e5d_A		402	Rubredoxin\:oxygen oxidoreductase; oxygenreductase	2e-04
1p9e_A		331	Methyl parathion hydrolase; Zn containing; 2.40A {	3e-04

>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Length = 289	Back alignment and structure

 Score =  182 bits (463), Expect = 1e-53
 Identities = 60/243 (24%), Positives = 103/243 (42%), Gaps = 15/243 (6%)

Query: 230 GEALIVDPGCRS--EFHEELLKVVASLPRKLI-VFVTHHHRDHVDGLSIIQKCNPDAILL 286
              +++D G  +  E+   L + +      +  + VTH HRDH  G+  I K   +    
Sbjct: 41  PRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTY 100

Query: 287 AHENTMR----RIGKDDWSLGYTSVSGSEDICVGGQRLTVVFSPGHTDGHVALLHASTNS 342
             +   R         +    Y  +   + I   G  L V+++PGHTD H+ALL    N+
Sbjct: 101 CIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENA 160

Query: 343 LIVGDHCVGQGSAVLDITAGGNMTDYFQSTYKFLELSPHALIPMHGRVNLWPKHMLCGYL 402
           +  GD  +G+G+ V       ++ DY  S  + L++    + P HG V    +  +  Y+
Sbjct: 161 IFSGDCILGEGTTVF-----EDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYI 215

Query: 403 KNRRAREAAILQAIENGVE---TLFDIVANVYSEVPRSFWIPAASNVRLHVDHLADQNKL 459
            +R  RE  IL       E   T+ ++V  +Y   P +    A  N+ LH+  L  + K+
Sbjct: 216 SHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKI 275

Query: 460 PKE 462
              
Sbjct: 276 FSN 278

PyMOL of 4ad9

>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Length = 317	Back alignment and structure

>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Length = 261	Back alignment and structure

>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Length = 232	Back alignment and structure

>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} Length = 219	Back alignment and structure

>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Length = 265	Back alignment and structure

>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Length = 223	Back alignment and structure

>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Length = 227	Back alignment and structure

>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Length = 270	Back alignment and structure

>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Length = 228	Back alignment and structure

>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Length = 303	Back alignment and structure

>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Length = 269	Back alignment and structure

>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Length = 210	Back alignment and structure

>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Length = 246	Back alignment and structure

>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Length = 294	Back alignment and structure

>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Length = 263	Back alignment and structure

>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Length = 207	Back alignment and structure

>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Length = 254	Back alignment and structure

>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Length = 303	Back alignment and structure

>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Length = 201	Back alignment and structure

>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Length = 233	Back alignment and structure

>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466	Back alignment and structure

>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Length = 258	Back alignment and structure

>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Length = 260	Back alignment and structure

>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A Length = 227	Back alignment and structure

>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474	Back alignment and structure

>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Length = 221	Back alignment and structure

>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Length = 245	Back alignment and structure

>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Length = 311	Back alignment and structure

>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Length = 298	Back alignment and structure

>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Length = 254	Back alignment and structure

>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Length = 404	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Length = 414	Back alignment and structure

>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Length = 276	Back alignment and structure

>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Length = 398	Back alignment and structure

>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Length = 274	Back alignment and structure

>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Length = 402	Back alignment and structure

>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Length = 331	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		522
2zo4_A		317	Metallo-beta-lactamase family protein; hydrolase;	100.0
4ad9_A		289	Lactb2, beta-lactamase-like protein 2; hydrolase,	100.0
2vw8_A		303	PA1000, PQSE; quinolone signal response protein, s	99.97
2cfu_A		658	SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1	99.97
2yhe_A		668	SEC-alkyl sulfatase; hydrolase, inversion, metallo	99.94
1m2x_A		223	Class B carbapenemase BLAB-1; alpha-beta/BETA-alph	99.96
4eyb_A		270	Beta-lactamase NDM-1; metallo beta lactamase, anti	99.96
3l6n_A		219	Metallo-beta-lactamase; zinc, hydolase, antibiotic	99.96
1a7t_A		232	Metallo-beta-lactamase; hydrolase (beta-lactamase)	99.96
3hnn_A		262	Putative diflavin flavoprotein A 5; PSI-2, protein	99.96
1k07_A		263	FEZ-1 beta-lactamase; monomer with alpha-beta/BETA	99.96
1mqo_A		227	Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd	99.95
2fhx_A		246	SPM-1; metallo-beta-lactamase, dinuclear zinc, ant	99.95
2y8b_A		265	Metallo-B-lactamase; hydrolase, cephalosporins, an	99.95
3iog_A		227	Beta-lactamase; hydrolase, antibiotic resistance,	99.95
3q6v_A		233	Beta-lactamase; metalloenzyme, alpha-beta, hydrola	99.95
4hl2_A		243	Beta-lactamase NDM-1; structural genomics, PSI-bio	99.95
1jjt_A		228	IMP-1 metallo beta-lactamase; metallo-beta-lactama	99.95
2qed_A		258	Hydroxyacylglutathione hydrolase; metallo-B- super	99.94
1xm8_A		254	Glyoxalase II; structural genomics, protein struct	99.94
3m8t_A		294	'BLR6230 protein; subclass B3 beta-lactamase, zinc	99.94
2p18_A		311	Glyoxalase II; metalloprotein, beta sandwich, alph	99.93
4dik_A		410	Flavoprotein; TM0755, electron transport, DI-iron	99.93
2ohh_A		404	Type A flavoprotein FPRA; beta-lactamase like doma	99.93
1qh5_A		260	Glyoxalase II, protein (hydroxyacylglutathione hyd	99.93
4ax1_B		303	Metallo-beta-lactamase AIM-1; hydrolase, antibioti	99.92
2p97_A		201	Hypothetical protein; putative metal-dependent hyd	99.92
1ycg_A		398	Nitric oxide reductase; DIIRON site, oxidoreductas	99.92
2q9u_A		414	A-type flavoprotein; flavodoxin like, beta lactama	99.92
1e5d_A		402	Rubredoxin\:oxygen oxidoreductase; oxygenreductase	99.92
2gcu_A		245	Putative hydroxyacylglutathione hydrolase 3; ethyl	99.92
2xf4_A		210	Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A	99.92
4efz_A		298	Metallo-beta-lactamase family protein; structural	99.92
2zwr_A		207	Metallo-beta-lactamase superfamily protein; hydrol	99.91
1sml_A		269	Protein (penicillinase); metallo-beta-lactamase, a	99.91
3r2u_A		466	Metallo-beta-lactamase family protein; structural	99.9
3adr_A		261	Putative uncharacterized protein ST1585; quorum se	99.89
3tp9_A		474	Beta-lactamase and rhodanese domain protein; struc	99.88
3dha_A		254	N-acyl homoserine lactone hydrolase; zinc bimetall	99.86
3aj3_A		274	MLR6805 protein, 4-pyridoxolactonase; Zn-protein,	99.84
3esh_A		280	Protein similar to metal-dependent hydrolase; stru	99.84
1p9e_A		331	Methyl parathion hydrolase; Zn containing; 2.40A {	99.83
2r2d_A		276	AGR_PTI_140P, Zn-dependent hydrolases; lactonase,	99.82
1ztc_A		221	Hypothetical protein TM0894; structural genomics,	99.81
3qsj_A		232	Nudix hydrolase; structural genomics, PSI-biology,	99.71
1zkp_A		268	Hypothetical protein BA1088; zinc binding protein,	99.61
3zq4_A		555	Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat	99.57
3bk2_A		562	RNAse J, metal dependent hydrolase; endoribonuclea	99.53
3iek_A		431	Ribonuclease TTHA0252; metallo beta lactamase fold	99.48
2ycb_A		636	Beta-CAsp RNAse, cleavage and polyadenylation spec	99.46
2i7x_A		717	Protein CFT2; polyadenylation, metallo-B-lactamase	99.43
2xr1_A		640	Cleavage and polyadenylation specificity factor 1	99.43
2e7y_A		280	TRNAse Z; tRNA maturation, metallo-beta-lactaMSe,	99.4
3g1p_A		258	Protein PHNP; C-P lyase, phosphodiesterase, phosph	99.39
3md7_A		293	Beta-lactamase-like; ssgcid, hydrolase, structural	99.39
3af5_A		651	Putative uncharacterized protein PH1404; archaeal	99.35
2az4_A		429	Hypothetical protein EF2904; structural genomics,	99.34
3kl7_A		235	Putative metal-dependent hydrolase; structural gen	99.32
2cbn_A		306	Ribonuclease Z; phosphodiesterase beta lactamase t	99.3
2wyl_A		360	L-ascorbate-6-phosphate lactonase ULAG; hydrolase;	99.28
1y44_A		320	Ribonuclease Z; zinc-dependent metal hydrolase, hy	99.27
2i7t_A		459	Cleavage and polyadenylation specificity factor 73	99.26
3bv6_A		379	Metal-dependent hydrolase; metallo protein, beta-l	99.23
2bib_A		547	CBPE, teichoic acid phosphorylcholine esterase/ ch	99.17
2p4z_A		284	Metal-dependent hydrolases of the beta-lactamase s	99.16
3rpc_A		264	Possible metal-dependent hydrolase; structural gen	99.1
4b87_A		367	DNA cross-LINK repair 1A protein; dclre1A, DCLRE,	99.1
3zwf_A		368	Zinc phosphodiesterase ELAC protein 1; beta-lactam	99.08
3jxp_A		321	Coenzyme PQQ synthesis protein B; alpha-beta prote	99.03
3zdk_A		336	5' exonuclease apollo; hydrolase; HET: TLA; 2.16A	98.91
3h3e_A		267	Uncharacterized protein TM1679; structural genomic	98.81
1vjn_A		220	Zn-dependent hydrolase of metallo-beta-lactamase s	98.69
3u53_A		155	BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical];	97.95
3gwy_A		140	Putative CTP pyrophosphohydrolase; structural geno	97.84
3grn_A		153	MUTT related protein; structural genomics, hydrola	97.79
3i7u_A		134	AP4A hydrolase; nudix protein, diadenosine polypho	97.75
1q27_A		171	Putative nudix hydrolase DR0079; radiation resista	97.68
1ktg_A		138	Diadenosine tetraphosphate hydrolase; nudix, AMP,	97.66
1sjy_A		159	MUTT/nudix family protein; nudix fold, alpha-beta-	97.62
1v8y_A		170	ADP-ribose pyrophosphatase; nudix motif, loop-heli	97.61
3q91_A		218	Uridine diphosphate glucose pyrophosphatase; struc	97.59
4dyw_A		157	MUTT/nudix family protein; structural genomics, ni	97.49
1rya_A		160	GDP-mannose mannosyl hydrolase; GDP-glucose, nudix	97.49
3shd_A		153	Phosphatase NUDJ; nudix fold, nudix motif, hydrola	97.47
3exq_A		161	Nudix family hydrolase; protein structure initiati	97.45
1vcd_A		126	NDX1; nudix protein, diadenosine polyphosphate, AP	97.38
3eds_A		153	MUTT/nudix family protein; MUT/nudix protein, prot	97.37
1mut_A		129	MUTT, nucleoside triphosphate pyrophosphohydrolase	97.34
2pbt_A		134	AP4A hydrolase; nudix protein, diadenosine polypho	97.33
2b0v_A		153	Nudix hydrolase; structural genomics, PSI, protein	97.33
3o6z_A		191	GDP-mannose pyrophosphatase NUDK; nudix, hydrolase	97.32
3son_A		149	Hypothetical nudix hydrolase; structural genomics,	97.3
1nqz_A		194	COA pyrophosphatase (MUTT/nudix family protein); D	97.27
2w4e_A		145	MUTT/nudix family protein; ADP-ribose pyrophosphat	97.27
3h95_A		199	Nucleoside diphosphate-linked moiety X motif 6; NU	97.26
2o1c_A		150	DATP pyrophosphohydrolase; nudix NTP hydrolase NTP	97.25
3q93_A		176	7,8-dihydro-8-oxoguanine triphosphatase; structura	97.24
3hhj_A		158	Mutator MUTT protein; niaid, ssgcid, decode, UW, S	97.22
1hzt_A		190	Isopentenyl diphosphate delta-isomerase; dimethyla	97.21
3ees_A		153	Probable pyrophosphohydrolase; nudix, RNA pyrophos	97.21
2azw_A		148	MUTT/nudix family protein; MUTT/nudix ,enterococcu	97.19
3r03_A		144	Nudix hydrolase; structural genomics, PSI2, protei	97.19
1f3y_A		165	Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase	97.19
1g0s_A		209	Hypothetical 23.7 kDa protein in ICC-TOLC intergen	97.09
3id9_A		171	MUTT/nudix family protein; hydrolase, protein stru	97.08
3cng_A		189	Nudix hydrolase; structural genomics, APC7497, PSI	97.07
2yvp_A		182	NDX2, MUTT/nudix family protein; nudix protein, AD	97.04
3oga_A		165	Nucleoside triphosphatase NUDI; salmonella enteric	97.01
3gg6_A		156	Nudix motif 18, nucleoside diphosphate-linked moie	96.99
2fkb_A		180	Putative nudix hydrolase YFCD; putative protein, M	96.94
2rrk_A		140	ORF135, CTP pyrophosphohydrolase; NMR {Escherichia	96.91
2jvb_A		146	Protein PSU1, mRNA-decapping enzyme subunit 2; DCP	96.9
2dsc_A		212	ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP	96.9
2fml_A		273	MUTT/nudix family protein; structural genomics, PS	96.84
1mk1_A		207	ADPR pyrophosphatase; nudix hydrolase, adprase, ad	96.76
2pqv_A		154	MUTT/nudix family protein; structu genomics, PSI-2	96.76
1x51_A		155	A/G-specific adenine DNA glycosylase; nudix domain	96.73
2fvv_A		194	Diphosphoinositol polyphosphate phosphohydrolase 1	96.73
2b06_A		155	MUTT/nudix family protein; structural genomics, P	96.65
2yyh_A		139	MUTT domain, 8-OXO-DGTPase domain; nudix family pr	96.6
3fcm_A		197	Hydrolase, nudix family; protein structure initiat	96.6
2a6t_A		271	SPAC19A8.12; alpha/beta/alpha, RNA binding protein	96.58
3f6a_A		159	Hydrolase, nudix family; protein structure initiat	96.52
3i9x_A		187	MUTT/nudix family protein; structural genomics, hy	96.5
3fjy_A		364	Probable MUTT1 protein; dimer, protein structure i	96.47
1vhz_A		198	ADP compounds hydrolase NUDE; structural genomics;	96.47
3gz5_A		240	MUTT/nudix family protein; DNA binding protein, nu	96.46
3fk9_A		188	Mutator MUTT protein; structural genomics, hydrola	96.36
2qjt_B		352	Nicotinamide-nucleotide adenylyltransferase; two i	96.29
2qjo_A		341	Bifunctional NMN adenylyltransferase/nudix hydrol;	96.29
2kdv_A		164	RNA pyrophosphohydrolase; nudix family, magnesium,	96.28
3o8s_A		206	Nudix hydrolase, ADP-ribose pyrophosphatase; struc	96.17
3q1p_A		205	Phosphohydrolase (MUTT/nudix family protein); asym	96.12
2fb1_A		226	Conserved hypothetical protein; structural genomic	96.09
1k2e_A		156	Nudix homolog; nudix/MUTT-like fold, mixed alpha/b	95.91
3fsp_A		369	A/G-specific adenine glycosylase; protein-DNA comp	95.69
1q33_A		292	Pyrophosphatase, ADP-ribose pyrophosphatase; nudix	95.59
1vk6_A		269	NADH pyrophosphatase; 1790429, structural genomics	95.5
3e57_A		211	Uncharacterized protein TM1382; structural genomic	95.44
3f13_A		163	Putative nudix hydrolase family member; structural	94.58
2pny_A		246	Isopentenyl-diphosphate delta-isomerase 2; caroten	93.77
1u20_A		212	U8 snoRNA-binding protein X29; modified nudix hydr	93.19
2dho_A		235	Isopentenyl-diphosphate delta-isomerase 1; alpha/b	93.07
3dup_A		300	MUTT/nudix family protein; nudix superfamily hydro	89.93
2xsq_A		217	U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp	89.2
2jt1_A		77	PEFI protein; solution structure, winged helix-tur	84.13

>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus}	Back alignment and structure

Probab=100.00  E-value=3.4e-38  Score=320.80  Aligned_cols=258  Identities=22%  Similarity=0.314  Sum_probs=205.8

Q ss_pred             ceecCCeEEEEeccCCCCCCCccccEEEEccCCCCCCCcceEEEecCCeEEEcCCCCChH-HHHHHHHHHhCC----Ccc
Q 009940          184 YQEYPPGVILVPMQSRTAKPFLTTNLIVFAPDSVSDDCGNHRFVAQGEALIVDPGCRSEF-HEELLKVVASLP----RKL  258 (522)
Q Consensus       184 ~~evapGv~~v~~~~~~~~p~~~~N~~~i~~~~~~~g~~~~~~l~~g~~iLIDtG~~~~~-~~~L~~~~~~~~----~i~  258 (522)
                      ++|++||||+++.+.+  .+....|+|++..+              ++.+|||||..... .+.+.+.+++.+    +++
T Consensus         1 ~~~v~~~v~~i~~~~p--~~~~~~n~~li~~~--------------~~~ilID~G~~~~~~~~~l~~~l~~~g~~~~~i~   64 (317)
T 2zo4_A            1 MKALLPGLYLLPVPIP--YPLKTVNLYLLQGA--------------GEVALVDTALGTRAARGALELHLAELGLCFQDVK   64 (317)
T ss_dssp             --CCBTTEEEEEEECS--STTCEEEEEEEEET--------------TEEEEECCCCSSHHHHHHHHHHHHHTTCCGGGCC
T ss_pred             CeeccCCeEEEEecCC--CCCCcEEEEEEEcC--------------CceEEEECCCCCHHHHHHHHHHHHHcCCChhhcC
Confidence            3689999999976432  23345677776643              46899999988753 334555555543    477


Q ss_pred             EEEEcCCCccccCCHHHHHHhCCCCEEEEcHhHHHHhcc------------------CCC--------------------
Q 009940          259 IVFVTHHHRDHVDGLSIIQKCNPDAILLAHENTMRRIGK------------------DDW--------------------  300 (522)
Q Consensus       259 ~IiiTH~H~DHiGG~~~l~~~~p~a~V~a~~~~~~~l~~------------------~~~--------------------  300 (522)
                      +||+||.|+||+||+..|++.  +++||+++.+...+..                  .+.                    
T Consensus        65 ~Vi~TH~H~DH~gg~~~l~~~--~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~  142 (317)
T 2zo4_A           65 TILLTHHHPDHYGLSGFFEGL--GARVFLHEEEFARGHRFWREPEAFAEASWRLFLDHGTPEGALQGIRETVEKTRERVH  142 (317)
T ss_dssp             EEEESCCSHHHHTTHHHHHHT--TCEEEEEGGGTTTHHHHHHCTTTSHHHHHHHHHHTTCCC-------CHHHHHHTTCC
T ss_pred             EEEEcCCCCcccccHHHHHhC--CCEEEEcHHHHHHHHhhhhhhhhHHHHHHHHHHHcCCCHHHHHHHHHhcccccccCC
Confidence            999999999999999999886  8999999876543321                  001                    


Q ss_pred             -CCCceecCCCceEEECCEEEEEEeCCCCCCCCeEEEeCCCCEEEEcccccCCCCcccccC---CCCCHHHHHHHHHHHh
Q 009940          301 -SLGYTSVSGSEDICVGGQRLTVVFSPGHTDGHVALLHASTNSLIVGDHCVGQGSAVLDIT---AGGNMTDYFQSTYKFL  376 (522)
Q Consensus       301 -~~~~~~l~~g~~l~lgg~~l~vi~tPGHT~g~i~l~~~~~~vLftGD~l~~~~~~~~~~~---~~~~~~~~~~SL~~l~  376 (522)
                       ......+.+|+.+.+||.+++++++||||+||+++++++.++||+||+++....++....   ...++.+|++|++++.
T Consensus       143 ~~~~~~~~~~g~~l~~gg~~~~~i~tpGHt~g~~~~~~~~~~~lf~GD~~~~~~~~~~~~~~~~~~~~~~~~~~sl~~l~  222 (317)
T 2zo4_A          143 PPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLA  222 (317)
T ss_dssp             CCSSCEEECTTCEEEETTEEEEEEECCSSSTTCEEEEETTTTEEEEETSCCSSSCCCCCCCTTSCSCHHHHHHHHHHHHH
T ss_pred             CCCCceEECCCCEEEeCCceEEEEECCCCCcccEEEEeCCCCEEEECCEecCCCCCCCcccCCCCCchHHHHHHHHHHHh
Confidence             124567889999999999999999999999999999999999999999987655443321   2357899999999999


Q ss_pred             cCCCcEEEcCCCCCcCChHHHHHHHHHHHHHHHHHHHHHHHcCCCCHHHHHHHHhc-CCCCcchhHHHHHHHHHHHHHHH
Q 009940          377 ELSPHALIPMHGRVNLWPKHMLCGYLKNRRAREAAILQAIENGVETLFDIVANVYS-EVPRSFWIPAASNVRLHVDHLAD  455 (522)
Q Consensus       377 ~l~~~~ivPgHG~~~~~~~~~i~~~l~~~~~r~~~il~~l~~g~~T~~ei~~~~y~-~~~~~~~~~a~~~v~ahL~~L~~  455 (522)
                      ++++++++||||+++.+..+.++++++++++|++++++++ +++.|+.|+++.+|+ ++++.++.++..++.+||++|++
T Consensus       223 ~l~~~~v~pgHg~~~~~~~~~i~~~~~~~~~~~~~i~~~l-~~~~t~~ei~~~~~~~~~~~~~~~~a~~e~~ahL~~L~~  301 (317)
T 2zo4_A          223 DLGARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALL-DGPKTAWELSLHLFPQELDPAGRRFAFAETLAHLEYLRE  301 (317)
T ss_dssp             TSCCSEEEESSSSCBSCHHHHHHHHHHHHHHHHHHHHHHC-SSCBCHHHHHHHHCC-------CHHHHHHHHHHHHHHHH
T ss_pred             cCCCCEEECCCCCccCCHHHHHHHHHHHHHHHHHHHHHHh-cCCCCHHHHHHHHhhcccChhHHHHHHHHHHHHHHHHHH
Confidence            9999999999999998888999999999999999999988 567799999999999 99999999999999999999999


Q ss_pred             CCCcc
Q 009940          456 QNKLP  460 (522)
Q Consensus       456 ~g~i~  460 (522)
                      +|+|.
T Consensus       302 ~g~v~  306 (317)
T 2zo4_A          302 EGAVG  306 (317)
T ss_dssp             TTSEE
T ss_pred             CCCEE
Confidence            99997

PyMOL of 2zo4

>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens}	Back alignment and structure

>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A*	Back alignment and structure

>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A*	Back alignment and structure

>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP}	Back alignment and structure

>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1	Back alignment and structure

>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A	Back alignment and structure

>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0	Back alignment and structure

>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A*	Back alignment and structure

>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A	Back alignment and structure

>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ...	Back alignment and structure

>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa}	Back alignment and structure

>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A	Back alignment and structure

>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A	Back alignment and structure

>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A	Back alignment and structure

>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A	Back alignment and structure

>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A	Back alignment and structure

>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2	Back alignment and structure

>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A	Back alignment and structure

>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A	Back alignment and structure

>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A*	Back alignment and structure

>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A*	Back alignment and structure

>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A*	Back alignment and structure

>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A*	Back alignment and structure

>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B	Back alignment and structure

>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12	Back alignment and structure

>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A*	Back alignment and structure

>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis}	Back alignment and structure

>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3	Back alignment and structure

>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana}	Back alignment and structure

>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica}	Back alignment and structure

>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei}	Back alignment and structure

>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A	Back alignment and structure

>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A	Back alignment and structure

>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus}	Back alignment and structure

>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii}	Back alignment and structure

>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A	Back alignment and structure

>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A	Back alignment and structure

>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp}	Back alignment and structure

>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5	Back alignment and structure

>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens}	Back alignment and structure

>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11	Back alignment and structure

>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9	Back alignment and structure

>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis}	Back alignment and structure

>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A*	Back alignment and structure

>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A*	Back alignment and structure

>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid}	Back alignment and structure

>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10	Back alignment and structure

>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei}	Back alignment and structure

>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A	Back alignment and structure

>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A	Back alignment and structure

>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A*	Back alignment and structure

>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A*	Back alignment and structure

>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10	Back alignment and structure

>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503}	Back alignment and structure

>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7	Back alignment and structure

>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A*	Back alignment and structure

>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A*	Back alignment and structure

>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A	Back alignment and structure

>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor}	Back alignment and structure

>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A*	Back alignment and structure

>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis}	Back alignment and structure

>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula}	Back alignment and structure

>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens}	Back alignment and structure

>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens}	Back alignment and structure

>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A	Back alignment and structure

>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens}	Back alignment and structure

>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima}	Back alignment and structure

>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4	Back alignment and structure

>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A*	Back alignment and structure

>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0	Back alignment and structure

>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei}	Back alignment and structure

>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A*	Back alignment and structure

>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A	Back alignment and structure

>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A*	Back alignment and structure

>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A*	Back alignment and structure

>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A	Back alignment and structure

>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens}	Back alignment and structure

>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei}	Back alignment and structure

>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A*	Back alignment and structure

>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A	Back alignment and structure

>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367}	Back alignment and structure

>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A*	Back alignment and structure

>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A*	Back alignment and structure

>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1	Back alignment and structure

>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A	Back alignment and structure

>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes}	Back alignment and structure

>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A	Back alignment and structure

>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans}	Back alignment and structure

>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens}	Back alignment and structure

>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A	Back alignment and structure

>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A	Back alignment and structure

>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae}	Back alignment and structure

>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A*	Back alignment and structure

>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A*	Back alignment and structure

>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1	Back alignment and structure

>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0	Back alignment and structure

>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A*	Back alignment and structure

>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A	Back alignment and structure

>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str}	Back alignment and structure

>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718}	Back alignment and structure

>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A*	Back alignment and structure

>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A	Back alignment and structure

>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens}	Back alignment and structure

>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2	Back alignment and structure

>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli}	Back alignment and structure

>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A*	Back alignment and structure

>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6	Back alignment and structure

>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A*	Back alignment and structure

>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae}	Back alignment and structure

>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3	Back alignment and structure

>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A*	Back alignment and structure

>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1	Back alignment and structure

>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus}	Back alignment and structure

>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124}	Back alignment and structure

>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B*	Back alignment and structure

>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124}	Back alignment and structure

>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua}	Back alignment and structure

>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID}	Back alignment and structure

>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A*	Back alignment and structure

>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A*	Back alignment and structure

>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans}	Back alignment and structure

>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B	Back alignment and structure

>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP}	Back alignment and structure

>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A	Back alignment and structure

>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis}	Back alignment and structure

>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A	Back alignment and structure

>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6	Back alignment and structure

>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A	Back alignment and structure

>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A*	Back alignment and structure

>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A*	Back alignment and structure

>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A	Back alignment and structure

>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima}	Back alignment and structure

>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum}	Back alignment and structure

>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens}	Back alignment and structure

>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A*	Back alignment and structure

>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A*	Back alignment and structure

>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170}	Back alignment and structure

>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A	Back alignment and structure

>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		522
d1ko3a_		230	d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomo	1e-14
d1xm8a_		254	d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathio	1e-12
d2aioa1		266	d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xa	1e-11
d1mqoa_		221	d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus	2e-11
d1k07a_		262	d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoriba	2e-11
d2q0ia1		298	d.157.1.14 (A:1-298) Quinolone signal response pro	3e-11
d1jjta_		220	d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomo	1e-10
d2gmna1		264	d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Br	6e-10
d1e5da2		249	d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreducta	2e-09
d2p97a1		200	d.157.1.12 (A:1-200) Hypothetical protein Ava3068	4e-09
d1x8ha_		228	d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromona	8e-09
d1vmea2		250	d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755,	1e-08
d2qeda1		251	d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglut	1e-08
d1ycga2		249	d.157.1.3 (A:2-250) Nitric oxide reductase N-termi	2e-08
d1m2xa_		219	d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseob	2e-08
d2cfua2		505	d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudo	3e-08
d1znba_		230	d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroi	8e-07
d1ztca1		207	d.157.1.11 (A:1-207) Hypothetical protein TM0894 {	8e-06
d1qh5a_		260	d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathio	9e-05
d2dkfa1		431	d.157.1.10 (A:1-431) Putative RNA-degradation prot	0.003

>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Length = 230	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Zn metallo-beta-lactamase
domain: Zn metallo-beta-lactamase
species: Pseudomonas aeruginosa, VIM-2 [TaxId: 287]

 Score = 71.2 bits (173), Expect = 1e-14
 Identities = 28/166 (16%), Positives = 54/166 (32%), Gaps = 5/166 (3%)

Query: 230 GEALIVDPGCRSEFHEELLKVVASLPRKLI--VFVTHHHRDHVDGLSIIQKCN-PDAILL 286
            E L++D    ++    LL  +       +     TH H D V G+ +++          
Sbjct: 47  DELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASP 106

Query: 287 AHENTMRRIGKDDWSLGYTSVSGSEDICVGGQRLTVVFSPGHTDGHVALLHASTNSLIVG 346
           +        G +  +     +S S D    G          H+  ++ +   S + L  G
Sbjct: 107 STRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGG 166

Query: 347 DHCVGQGSAVLDITAGGNMTDYFQSTYKFLELSPHA--LIPMHGRV 390
                         A  ++ ++  S  +  +  P A  +IP HG  
Sbjct: 167 CAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLP 212

PyMOL of d1ko3a_

>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 254	Back information, alignment and structure

>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Length = 266	Back information, alignment and structure

>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Length = 221	Back information, alignment and structure

>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Length = 262	Back information, alignment and structure

>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Length = 298	Back information, alignment and structure

>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Length = 220	Back information, alignment and structure

>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Length = 264	Back information, alignment and structure

>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Length = 249	Back information, alignment and structure

>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Length = 200	Back information, alignment and structure

>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Length = 228	Back information, alignment and structure

>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 250	Back information, alignment and structure

>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Length = 251	Back information, alignment and structure

>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Length = 249	Back information, alignment and structure

>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Length = 219	Back information, alignment and structure

>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Length = 505	Back information, alignment and structure

>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Length = 230	Back information, alignment and structure

>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Length = 207	Back information, alignment and structure

>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 260	Back information, alignment and structure

>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Length = 431	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		522
d2cfua2		505	Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI	99.97
d2q0ia1		298	Quinolone signal response protein PqsE {Pseudomona	99.96
d1mqoa_		221	Zn metallo-beta-lactamase {Bacillus cereus [TaxId:	99.96
d1x8ha_		228	Zn metallo-beta-lactamase {Aeromonas hydrophila, C	99.95
d1m2xa_		219	Zn metallo-beta-lactamase {Chryseobacterium mening	99.95
d1xm8a_		254	Glyoxalase II (hydroxyacylglutathione hydrolase) {	99.95
d1ycga2		249	Nitric oxide reductase N-terminal domain {Moorella	99.95
d1e5da2		249	Rubredoxin oxygen:oxidoreductase (ROO), N-terminal	99.95
d1jjta_		220	Zn metallo-beta-lactamase {Pseudomonas aeruginosa,	99.94
d1znba_		230	Zn metallo-beta-lactamase {Bacteroides fragilis [T	99.94
d1ko3a_		230	Zn metallo-beta-lactamase {Pseudomonas aeruginosa,	99.94
d1k07a_		262	Zn metallo-beta-lactamase {Fluoribacter gormanii,	99.94
d2qeda1		251	Glyoxalase II (hydroxyacylglutathione hydrolase) {	99.93
d2gmna1		264	Zn metallo-beta-lactamase {Bradyrhizobium japonicu	99.93
d2aioa1		266	Zn metallo-beta-lactamase {Xanthomonas maltophilia	99.93
d1qh5a_		260	Glyoxalase II (hydroxyacylglutathione hydrolase) {	99.91
d2p97a1		200	Hypothetical protein Ava3068 {Anabaena variabilis	99.9
d1vmea2		250	ROO-like flavoprotein TM0755, N-terminal domain {T	99.9
d1ztca1		207	Hypothetical protein TM0894 {Thermotoga maritima [	99.78
d1p9ea_		294	Methyl parathion hydrolase {Pseudomonas sp. WBC-3	99.76
d2dkfa1		431	Putative RNA-degradation protein TTHA0252 {Thermus	99.34
d2az4a1		183	Hypothetical protein EF2904 {Enterococcus faecalis	99.31
d1zkpa1		244	Hypothetical protein BA1088 (BAS1016) {Bacillus an	99.3
d2i7xa1		514	Cleavage factor two protein 2, CFT2 {Baker's yeast	99.22
d2i7ta1		451	Cleavage and polyadenylation specificity factor su	99.02
d1wraa1		305	Teichoic acid phosphorylcholine esterase Pce (LytD	98.84
d2cbna1		305	Ribonuclease Z (RNase Z) {Escherichia coli [TaxId:	98.72
d1y44a1		307	Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId	98.61
d1xtoa_		304	Coenzyme PQQ synthesis protein B, PqqB {Pseudomona	98.23
d2e7ya1		280	Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax	98.12
d1vjna_		209	Hypothetical protein TM0207 {Thermotoga maritima [	97.96
d1puna_		129	Nucleoside triphosphate pyrophosphorylase (MutT) {	97.86
d1sjya_		158	Hypothetical protein DR1025 {Deinococcus radiodura	97.65
d1v8ya_		158	ADP-ribose pyrophosphatase {Thermus thermophilus [	97.6
d2o5fa1		162	Hypothetical protein DR0079 {Deinococcus radiodura	97.6
d1vcda1		126	AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId:	97.55
d2fkba1		161	Hypothetical protein YfcD {Escherichia coli [TaxId	97.55
d2b0va1		146	Hypothetical protein NE0184 {Nitrosomonas europaea	97.55
d1ktga_		137	Diadenosine tetraphosphate hydrolase (Ap4A hydrola	97.51
d1ryaa_		160	GDP-mannose mannosyl hydrolase NudD {Escherichia c	97.47
d2b06a1		155	Hypothetical protein SP1235 (spr1115) {Streptococc	97.36
d1xsba_		153	Diadenosine tetraphosphate hydrolase (Ap4A hydrola	97.16
d2fvva1		135	Diphosphoinositol polyphosphate phosphohydrolase {	97.14
d1jkna_		165	Diadenosine tetraphosphate hydrolase (Ap4A hydrola	97.11
d1irya_		156	7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum	97.08
d1hzta_		153	Isopentenyl diphosphate isomerase {Escherichia col	97.0
d2fmla2		202	Hypothetical protein EF2700, N-terminal domain {En	96.92
d1x51a1		142	A/G-specific adenine DNA glycosylase {Human (Homo	96.61
d2a6ta2		151	mRNA decapping enzyme Dcp2p catalytic domain {Schi	96.59
d2azwa1		147	Hypothetical protein EF1141 {Enterococcus faecalis	96.44
d1k2ea_		152	Hypothetical protein PAE3301 {Archaeon Pyrobaculum	96.35
d1rrqa2		127	Adenine glycosylase MutY, C-terminal domain {Bacil	96.18
d2fb1a2		147	Hypothetical protein BT0354, N-terminal domain {Ba	96.16
d1g0sa_		209	ADP-ribose pyrophosphatase {Escherichia coli [TaxI	96.15
d1vk6a2		131	NADH pyrophosphatase {Escherichia coli [TaxId: 562	95.94
d1vhza_		186	ADP compounds hydrolase NudE {Escherichia coli [Ta	95.73
d1mqea_		202	ADP-ribose pyrophosphatase {Mycobacterium tubercul	95.66
d1nqza_		187	Coenzyme A pyrophosphatase {Deinococcus radioduran	95.4
d1viua_		189	ADP-ribose pyrophosphatase homologue YffH {Escheri	94.67
d1q33a_		292	NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {	93.69

>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Alkylsulfatase-like
domain: Alkylsulfatase SdsA1
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.97  E-value=9.7e-32  Score=287.22  Aligned_cols=337  Identities=14%  Similarity=0.112  Sum_probs=234.0

Q ss_pred             EEEEEeEcCCC-CCCcccccccccHHHHHHHHHh-cCCCCCccchhhhhhhccccccccccCCCCCccceecCCeEEEEe
Q 009940          118 TVYIMGKLLDG-NQILQEGCKWMSTQSCINCLAE-VKPSTDRVGPLVVIGLLNDLVQWRKWKVPPTLSYQEYPPGVILVP  195 (522)
Q Consensus       118 T~ff~a~~p~~-~~~e~~~~~W~~~~~al~~l~~-~~~~~~r~g~~~~~gl~~~~~~~~~~~~~~~~~~~evapGv~~v~  195 (522)
                      .|.|+|.++++ -.++.....|-.  .+++.|.+ ..|.+.+      ++|+..+....   ..   -..||+||||++.
T Consensus        34 ~~g~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~v~------p~l~r~~~~~~---~~---gl~eV~dgVy~~r   99 (505)
T d2cfua2          34 DRGLIRRPERLLIRNPDGSVAWQL--GGYDFLLDGKPRDSIN------PSLQRQALLNL---KY---GLFEVAEGIYQVR   99 (505)
T ss_dssp             HTTEEECCSSCEEECTTSCEEEEC--GGGGGGTTCCCCTTSC------HHHHHHHHHTT---CC---EEEEEETTEEEEE
T ss_pred             hCCCcccCCcceeeCCCCCEeech--hhhHHhccCCCCCCcC------HHHHHHHHHhc---cC---CeEEEeCCEEEEE
Confidence            35688888776 223445567763  44555543 4566777      88888554333   22   3579999999993


Q ss_pred             ccCCCCCCCccccEEEEccCCCCCCCcceEEEecCCeEEEcCCCCChHHHHHHHHH-HhCC--CccEEEEcCCCccccCC
Q 009940          196 MQSRTAKPFLTTNLIVFAPDSVSDDCGNHRFVAQGEALIVDPGCRSEFHEELLKVV-ASLP--RKLIVFVTHHHRDHVDG  272 (522)
Q Consensus       196 ~~~~~~~p~~~~N~~~i~~~~~~~g~~~~~~l~~g~~iLIDtG~~~~~~~~L~~~~-~~~~--~i~~IiiTH~H~DHiGG  272 (522)
                             ++...|+++|.++              ++.||||||.+.+..+...+.. +.++  .|++||+||+|+||+||
T Consensus       100 -------G~~~sN~~~I~gd--------------dG~iVIDtg~s~e~a~~~l~~~~~~l~~kPV~aVI~TH~H~DH~GG  158 (505)
T d2cfua2         100 -------GFDLANITFIRGD--------------SGWIVVDTLTTPATARAAYELVSRELGERPIRTVIYSHAHADHFGG  158 (505)
T ss_dssp             -------SSSSSCEEEEECS--------------SSEEEECCCSSHHHHHHHHHHHHHHHCCCCEEEEECSBSCHHHHTT
T ss_pred             -------ecCccceeEEEcC--------------CEEEEEECCCCHHHHHHHHHHHHHhcCCCCeEEEEeCCCCcchhhh
Confidence                   5666788888875              5699999999877655544444 4454  35699999999999999


Q ss_pred             HHHHHH----hCCCCEEEEcHhHHHHhccCC------------------------------------------CCCCcee
Q 009940          273 LSIIQK----CNPDAILLAHENTMRRIGKDD------------------------------------------WSLGYTS  306 (522)
Q Consensus       273 ~~~l~~----~~p~a~V~a~~~~~~~l~~~~------------------------------------------~~~~~~~  306 (522)
                      +..|.+    ....++|++++...+.+...+                                          .+.....
T Consensus       159 a~~~~e~~~~~~~~~~IiA~~~~~~~~~~~~~~~~~~~~rr~~~q~g~~L~~~~~~~~~~~lg~~~~~g~~~~~~p~~~~  238 (505)
T d2cfua2         159 VRGLVEPQQVASGAVQIIAPAGFMEAAIKENVLAGNAMMRRATYQYGTQLPKGPQGQVDMAIGKGLARGPLSLLAPTRLI  238 (505)
T ss_dssp             GGGTCCHHHHHTTSSEEEEETTHHHHHC---CTTHHHHHHHHHHHTTTTSCBSTTSBCCCSSSSCCCCSCCCCCCCSEEE
T ss_pred             HHHHhhhhhhccCCceEEechHHHHHHHhhchhhhHHHHHHHHHHHHhhccccchhccccccccccCcCCcccCCCCeEE
Confidence            999864    245789999977654432110                                          0011233


Q ss_pred             cCCCceEEECCEEEEEEeCCC-CCCCCeEEEeCCCCEEEEcccccCCCCcccc--cCCCCCHHHHHHHHHHHh---cCCC
Q 009940          307 VSGSEDICVGGQRLTVVFSPG-HTDGHVALLHASTNSLIVGDHCVGQGSAVLD--ITAGGNMTDYFQSTYKFL---ELSP  380 (522)
Q Consensus       307 l~~g~~l~lgg~~l~vi~tPG-HT~g~i~l~~~~~~vLftGD~l~~~~~~~~~--~~~~~~~~~~~~SL~~l~---~l~~  380 (522)
                      ..+++.+.+||.+++++++|| ||+||+++|+|+.++||+||+++........  .....+...|.++|++++   .+++
T Consensus       239 ~~~~~~l~igG~~ie~i~tpG~HTp~~l~~y~Pe~kvL~sGD~v~~~~~n~~t~rg~~~rd~~~w~~~L~~l~~l~~~~~  318 (505)
T d2cfua2         239 EGEGEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTLHNLYTLRGAEVRDALGWSKYINQALHRFGRQA  318 (505)
T ss_dssp             CTTEEEEEETTEEEEEEECTTSSSSSBEEEEETTTTEEECTTTSCSSCCCSSCTTCCCCCCHHHHHHHHHHHHHHTGGGC
T ss_pred             eccceEEeeCcEEEEEEECCCCCCccceEEEecCCCEEEEeccccccCcCccCCcCCCcccchhHHHHHHHHHHHhCCCC
Confidence            456778999999999999998 9999999999999999999998754322221  123456667777776554   5689


Q ss_pred             cEEEcCCCCCcCChHHHHHHHHHHHHHH----HHHHHHHHHcCCCCHHHHHHHHhcCCCCcchhHHHHHHHHHHHHHHHC
Q 009940          381 HALIPMHGRVNLWPKHMLCGYLKNRRAR----EAAILQAIENGVETLFDIVANVYSEVPRSFWIPAASNVRLHVDHLADQ  456 (522)
Q Consensus       381 ~~ivPgHG~~~~~~~~~i~~~l~~~~~r----~~~il~~l~~g~~T~~ei~~~~y~~~~~~~~~~a~~~v~ahL~~L~~~  456 (522)
                      ++++||||+|+.+ .+.+.+++..+++.    .+++++.+.+|. |++||+..+  .+|+                    
T Consensus       319 evlvpgHg~Pi~G-~~~I~~~L~~~rD~~~~i~Dqt~~~~N~G~-t~~Ei~~~i--~lP~--------------------  374 (505)
T d2cfua2         319 EVMFAVHNWPRWG-NAEIVEVLEKQRDLYGYLHDQTLHLANQGV-TIGQVHNRL--RLPP--------------------  374 (505)
T ss_dssp             SEEECSSSCCEES-HHHHHHHHHHHHHHHHHHHHHHHHHHTTTC-CTTTGGGTC--CCCH--------------------
T ss_pred             cEEecCCCccccc-chHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CHHHHHHHh--cCCh--------------------
Confidence            9999999999865 45566666555554    456677777765 888888775  2332                    


Q ss_pred             CCccceeccch--hhhccchhhHHHHHH-HhhhhhhhhhhccchhHHHhHHh----hhchhHHHHHHhh
Q 009940          457 NKLPKEFSILK--FRKTCGLHFLLRWAW-TYLRFQVRYQKLSMSKLLIGGAA----VAGFAVFFSIRNK  518 (522)
Q Consensus       457 g~i~~~~~~~~--~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~  518 (522)
                           .+....  ...+-.+.+.+|-+| .|.+|+++++....|..-...+.    |+||+-.+..+++
T Consensus       375 -----~l~~~~~~~~~Yg~~~~~vr~iy~~y~GW~dgnp~~L~p~~~~~~a~~~v~~~GG~~~~~~~a~  438 (505)
T d2cfua2         375 -----SLDQEWYDRGYHGSVSHNARAVLNRYLGYYDGNPATLDPLSPEDSAGRYVEYMGGAERLLEQAR  438 (505)
T ss_dssp             -----HHHTCGGGSCSSSCHHHHHHHHHHHHHCSCCSCGGGTSCCCHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             -----hHhhCcccccccccHHHHHHHHHHHhcCcccCCccccCCCCHHHHHHHHHHHcCCHHHHHHHHH
Confidence                 211111  122455688999998 99999999999877766665554    8899888777764

PyMOL of d2cfua2

>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]}	Back information, alignment and structure

>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]}	Back information, alignment and structure

>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]}	Back information, alignment and structure

>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}	Back information, alignment and structure

>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]}	Back information, alignment and structure

>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]}	Back information, alignment and structure

>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]}	Back information, alignment and structure

>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]}	Back information, alignment and structure

>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}	Back information, alignment and structure

>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]}	Back information, alignment and structure

>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]}	Back information, alignment and structure

>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]}	Back information, alignment and structure

>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]}	Back information, alignment and structure

>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]}	Back information, alignment and structure

>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure