Citrus Sinensis ID: 010064


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MAKIHQNNVRSLILERNDGPTSAADGHHHFRLWTAFSGAAFRRKIFDAVSCGGSSRYGREILDDEGISLPTPKAKTEMESRGVDSEKGNGRKPEKQKEAKGCVSKSEKLLDLLNLAEGEAASEIKKKEEALEELKIVVKDLQSESEEQRREAASKVRSLAKENSETRVTLAMLGAIPPLAGMLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSNKPIIGSSGAVPFLVKTLKNSDKKVSPQAKQDALRALYNLSIFPSNISFILETDLIRYLLEMLGDMELSERILSILSNLVSTPEGRKAISRVPDAFPILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRILECLRVDKGKQVSGTYGGNLVAAAAVSAPICGSSSSTSTNPNGVAKECLEEEEDMMSEEKKAVKQLVQQSLQNNMKRIVKRANLPQDFVPSEHFKSLTTSSTSKSLPF
cccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
cccccccccccEEEEccccccccccccccEEEccHHHHHHHHHHHHHHHcccccccHHcccccccccccccccccccccccccccHHHHHHcccHHHHHcccccccccccccccccccHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHcHcccHHEcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHcHHccHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHccccccccHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHEEEccccccccc
MAKIHQNNVRSLIlerndgptsaadghhhFRLWTAFSGAAFRRKIFDAvscggssrygreilddegislptpkaktemesrgvdsekgngrkpekqkeakgcvsksEKLLDLLNLAEGEAASEIKKKEEALEELKIVVKDLQSESEEQRREAASKVRSLAKENSETRVTLAMLgaipplagmldfqlaDSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLiespvapnpsvsEAIVANFLglsaldsnkpiigssgavPFLVKTLknsdkkvspQAKQDALRALYnlsifpsnisfILETDLIRYLLEMLGDMELSERILSILSNlvstpegrkaisrvpdafPILVDVlnwtdspgcqekASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRILECLrvdkgkqvsgtygGNLVAAAAvsapicgsssststnpngvakeCLEEEEDMMSEEKKAVKQLVQQSLQNNMKRIVKranlpqdfvpsehfkslttsstskslpf
MAKIHQNNVRSLILERNDGPTSAADGHHHFRLWTAFSGAAFRRKIFDAVscggssrygreilddegislptpkaktemesrgvdsekgngrkpekqkeakgcvsksekLLDLLNLAEGEAASEIKKKEEALEELKIVVkdlqseseeqrREAASkvrslakensetrVTLAMLGAIPPLAGMLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSNKPIIGSSGAVPFLVKTLKNSDKKVSPQAKQDALRALYNLSIFPSNISFILETDLIRYLLEMLGDMELSERILSILSnlvstpegrkAISRVPDAFPILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRILECLRVDKGKQVSGTYGGNLVAAAAVSAPICgsssststnpngvAKECLEEEEDMMSEEKKAVKQLVQQSLQNNMKRIVKRANLpqdfvpsehfkslttsstskslpf
MAKIHQNNVRSLILERNDGPTSAADGHHHFRLWTAFSGAAFRRKIFDAVSCGGSSRYGREILDDEGISLPTPKAKTEMESRGVDSEKGNGRKPEKQKEAKGCVSKSEKLLDLLNLaegeaaseikkkeealeelkiVVKDLqseseeqrreaasKVRSLAKENSETRVTLAMLGAIPPLAGMLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSNKPIIGSSGAVPFLVKTLKNSDKKVSPQAKQDALRALYNLSIFPSNISFILETDLIRYLLEMLGDMELSERILSILSNLVSTPEGRKAISRVPDAFPILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIasalleltllgstlaQKRASRILECLRVDKGKQVSGTYGGNLVAAAAVSAPICGsssststNPNGVAkecleeeedmmseekkAVKQLVQQSLQNNMKRIVKRANLPQDFVPSEHFkslttsstskslPF
*************************GHHHFRLWTAFSGAAFRRKIFDAVSCGGSSRYGREI***********************************************************************************************************TLAMLGAIPPLAGML************YALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSNKPIIGSSGAVPFLVKTL**************ALRALYNLSIFPSNISFILETDLIRYLLEMLGDMELSERILSILSNLVSTPEGRKAISRVPDAFPILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRILECLRVDKGKQVSGTYGGNLVAAAAVSAPIC*****************************************************************************
**********************************************************************************************************************************LEELKIVVKDLQSESEEQRREAASKVRSLAKENSETRVTLAMLGAIPPLAGMLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSNKPIIGSSGAVPFLVKTLKNSDKKVSPQAKQDALRALYNLSIFPSNISFILETDLIRYLLEMLGDMELSERILSILSNLVSTPEGRKAISRVPDAFPILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRILECL*************************************NGVA****************************************QDFVPS*****************
MAKIHQNNVRSLILERNDGPTSAADGHHHFRLWTAFSGAAFRRKIFDAVSCGGSSRYGREILDDEGISLPTPKA******************************KSEKLLDLLNLAEGEAASEIKKKEEALEELKIVVKDLQ*********************SETRVTLAMLGAIPPLAGMLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSNKPIIGSSGAVPFLVKTLK***********QDALRALYNLSIFPSNISFILETDLIRYLLEMLGDMELSERILSILSNLVSTPEGRKAISRVPDAFPILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRILECLRVDKGKQVSGTYGGNLVAAAAVSA**************GVAKECLE*************KQLVQQSLQNNMKRIVKRANLPQDFVPSEHF**************
***I*QNNVRS*I***N*********HHHFRLWTAFSGAAFRRKIFDAVSCGGSSR**RE*L****ISLPTPKA*TEMESRGVDSEKGNGRKPEKQKEAKG*************************KEEALEELKIVVKDLQSESEEQRREAASKVRSLAKENSETRVTLAMLGAIPPLAGMLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSNKPIIGSSGAVPFLVKTLKNSDKKVSPQAKQDALRALYNLSIFPSNISFILETDLIRYLLEMLGDMELSERILSILSNLVSTPEGRKAISRVPDAFPILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRILECLRVDKGKQVS***GG**V*A*AV********SSTSTNPNGVAKECLEEEEDMMSEEKKAVKQLVQQSLQNNMKRIVKRANLPQDFVPSEHFKSLTT*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKIHQNNVRSLILERNDGPTSAADGHHHFRLWTAFSGAAFRRKIFDAVSCGGSSRYGREILDDEGISLPTPKAKTEMESRGVDSEKGNGRKPEKQKEAKGCVSKSEKLLDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAASKVRSLAKENSETRVTLAMLGAIPPLAGMLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSNKPIIGSSGAVPFLVKTLKNSDKKVSPQAKQDALRALYNLSIFPSNISFILETDLIRYLLEMLGDMELSERILSILSNLVSTPEGRKAISRVPDAFPILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRILECLRVDKGKQVSGTYGGNLVAAAAVSAPICGSSSSTSTNPNGVAxxxxxxxxxxxxxxxxxxxxxxxxSLQNNMKRIVKRANLPQDFVPSEHFKSLTTSSTSKSLPF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query519 2.2.26 [Sep-21-2011]
Q5VRH9611 U-box domain-containing p no no 0.512 0.435 0.334 1e-28
O22193826 U-box domain-containing p no no 0.535 0.336 0.318 2e-28
Q8GUG9612 U-box domain-containing p no no 0.520 0.441 0.321 2e-27
Q9SNC6660 U-box domain-containing p no no 0.489 0.384 0.360 4e-27
Q8GWV5760 U-box domain-containing p no no 0.522 0.356 0.320 1e-25
Q9C9A6628 U-box domain-containing p no no 0.518 0.428 0.343 2e-25
Q9ZV31654 U-box domain-containing p no no 0.524 0.415 0.336 5e-25
Q9CAG5782 U-box domain-containing p no no 0.524 0.347 0.295 2e-24
Q5XEZ8707 U-box domain-containing p no no 0.535 0.393 0.295 6e-24
O48700771 U-box domain-containing p no no 0.666 0.448 0.278 6e-24
>sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 Back     alignment and function desciption
 Score =  128 bits (321), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 93/278 (33%), Positives = 155/278 (55%), Gaps = 12/278 (4%)

Query: 141 LQSESEEQRREAASKVRSLAKENSETRVTLAMLGAIPPLAGMLDFQLADSQISSLYALLN 200
           L+S +++++R AA ++R LAK N   R+ +A  GAIP L  +L      +Q  ++ ALLN
Sbjct: 332 LRSGNQDEQRAAAGEIRLLAKRNVNNRICIAEAGAIPLLVNLLSSSDPRTQEHAVTALLN 391

Query: 201 LGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSNKPIIGSSG 260
           L I  + NKA+IV + A+ K+++++++         E   A    LS +D NK  IG++G
Sbjct: 392 LSIHEN-NKASIVDSHAIPKIVEVLKTGSM---ETRENAAATLFSLSVVDENKVTIGAAG 447

Query: 261 AVPFLVKTLKNSDKKVSPQAKQDALRALYNLSIFPSNISFILETDLIRYLLEMLGDME-- 318
           A+P L+  L +     SP+ K+DA  A++NL I+  N    ++  ++ +L+  L D    
Sbjct: 448 AIPPLINLLCDG----SPRGKKDAATAIFNLCIYQGNKVRAVKAGIVIHLMNFLVDPTGG 503

Query: 319 LSERILSILSNLVSTPEGRKAISRVPDAFPILVDVLNWTDSPGCQEKASYVLMVMAHKSY 378
           + +  LS+LS L   PEG+  I+R  +  P LV+V+  T SP  +E A+ +L ++     
Sbjct: 504 MIDEALSLLSILAGNPEGKIVIARS-EPIPPLVEVIK-TGSPRNRENAAAILWLLCSADT 561

Query: 379 GDRQAMIEAGIASALLELTLLGSTLAQKRASRILECLR 416
               A   AG+  AL EL+  G+  A+++AS ILE + 
Sbjct: 562 EQTLAAKAAGVEDALKELSETGTDRAKRKASSILELMH 599




Possesses E3 ubiquitin-protein ligase in vitro.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 Back     alignment and function description
>sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2 Back     alignment and function description
>sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 Back     alignment and function description
>sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabidopsis thaliana GN=PUB3 PE=2 SV=2 Back     alignment and function description
>sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAG5|PUB7_ARATH U-box domain-containing protein 7 OS=Arabidopsis thaliana GN=PUB7 PE=2 SV=1 Back     alignment and function description
>sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 Back     alignment and function description
>sp|O48700|PUB6_ARATH U-box domain-containing protein 6 OS=Arabidopsis thaliana GN=PUB6 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query519
255548766510 ubiquitin-protein ligase, putative [Rici 0.963 0.980 0.717 0.0
224089352492 predicted protein [Populus trichocarpa] 0.947 1.0 0.714 0.0
297798774517 armadillo/beta-catenin repeat family pro 0.961 0.965 0.675 0.0
15236577518 armadillo/beta-catenin-like repeat-conta 0.959 0.961 0.664 1e-179
449493326506 PREDICTED: U-box domain-containing prote 0.961 0.986 0.665 1e-172
449521862502 PREDICTED: U-box domain-containing prote 0.965 0.998 0.651 1e-172
449455533502 PREDICTED: U-box domain-containing prote 0.965 0.998 0.648 1e-171
357466041495 U-box domain-containing protein [Medicag 0.947 0.993 0.651 1e-170
225430354497 PREDICTED: U-box domain-containing prote 0.944 0.985 0.678 1e-163
356507311482 PREDICTED: U-box domain-containing prote 0.903 0.973 0.618 1e-158
>gi|255548766|ref|XP_002515439.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223545383|gb|EEF46888.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/514 (71%), Positives = 411/514 (79%), Gaps = 14/514 (2%)

Query: 7   NNVRSLILERNDGPTSAADGHHHFRLWTAFSGAAFRRKIFDAVSCGGSSRYGREILDDEG 66
           NN+ SLIL  ND  + A+    HFRLWT+    +FRRKIFDAVSCGGSSRY     +D+ 
Sbjct: 10  NNIGSLIL--NDRHSPASTTSRHFRLWTS----SFRRKIFDAVSCGGSSRYRHH--EDDF 61

Query: 67  ISLPTPKAKTEMESRGVDSEKGNGRKPEKQKEAKGCVSKSEKLLDLLNLAEGEAASEIKK 126
            S  T    T   +    +        EK +  K    KSEKL DLL++AE E+  E +K
Sbjct: 62  ASTTTAATATTATATATTTATTTTNAIEKTRRMKN--GKSEKLSDLLSVAEAESEIETRK 119

Query: 127 KEEALEELKIVVKDLQSESEEQRRE-AASKVRSLAKENSETRVTLAMLGAIPPLAGMLDF 185
           K E LEELK +VK+LQ E++ +R+E AAS+VR LAKE+S  RVTLA+LGAIPPL  M+DF
Sbjct: 120 KVEELEELKSLVKELQIENDSKRKEEAASRVRLLAKEDSGVRVTLALLGAIPPLVAMIDF 179

Query: 186 QLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLG 245
             AD QI+SLYALLNL I ND NKAAIVKAGAVHKMLK+IE P  P PSVSEAIVANFLG
Sbjct: 180 DNADLQIASLYALLNLAIANDANKAAIVKAGAVHKMLKIIELPYPPKPSVSEAIVANFLG 239

Query: 246 LSALDSNKPIIGSSGAVPFLVKTLKNSDKKVSPQAKQDALRALYNLSIFPSNISFILETD 305
           LSALDSNKPIIGSSGA+PFLV TL++ D K S QAKQDA+RALYNLSIF SN+SFI+E +
Sbjct: 240 LSALDSNKPIIGSSGAIPFLVNTLRDLDHKCSIQAKQDAVRALYNLSIFSSNVSFIVEAN 299

Query: 306 LIRYLLEMLGDMELSERILSILSNLVSTPEGRKAISRVPDAFPILVDVLNWTDSPGCQEK 365
           LI +L+  LGDME+SERILSILSNLVSTPEGRKAIS + DAF IL+DVLNWTDSPGCQEK
Sbjct: 300 LIPFLMNTLGDMEVSERILSILSNLVSTPEGRKAISTMRDAFTILIDVLNWTDSPGCQEK 359

Query: 366 ASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRILECLRVDKGKQVSG 425
           ASY+LMVMAHK+YGDRQAMIEAGI SALLELTLLGSTLAQKRASRILECLRVDKGKQ+S 
Sbjct: 360 ASYILMVMAHKAYGDRQAMIEAGIVSALLELTLLGSTLAQKRASRILECLRVDKGKQISD 419

Query: 426 TYGGNLVAAAAVSAPICGSSSSTSTNPNGVAKECLEEEEDMMSEEKKAVKQLVQQSLQNN 485
            YGGNL   AAVSAPI GSSSS S NPNGV+KE LEE ED MSEEKKAVKQLVQQSLQ N
Sbjct: 420 HYGGNL--GAAVSAPIYGSSSS-SANPNGVSKEFLEEAEDTMSEEKKAVKQLVQQSLQTN 476

Query: 486 MKRIVKRANLPQDFVPSEHFKSLTTSSTSKSLPF 519
           M RIVKRANLPQDFVPSEHFKSLT SSTSKSLPF
Sbjct: 477 MMRIVKRANLPQDFVPSEHFKSLTASSTSKSLPF 510




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224089352|ref|XP_002308701.1| predicted protein [Populus trichocarpa] gi|222854677|gb|EEE92224.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297798774|ref|XP_002867271.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297313107|gb|EFH43530.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15236577|ref|NP_194917.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|334187073|ref|NP_001190883.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|4584528|emb|CAB40759.1| putative protein [Arabidopsis thaliana] gi|7270092|emb|CAB79907.1| putative protein [Arabidopsis thaliana] gi|110736926|dbj|BAF00420.1| hypothetical protein [Arabidopsis thaliana] gi|190341119|gb|ACE74718.1| At4g31890 [Arabidopsis thaliana] gi|332660574|gb|AEE85974.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|332660575|gb|AEE85975.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449493326|ref|XP_004159256.1| PREDICTED: U-box domain-containing protein 12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449521862|ref|XP_004167948.1| PREDICTED: U-box domain-containing protein 7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449455533|ref|XP_004145507.1| PREDICTED: U-box domain-containing protein 7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357466041|ref|XP_003603305.1| U-box domain-containing protein [Medicago truncatula] gi|355492353|gb|AES73556.1| U-box domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225430354|ref|XP_002285290.1| PREDICTED: U-box domain-containing protein 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356507311|ref|XP_003522411.1| PREDICTED: U-box domain-containing protein 13-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query519
TAIR|locus:2116792518 AT4G31890 "AT4G31890" [Arabido 0.971 0.972 0.570 1.3e-137
TAIR|locus:2040214468 AT2G25130 [Arabidopsis thalian 0.709 0.786 0.595 4.7e-116
TAIR|locus:2038598438 AT2G27430 "AT2G27430" [Arabido 0.518 0.614 0.309 5.6e-34
TAIR|locus:2045334829 PUB4 "plant U-box 4" [Arabidop 0.445 0.278 0.322 1e-23
TAIR|locus:2099634408 AT3G03440 "AT3G03440" [Arabido 0.481 0.612 0.324 1.4e-23
UNIPROTKB|Q5VRH9611 PUB12 "U-box domain-containing 0.483 0.410 0.311 2.1e-23
TAIR|locus:2075140660 PUB13 "plant U-box 13" [Arabid 0.473 0.372 0.344 2.6e-23
TAIR|locus:2162276660 PUB15 "Plant U-Box 15" [Arabid 0.495 0.389 0.306 4.2e-22
TAIR|locus:2102455760 AT3G54790 [Arabidopsis thalian 0.695 0.475 0.260 1.3e-21
TAIR|locus:2082682632 PUB14 "plant U-box 14" [Arabid 0.500 0.411 0.294 1.5e-21
TAIR|locus:2116792 AT4G31890 "AT4G31890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1347 (479.2 bits), Expect = 1.3e-137, P = 1.3e-137
 Identities = 304/533 (57%), Positives = 351/533 (65%)

Query:     1 MAKIHQNNVRSLILERNDGPTSAADGHHHFRLWTAFSGAAFRRKIFDAVSCGGSSRYGRE 60
             MAK H+NN+ SLIL+R    +S++   +HFRLW+ FS + FRRKI DAVSCGGSSRY  E
Sbjct:     1 MAKCHRNNIGSLILDRAPSTSSSSTSGYHFRLWSTFSRSTFRRKIVDAVSCGGSSRYRHE 60

Query:    61 IL--DDEGISLPTPKAKTEMESRGVDSEKGNGRKPEKQKEAKGCVSKSEKLLDLLNLXXX 118
             +   DDEG S  T  AK+ + S   D++             +    KSEKL DLLNL   
Sbjct:    61 LREEDDEG-SYVTVTAKSTVAS-SKDAKANTIGAALNGVAFEETSKKSEKLCDLLNLAEV 118

Query:   119 XXXXXXXXXXXXXXXXXXVVKDLXXXXXXXXX-----------XXXXKVRSLAKENSETR 167
                               VV++L                        +VR LAKE+SE R
Sbjct:   119 EADVETMKKEEALEVLKRVVRELQSAAAAREDNDDGGDCRKKITAASEVRLLAKEDSEAR 178

Query:   168 VTLAMLGAIPPLAGMLD-FQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIE 226
             VTLAMLGAIPPL  M+D  ++ D+QI+SLYALLNLGIGND NKAAIVKAGAVHKMLKLIE
Sbjct:   179 VTLAMLGAIPPLVSMIDDSRIVDAQIASLYALLNLGIGNDANKAAIVKAGAVHKMLKLIE 238

Query:   227 SPVAPNPSVSEAIVANFLGLSALDSNKPIIGSSGAVPFLVKTLKNSDKKVSPQAKQDALR 286
             SP  P+  ++EA+VANFLGLSALDSNKPIIGSSGA+ FLVKTL+N D+  S QA++DALR
Sbjct:   239 SPNTPDQEIAEAVVANFLGLSALDSNKPIIGSSGAIIFLVKTLQNLDETSSSQAREDALR 298

Query:   287 ALYNLSIFPSNISFILETDLIRYLLEMLGDMELSERILSILSNLVSTPEGRKAISRVPDA 346
             ALYNLSI+  N+SFILETDLI YLL  LGDME+SERIL+ILSNLV+ PEGRKAI  V DA
Sbjct:   299 ALYNLSIYQPNVSFILETDLITYLLNTLGDMEVSERILAILSNLVAVPEGRKAIGLVCDA 358

Query:   347 FPILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIXXXXXXXXXXXXXXXQK 406
             FP+LVDVLNWTDSPGCQEKA+Y+LM+MAHK YGDRQ MIEAGI               QK
Sbjct:   359 FPVLVDVLNWTDSPGCQEKATYILMLMAHKGYGDRQVMIEAGIESALLELTLLGSALAQK 418

Query:   407 RASRILECLRVDKGKQVSGTYGGNLVAAAAVSAPICGXXXXXXXNPNGVAXXXXXXXXXX 466
             RASRILECLRVDKGKQV  + G    +  A+SAPI G         NG+           
Sbjct:   419 RASRILECLRVDKGKQVLDSTG----SCGALSAPIYGT------RDNGL---DHEENDLM 465

Query:   467 XXXXXXAVKQLVQQSLQNNMKRIVKRANLPQDFVPSEHFXXXXXXXXXXXXPF 519
                   AVKQLVQQSLQ+NMKRIVKRANLPQDFVPSEHF            PF
Sbjct:   466 MSEERKAVKQLVQQSLQSNMKRIVKRANLPQDFVPSEHFKSLSLSSTSKSLPF 518




GO:0008150 "biological_process" evidence=ND
TAIR|locus:2040214 AT2G25130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038598 AT2G27430 "AT2G27430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045334 PUB4 "plant U-box 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099634 AT3G03440 "AT3G03440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRH9 PUB12 "U-box domain-containing protein 12" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2075140 PUB13 "plant U-box 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162276 PUB15 "Plant U-Box 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102455 AT3G54790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082682 PUB14 "plant U-box 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_LG_VI0817
SubName- Full=Putative uncharacterized protein; (493 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query519
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-08
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 4e-08
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 9e-06
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.004
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
 Score = 51.9 bits (125), Expect = 3e-08
 Identities = 37/121 (30%), Positives = 64/121 (52%), Gaps = 10/121 (8%)

Query: 174 GAIPPLAGMLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNP 233
           G +P L  +L     + Q  + +AL NL  GN+ N  A+V+AG +  +++L++S    + 
Sbjct: 7   GGLPALVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKS---EDE 63

Query: 234 SVSEAIVANFLGLSALDS--NKPIIGSSGAVPFLVKTLKNSDKKVSPQAKQDALRALYNL 291
            V +A +   L   A     NK I+  +G VP LV  L +S++ +    +++A  AL NL
Sbjct: 64  EVVKAALW-ALRNLAAGPEDNKLIVLEAGGVPKLVNLLDSSNEDI----QKNATGALSNL 118

Query: 292 S 292
           +
Sbjct: 119 A 119


An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120

>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 519
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.97
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.97
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.96
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.96
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.96
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.96
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.96
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.93
PF05804708 KAP: Kinesin-associated protein (KAP) 99.92
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.86
PF05804708 KAP: Kinesin-associated protein (KAP) 99.83
KOG1048717 consensus Neural adherens junction protein Plakoph 99.78
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.76
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.69
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.67
KOG1048717 consensus Neural adherens junction protein Plakoph 99.64
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.53
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.51
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.51
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.43
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.34
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.31
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.29
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.26
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.22
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 99.2
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.19
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 99.14
PRK09687280 putative lyase; Provisional 99.09
PRK09687280 putative lyase; Provisional 99.04
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.01
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.94
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.86
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.77
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.7
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.69
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.68
KOG1293678 consensus Proteins containing armadillo/beta-caten 98.66
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.6
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.57
KOG1293678 consensus Proteins containing armadillo/beta-caten 98.57
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.52
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.48
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.44
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.43
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.42
PTZ00429 746 beta-adaptin; Provisional 98.41
COG5369743 Uncharacterized conserved protein [Function unknow 98.41
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.36
KOG4646173 consensus Uncharacterized conserved protein, conta 98.35
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.22
KOG4646173 consensus Uncharacterized conserved protein, conta 98.19
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 98.03
PF05536 543 Neurochondrin: Neurochondrin 98.02
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.01
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 98.01
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.0
PTZ00429 746 beta-adaptin; Provisional 97.97
KOG2973353 consensus Uncharacterized conserved protein [Funct 97.95
PF05536 543 Neurochondrin: Neurochondrin 97.93
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 97.93
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 97.9
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 97.89
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.8
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.8
KOG4413524 consensus 26S proteasome regulatory complex, subun 97.8
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.65
TIGR02270410 conserved hypothetical protein. Members are found 97.62
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.6
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.58
KOG4413524 consensus 26S proteasome regulatory complex, subun 97.57
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 97.51
KOG3678 832 consensus SARM protein (with sterile alpha and arm 97.49
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 97.44
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 97.42
TIGR02270410 conserved hypothetical protein. Members are found 97.41
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.36
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.35
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.33
COG5369743 Uncharacterized conserved protein [Function unknow 97.31
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.24
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.23
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.18
KOG1242569 consensus Protein containing adaptin N-terminal re 97.17
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.15
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.12
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 97.01
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.01
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 96.97
KOG1824 1233 consensus TATA-binding protein-interacting protein 96.96
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.88
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 96.85
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.8
KOG0212 675 consensus Uncharacterized conserved protein [Funct 96.76
KOG0212675 consensus Uncharacterized conserved protein [Funct 96.7
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.64
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 96.59
KOG1242 569 consensus Protein containing adaptin N-terminal re 96.57
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 96.47
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.45
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 96.44
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.36
KOG2259 823 consensus Uncharacterized conserved protein [Funct 96.24
COG5096 757 Vesicle coat complex, various subunits [Intracellu 96.02
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 96.0
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 95.97
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 95.97
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 95.95
KOG2259 823 consensus Uncharacterized conserved protein [Funct 95.88
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 95.77
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 95.75
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 95.72
PF08045257 CDC14: Cell division control protein 14, SIN compo 95.47
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 95.46
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 95.45
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 95.45
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 95.42
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 95.37
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 95.37
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 95.3
KOG3036293 consensus Protein involved in cell differentiation 95.3
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 95.15
PF05004309 IFRD: Interferon-related developmental regulator ( 95.09
KOG3036293 consensus Protein involved in cell differentiation 95.08
PF07814361 WAPL: Wings apart-like protein regulation of heter 95.06
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 95.04
PF11841160 DUF3361: Domain of unknown function (DUF3361) 95.02
KOG0567289 consensus HEAT repeat-containing protein [General 94.93
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 94.9
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 94.83
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 94.81
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 94.8
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 94.76
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 94.69
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 94.47
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 94.47
KOG4464532 consensus Signaling protein RIC-8/synembryn (regul 94.46
KOG1824 1233 consensus TATA-binding protein-interacting protein 94.29
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 94.1
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 94.04
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 93.68
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 93.66
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 93.58
PF08045257 CDC14: Cell division control protein 14, SIN compo 93.3
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 93.11
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 92.93
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 92.8
PF05004309 IFRD: Interferon-related developmental regulator ( 92.66
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 92.66
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 92.6
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 92.59
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 92.3
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 92.06
PF07814361 WAPL: Wings apart-like protein regulation of heter 91.88
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 91.8
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 91.67
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 91.53
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 91.43
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 91.39
KOG4535728 consensus HEAT and armadillo repeat-containing pro 91.26
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 91.21
PF11701157 UNC45-central: Myosin-binding striated muscle asse 91.15
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 91.03
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 91.02
PRK14707 2710 hypothetical protein; Provisional 90.72
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 90.6
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 90.48
COG5096 757 Vesicle coat complex, various subunits [Intracellu 90.23
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 90.16
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 89.89
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 89.79
KOG4653982 consensus Uncharacterized conserved protein [Funct 89.77
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 89.09
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 88.97
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 88.85
KOG0301745 consensus Phospholipase A2-activating protein (con 88.66
PRK14707 2710 hypothetical protein; Provisional 88.52
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 88.15
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 87.98
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 87.85
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 87.75
KOG4535728 consensus HEAT and armadillo repeat-containing pro 87.56
COG5209315 RCD1 Uncharacterized protein involved in cell diff 86.79
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 86.27
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 86.24
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 86.07
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 85.37
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 85.31
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 85.03
COG5209315 RCD1 Uncharacterized protein involved in cell diff 84.93
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 84.74
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 84.66
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 84.66
smart00638574 LPD_N Lipoprotein N-terminal Domain. 84.37
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 83.62
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 83.47
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 82.9
KOG2032533 consensus Uncharacterized conserved protein [Funct 82.51
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 82.12
KOG2025 892 consensus Chromosome condensation complex Condensi 81.91
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 81.78
KOG2062 929 consensus 26S proteasome regulatory complex, subun 81.43
PF11701157 UNC45-central: Myosin-binding striated muscle asse 81.42
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 81.3
smart00638574 LPD_N Lipoprotein N-terminal Domain. 81.12
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
Probab=99.97  E-value=5.8e-30  Score=266.93  Aligned_cols=291  Identities=19%  Similarity=0.271  Sum_probs=257.9

Q ss_pred             CChhhHHHHHhcchhHHHHHHHHHhcC-CCHHHHHHHHHHHHHHhccChhhHHHHHhcCCHHHHHHhhcCCCHHHHHHHH
Q 010064          117 EGEAASEIKKKEEALEELKIVVKDLQS-ESEEQRREAASKVRSLAKENSETRVTLAMLGAIPPLAGMLDFQLADSQISSL  195 (519)
Q Consensus       117 ~~e~~~~~i~~~g~~~~l~~Lv~~L~s-~~~~~~~~Aa~~L~~La~~~~~~r~~l~~~G~i~~Lv~lL~s~~~~~~~~a~  195 (519)
                      .+..-...+ ..|.   ++.+|+.|.. .++..|.+|+|+|.+++.++.+....+++.|++|.++.+|.++++.+++.|.
T Consensus        98 ~~ppi~~vi-~~G~---v~~lV~~l~~~~~~~lq~eAAWaLTnIAsgtse~T~~vv~agavp~fi~Ll~s~~~~v~eQav  173 (514)
T KOG0166|consen   98 RNPPIDEVI-QSGV---VPRLVEFLSRDDNPTLQFEAAWALTNIASGTSEQTKVVVDAGAVPIFIQLLSSPSADVREQAV  173 (514)
T ss_pred             CCCCHHHHH-HcCc---HHHHHHHHccCCChhHHHHHHHHHHHHhcCchhhccccccCCchHHHHHHhcCCcHHHHHHHH
Confidence            333444444 4477   9999999974 4688999999999999999988888899999999999999999999999999


Q ss_pred             HHHHHhcCCChhhHHHHHhcCcHHHHHHhhcCCCCCCHHHHHHHHHHHHHhccCCCChhhhhh-CCChHHHHHHhhcCCC
Q 010064          196 YALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSNKPIIGS-SGAVPFLVKTLKNSDK  274 (519)
Q Consensus       196 ~aL~NLa~~~~~nk~~iv~aG~v~~Lv~lL~s~~~~~~~~~~~a~~aL~~LS~~~~~k~~I~~-~gai~~LV~lL~~~~~  274 (519)
                      |||+|++.+++..|..++++|++++|+.++..+.  .......++|+|.||.......+.+.. ..++|.|..++..   
T Consensus       174 WALgNIagds~~~Rd~vl~~g~l~pLl~~l~~~~--~~~~lRn~tW~LsNlcrgk~P~P~~~~v~~iLp~L~~ll~~---  248 (514)
T KOG0166|consen  174 WALGNIAGDSPDCRDYVLSCGALDPLLRLLNKSD--KLSMLRNATWTLSNLCRGKNPSPPFDVVAPILPALLRLLHS---  248 (514)
T ss_pred             HHHhccccCChHHHHHHHhhcchHHHHHHhcccc--chHHHHHHHHHHHHHHcCCCCCCcHHHHHHHHHHHHHHHhc---
Confidence            9999999999999999999999999999998872  236788999999999987755455444 7789999999998   


Q ss_pred             CCCHHHHHHHHHHHHHhcCCCc-cHHHHHhcCcHHHHHHHcCCHH--HHHHHHHHHHHhcC-CcccHHHHhhcCCcchhh
Q 010064          275 KVSPQAKQDALRALYNLSIFPS-NISFILETDLIRYLLEMLGDME--LSERILSILSNLVS-TPEGRKAISRVPDAFPIL  350 (519)
Q Consensus       275 ~~~~~~~~~A~~aL~nLs~~~~-n~~~l~~~g~v~~Lv~lL~~~~--v~~~Al~~L~nLs~-~~e~r~~i~~~~g~i~~L  350 (519)
                       .+..+..+|+|||.+|+.+++ ..+.+++.|+++.|+.+|..++  ++..|+++++|++. ++...+.+++ .|+++.|
T Consensus       249 -~D~~Vl~Da~WAlsyLsdg~ne~iq~vi~~gvv~~LV~lL~~~~~~v~~PaLRaiGNIvtG~d~QTq~vi~-~~~L~~l  326 (514)
T KOG0166|consen  249 -TDEEVLTDACWALSYLTDGSNEKIQMVIDAGVVPRLVDLLGHSSPKVVTPALRAIGNIVTGSDEQTQVVIN-SGALPVL  326 (514)
T ss_pred             -CCHHHHHHHHHHHHHHhcCChHHHHHHHHccchHHHHHHHcCCCcccccHHHhhccceeeccHHHHHHHHh-cChHHHH
Confidence             799999999999999998765 8899999999999999997554  88999999999998 5556667777 7999999


Q ss_pred             hhhccCCCCHHHHHHHHHHHHHHhcCChhhHHHHHHcCcHHHHHHHhhcCCHHHHHHHHHHHHHhhhc
Q 010064          351 VDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRILECLRVD  418 (519)
Q Consensus       351 v~lL~~s~~~~~qe~A~~~L~nL~~~~~~~~~~i~~~G~i~~Ll~Ll~~gs~~~~~~A~~~L~~l~~~  418 (519)
                      ..++..+....++++|||++.|++.++.++.++++++|++|.|+.++..+.-+.|+.|+|++.++.-.
T Consensus       327 ~~ll~~s~~~~ikkEAcW~iSNItAG~~~qiqaVida~l~p~Li~~l~~~ef~~rKEAawaIsN~ts~  394 (514)
T KOG0166|consen  327 SNLLSSSPKESIKKEACWTISNITAGNQEQIQAVIDANLIPVLINLLQTAEFDIRKEAAWAISNLTSS  394 (514)
T ss_pred             HHHhccCcchhHHHHHHHHHHHhhcCCHHHHHHHHHcccHHHHHHHHhccchHHHHHHHHHHHhhccc
Confidence            99998666677999999999999999999999999999999999999999999999999999999943



>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG4464 consensus Signaling protein RIC-8/synembryn (regulates neurotransmitter secretion) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query519
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 3e-06
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 59/202 (29%), Positives = 95/202 (47%), Gaps = 14/202 (6%) Query: 174 GAIPPLAGMLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNP 233 G + L +L ++ Q + AL N+ G D AIV AG V ++KL+ S + Sbjct: 44 GGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQ 103 Query: 234 SVSEAIVANFLGLSALDSNKPIIGSSGAVPFLVKTLKNSDKKVSPQAKQDALRALYNLSI 293 + +AN S D I +G V LVK L ++D +V +++A RAL N++ Sbjct: 104 KEAARALANI--ASGPDEAIKAIVDAGGVEVLVKLLTSTDSEV----QKEAARALANIAS 157 Query: 294 FPSN-ISFILETDLIRYLLEML--GDMELSERILSILSNLVSTPEGRKAISRVPDA--FP 348 P I I++ + L+++L D E+ + L+N+ S P AI + DA Sbjct: 158 GPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGP--TSAIKAIVDAGGVE 215 Query: 349 ILVDVLNWTDSPGCQEKASYVL 370 +L +L TDS Q++A L Sbjct: 216 VLQKLLTSTDSE-VQKEAQRAL 236

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query519
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 7e-35
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-26
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-25
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-25
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-17
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-15
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-04
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-34
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 5e-17
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 5e-12
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-34
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-31
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-27
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 7e-18
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-15
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-34
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-31
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-28
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-22
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-19
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-18
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-30
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 4e-25
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-22
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 8e-19
3nmz_A458 APC variant protein; protein-protein complex, arma 5e-29
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-15
3nmz_A458 APC variant protein; protein-protein complex, arma 5e-08
3nmz_A458 APC variant protein; protein-protein complex, arma 6e-04
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-28
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-23
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-20
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 8e-09
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-28
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 5e-20
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-12
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 5e-28
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-24
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 4e-11
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-25
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 3e-24
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 3e-21
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-25
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 9e-10
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-09
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-08
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 5e-22
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 8e-14
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 4e-20
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-15
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-09
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-07
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-05
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 7e-20
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 3e-14
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-13
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 3e-07
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 4e-16
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-12
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 5e-05
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 4e-04
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
 Score =  138 bits (348), Expect = 7e-35
 Identities = 61/309 (19%), Positives = 114/309 (36%), Gaps = 17/309 (5%)

Query: 112 LLNLAEGEAASEIKKKEEALEELKIVVKDLQSESEEQRREAASKVRSLAKENSETRVTLA 171
           +  L++ EA+     +   +  +  +V+ +Q+ ++ +     S        + E  + + 
Sbjct: 174 VHQLSKKEASRHAIMRSPQM--VSAIVRTMQNTNDVETARCTSGTLHNLSHHREGLLAIF 231

Query: 172 MLGAIPPLAGMLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAP 231
             G IP L  ML   +      ++  L NL +  +  K A+  AG + KM+ L+      
Sbjct: 232 KSGGIPALVNMLGSPVDSVLFHAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNK---T 288

Query: 232 NPSVSEAIVANFLGLSALDS-NKPIIGSSGAVPFLVKTLKNSDKKVSPQAKQDALRALYN 290
           N             L+  +  +K II +SG    LV  ++        +      R L  
Sbjct: 289 NVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYT---YEKLLWTTSRVLKV 345

Query: 291 LSIFPSNISFILETDLIRYLLEML--GDMELSERILSILSNLVSTPEGRKAISRVPDAFP 348
           LS+  SN   I+E   ++ L   L      L +  L  L NL      ++ +        
Sbjct: 346 LSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEG---LLG 402

Query: 349 ILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGST--LAQK 406
            LV +L  +D       A+ +L  +   +Y ++  + + G   AL+   L         +
Sbjct: 403 TLVQLLG-SDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITE 461

Query: 407 RASRILECL 415
            A   L  L
Sbjct: 462 PAICALRHL 470


>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query519
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.98
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.97
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.97
3nmz_A458 APC variant protein; protein-protein complex, arma 99.97
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.97
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.97
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.97
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.97
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.97
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.96
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.95
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.95
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.95
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.95
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.95
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.95
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.95
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.95
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.94
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.94
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.94
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.93
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.93
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.92
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.92
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.91
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.9
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.89
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.89
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.85
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.81
3grl_A 651 General vesicular transport factor P115; vesicle t 99.5
3grl_A 651 General vesicular transport factor P115; vesicle t 99.49
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.28
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.23
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.2
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.2
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.17
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.16
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.07
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.02
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.99
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.96
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.95
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 98.88
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 98.84
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.8
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.77
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.61
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.6
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.53
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.52
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 98.48
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.45
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.35
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.22
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.22
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.2
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.12
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.08
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.07
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.03
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.99
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.86
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.86
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.77
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.76
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.69
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.58
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.52
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.5
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.49
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.43
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.38
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 97.32
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.24
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.22
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.01
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.68
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.06
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 95.88
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 94.38
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.27
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 93.99
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 93.53
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 93.32
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 93.2
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 92.63
2x19_B 963 Importin-13; nuclear transport, protein transport; 92.49
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 92.48
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 92.33
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 91.87
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 91.22
2x1g_F971 Cadmus; transport protein, developmental protein, 91.13
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 90.79
2x19_B 963 Importin-13; nuclear transport, protein transport; 90.03
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 89.78
2x1g_F 971 Cadmus; transport protein, developmental protein, 89.74
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 88.96
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 87.52
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 86.44
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 85.19
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 83.6
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 83.41
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 82.95
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 81.98
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 81.88
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 80.95
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 80.38
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
Probab=100.00  E-value=6e-32  Score=293.32  Aligned_cols=368  Identities=17%  Similarity=0.189  Sum_probs=271.2

Q ss_pred             Hhhhhhhheecc-CCcccccccccccCCCC----CCcchhhhhcccCCCCCCCCC-------CCccchhhh------hch
Q 010064           41 FRRKIFDAVSCG-GSSRYGREILDDEGISL----PTPKAKTEMESRGVDSEKGNG-------RKPEKQKEA------KGC  102 (519)
Q Consensus        41 ~~~~~~~~~~~~-~~~r~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~------~~~  102 (519)
                      -|++.|+.-+.. ++.|+||++..-..|+.    ++.++|....... +......       ......++.      +-+
T Consensus        12 ~r~~~~k~~~~~~~e~r~~R~~~~v~lRk~kr~e~l~krR~~~~~~~-~~~~~~~~~~~~~~~~~~~l~~lv~~l~s~d~   90 (529)
T 3tpo_A           12 ARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPD-DATSPLQENRNNQGTVNWSVEDIVKGINSNNL   90 (529)
T ss_dssp             --------------------------------CCSCSCCCCCC----------------CGGGSSCCHHHHHHHHTSSCH
T ss_pred             HHHHHhccCCCChHHHHHHHhHHHHHHHHHHHHHHHHhccCCCCCcc-cccChhhhccchhhhHHHHHHHHHHHhcCCCH
Confidence            378888877766 78888888887777766    6666654322111 1000000       000000000      113


Q ss_pred             hhHHHHHHHHHcc-cC-ChhhHHHHHhcchhHHHHHHHHHhc-CCCHHHHHHHHHHHHHHhccChhhHHHHHhcCCHHHH
Q 010064          103 VSKSEKLLDLLNL-AE-GEAASEIKKKEEALEELKIVVKDLQ-SESEEQRREAASKVRSLAKENSETRVTLAMLGAIPPL  179 (519)
Q Consensus       103 ~~~~~~l~aLl~l-s~-~e~~~~~i~~~g~~~~l~~Lv~~L~-s~~~~~~~~Aa~~L~~La~~~~~~r~~l~~~G~i~~L  179 (519)
                      ..+.+++..+.++ +. .....+.+.+.|+   ++.||+.|. +++++.|.+|+++|.+|+..+++.+..+.+.|+||+|
T Consensus        91 ~~q~~a~~~~rklLs~~~~~~i~~ii~~G~---ip~Lv~lL~~~~~~~~q~~Aa~aL~nia~~~~~~~~~vv~~Gaip~L  167 (529)
T 3tpo_A           91 ESQLQATQAARKLLSREKQPPIDNIIRAGL---IPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAF  167 (529)
T ss_dssp             HHHHHHHHHHHHHHTSSSCCCHHHHHHTTH---HHHHHHHHTCTTCHHHHHHHHHHHHHHHTSCHHHHHHHHHTTHHHHH
T ss_pred             HHHHHHHHHHHHHHcCCCCchHHHHHHCCC---HHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCCHHHH
Confidence            3445555555554 22 2233456668888   999999996 4568899999999999999888889999999999999


Q ss_pred             HHhhcCCCHHHHHHHHHHHHHhcCCChhhHHHHHhcCcHHHHHHhhcCCCC--CCHHHHHHHHHHHHHhccCCCChhhh-
Q 010064          180 AGMLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVA--PNPSVSEAIVANFLGLSALDSNKPII-  256 (519)
Q Consensus       180 v~lL~s~~~~~~~~a~~aL~NLa~~~~~nk~~iv~aG~v~~Lv~lL~s~~~--~~~~~~~~a~~aL~~LS~~~~~k~~I-  256 (519)
                      +.+|.+++.++++.|+++|+||+.+++.++..+++.|++++|+.++..+..  ....+...++++|.+++........+ 
T Consensus       168 v~LL~s~~~~v~e~A~~aL~nLa~~~~~~r~~i~~~g~i~~Ll~lL~~~~~~~~~~~~~~~a~~~L~nl~~~~~~~~~~~  247 (529)
T 3tpo_A          168 ISLLASPHAHISEQAVWALGNIAGAGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLD  247 (529)
T ss_dssp             HHHTTCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHTTCSSCGGGSCHHHHHHHHHHHHHHHCCCTTCCCHH
T ss_pred             HHHHcCCCHHHHHHHHHHHHHHhccCHHHHHHHHHcCCcHHHHHHHhccchhHhHHHHHHHHHHHHHHHHhcccchhhHH
Confidence            999999999999999999999999889999999999999999999987521  13456788999999999876554444 


Q ss_pred             hhCCChHHHHHHhhcCCCCCCHHHHHHHHHHHHHhcCCCc-cHHHHHhcCcHHHHHHHcCC--HHHHHHHHHHHHHhcC-
Q 010064          257 GSSGAVPFLVKTLKNSDKKVSPQAKQDALRALYNLSIFPS-NISFILETDLIRYLLEMLGD--MELSERILSILSNLVS-  332 (519)
Q Consensus       257 ~~~gai~~LV~lL~~~~~~~~~~~~~~A~~aL~nLs~~~~-n~~~l~~~g~v~~Lv~lL~~--~~v~~~Al~~L~nLs~-  332 (519)
                      ...+++|.|+.++.+    .+.+++.+|+|+|.+|+.+++ ....+++.|+++.|+.+|.+  ..++..++.+|+||+. 
T Consensus       248 ~~~~~lp~L~~LL~~----~~~~v~~~a~~aL~~l~~~~~~~~~~v~~~g~i~~Lv~lL~~~~~~v~~~a~~aL~nl~~~  323 (529)
T 3tpo_A          248 AVEQILPTLVRLLHH----NDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTG  323 (529)
T ss_dssp             HHHHHHHHHHHHTTS----SCHHHHHHHHHHHHHHHSSCHHHHHHHHTTTCHHHHHHHHTCSCHHHHHHHHHHHHHHTTS
T ss_pred             HHhhHHHHHHHHhcC----CcHHHHHHHHHHHHHhhhhhhhhHHHHHhccchHHHHHHhcCCChhHHHHHHHHHHHHHcc
Confidence            347899999999988    799999999999999998876 56667789999999999964  4599999999999998 


Q ss_pred             CcccHHHHhhcCCcchhhhhhccCCCCHHHHHHHHHHHHHHhcCChhhHHHHHHcCcHHHHHHHhhcCCHHHHHHHHHHH
Q 010064          333 TPEGRKAISRVPDAFPILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRIL  412 (519)
Q Consensus       333 ~~e~r~~i~~~~g~i~~Lv~lL~~s~~~~~qe~A~~~L~nL~~~~~~~~~~i~~~G~i~~Ll~Ll~~gs~~~~~~A~~~L  412 (519)
                      +++.+..+.+ .|+++.|+.+|. +.++.+++.|+|+|+||+.+++..++.+.+.|++|.|+.++.+++..+++.|+++|
T Consensus       324 ~~~~~~~i~~-~g~l~~L~~LL~-~~~~~i~~~a~~aL~nl~~~~~~~~~~v~~~g~i~~Lv~lL~~~~~~v~~~A~~aL  401 (529)
T 3tpo_A          324 TDEQTQKVID-AGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKAAAWAI  401 (529)
T ss_dssp             CHHHHHHHHH-TTGGGGHHHHTT-CSSHHHHHHHHHHHHHHHTSCHHHHHHHHHTTHHHHHHHHHHSSCHHHHHHHHHHH
T ss_pred             chHHHHHHhh-cccHHHHHHHHc-CCCHHHHHHHHHHHHHHhcccHHHHHHHHhcCcHHHHHHHhcCCCHHHHHHHHHHH
Confidence            5667777888 799999999999 67899999999999999999899999999999999999999999999999999999


Q ss_pred             HHhhhc
Q 010064          413 ECLRVD  418 (519)
Q Consensus       413 ~~l~~~  418 (519)
                      .++...
T Consensus       402 ~nl~~~  407 (529)
T 3tpo_A          402 TNYTSG  407 (529)
T ss_dssp             HHHHHH
T ss_pred             HHHHcC
Confidence            999854



>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 519
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 6e-15
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 4e-06
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-11
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 8e-11
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-09
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 6e-11
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-06
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 4e-04
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 3e-10
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 4e-06
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 9e-08
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Plakophilin 1 helical region
domain: Plakophilin 1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 74.5 bits (181), Expect = 6e-15
 Identities = 34/193 (17%), Positives = 71/193 (36%), Gaps = 14/193 (7%)

Query: 134 LKIVVKDLQSESEEQRREAASKVRSLAKENSETRVTLAMLGAIPPLAGMLDFQLADSQIS 193
           +   V+ L S+ E+ +   A  ++    ++   +  +  LG I  L  +L     + Q +
Sbjct: 4   IPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQA 63

Query: 194 SLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSNK 253
           +  AL NL   +  NK    +   + + + L+      N  + + +      LS+ D  K
Sbjct: 64  AAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRT--GNAEIQKQLTGLLWNLSSTDELK 121

Query: 254 PIIGSSGAVPFLVKTLKN-----------SDKKVSPQAKQDALRALYNLSIFPSN-ISFI 301
             + +        + +             S + V P+   +A   L NLS   +   +  
Sbjct: 122 EELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEVFFNATGCLRNLSSADAGRQTMR 181

Query: 302 LETDLIRYLLEML 314
             + LI  L+  +
Sbjct: 182 NYSGLIDSLMAYV 194


>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query519
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.95
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.94
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.92
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.92
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.78
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.73
d1b3ua_588 Constant regulatory domain of protein phosphatase 98.58
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 98.54
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 98.53
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.46
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.42
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.41
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.3
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.15
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.11
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.0
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.91
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.75
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.73
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.65
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.6
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 97.5
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.37
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.28
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.26
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.16
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 96.75
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.71
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 93.16
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 90.43
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 89.98
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 87.21
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 87.12
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 87.09
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 86.75
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.95  E-value=6e-26  Score=240.30  Aligned_cols=302  Identities=17%  Similarity=0.203  Sum_probs=261.2

Q ss_pred             HHHHHHHHHccc--CChhhHHHHHhcchhHHHHHHHHHhcC-CCHHHHHHHHHHHHHHhccChhhHHHHHhcCCHHHHHH
Q 010064          105 KSEKLLDLLNLA--EGEAASEIKKKEEALEELKIVVKDLQS-ESEEQRREAASKVRSLAKENSETRVTLAMLGAIPPLAG  181 (519)
Q Consensus       105 ~~~~l~aLl~ls--~~e~~~~~i~~~g~~~~l~~Lv~~L~s-~~~~~~~~Aa~~L~~La~~~~~~r~~l~~~G~i~~Lv~  181 (519)
                      +..++..+.++.  ......+.+.+.|+   ++.|++.|+. .+...+..|+++|.+|+..++.....+...|+++.|+.
T Consensus        93 ~~~a~~~~r~~ls~~~~~~i~~ii~~g~---i~~Lv~~l~~~~~~~iq~~a~~~L~ni~~~~~~~~~~~~~~g~i~~l~~  169 (503)
T d1wa5b_          93 QLSATVKFRQILSREHRPPIDVVIQAGV---VPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQ  169 (503)
T ss_dssp             HHHHHHHHHHHTCCSSSCSHHHHHHTTC---HHHHHHTTSTTSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHH
T ss_pred             HHHHHHHHHHHHhcCCCchHHHHHHCCC---hHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHhCCChHHHHH
Confidence            345555555542  22333455667888   9999999975 46779999999999999888888888999999999999


Q ss_pred             hhcCCCHHHHHHHHHHHHHhcCCChhhHHHHHhcCcHHHHHHhhcCCCCCCHHHHHHHHHHHHHhccCCCC-hhhhhhCC
Q 010064          182 MLDFQLADSQISSLYALLNLGIGNDLNKAAIVKAGAVHKMLKLIESPVAPNPSVSEAIVANFLGLSALDSN-KPIIGSSG  260 (519)
Q Consensus       182 lL~s~~~~~~~~a~~aL~NLa~~~~~nk~~iv~aG~v~~Lv~lL~s~~~~~~~~~~~a~~aL~~LS~~~~~-k~~I~~~g  260 (519)
                      +|.+++.+++..++++|+||+..++.++..+++.|+++.|+.++.+.   +..+...++++|.+++..... .......+
T Consensus       170 lL~s~~~~i~~~a~~~L~nia~~~~~~r~~l~~~~~~~~L~~ll~~~---~~~~~~~~~~~l~nl~~~~~~~~~~~~~~~  246 (503)
T d1wa5b_         170 LLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSN---KPSLIRTATWTLSNLCRGKKPQPDWSVVSQ  246 (503)
T ss_dssp             HHHHCCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHGGGSC---CHHHHHHHHHHHHHHHCCSSSCCCHHHHGG
T ss_pred             HhcCCChhHHHHHHHHHHHHhhhhHHHHHHHHhhcccccchhhcccC---CHHHHHHHHHHHHHHhcCCccchHHHHHHH
Confidence            99999999999999999999998899999999999999999999988   889999999999999876544 33334578


Q ss_pred             ChHHHHHHhhcCCCCCCHHHHHHHHHHHHHhcCCCc-cHHHHHhcCcHHHHHHHcC--CHHHHHHHHHHHHHhcCC-ccc
Q 010064          261 AVPFLVKTLKNSDKKVSPQAKQDALRALYNLSIFPS-NISFILETDLIRYLLEMLG--DMELSERILSILSNLVST-PEG  336 (519)
Q Consensus       261 ai~~LV~lL~~~~~~~~~~~~~~A~~aL~nLs~~~~-n~~~l~~~g~v~~Lv~lL~--~~~v~~~Al~~L~nLs~~-~e~  336 (519)
                      ++|.|+.++..    .+.+++..++++|.+|+.... ....+++.|+++.|+.++.  +..+...++.+|+||+.. ++.
T Consensus       247 ~l~~l~~~l~~----~d~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~l~~ll~~~~~~v~~~al~~l~nl~~~~~~~  322 (503)
T d1wa5b_         247 ALPTLAKLIYS----MDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQ  322 (503)
T ss_dssp             GHHHHHHHTTC----CCHHHHHHHHHHHHHHHSSCHHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHHHHTTSCHHH
T ss_pred             HHHHHHHHhcc----ccHHHHHHHHHHHHhhccCCchhhhhhhhhhhhhhhhhcccCCchhhhhhHHHHHHHHHHHHHHH
Confidence            99999999988    689999999999999998765 5677889999999999995  456899999999999984 444


Q ss_pred             HHHHhhcCCcchhhhhhccCCCCHHHHHHHHHHHHHHhcCChhhHHHHHHcCcHHHHHHHhhcCCHHHHHHHHHHHHHhh
Q 010064          337 RKAISRVPDAFPILVDVLNWTDSPGCQEKASYVLMVMAHKSYGDRQAMIEAGIASALLELTLLGSTLAQKRASRILECLR  416 (519)
Q Consensus       337 r~~i~~~~g~i~~Lv~lL~~s~~~~~qe~A~~~L~nL~~~~~~~~~~i~~~G~i~~Ll~Ll~~gs~~~~~~A~~~L~~l~  416 (519)
                      ...+.+ .|+++.|..++. +.++.++..++|+|.|++.+++.....+.+.|++|.++.++..+++.++..|.++|.++.
T Consensus       323 ~~~~~~-~~~l~~l~~ll~-~~~~~i~~~~~~~l~nl~~~~~~~~~~i~~~~~l~~li~~l~~~~~~v~~~a~~~l~nl~  400 (503)
T d1wa5b_         323 TQVVIN-AGVLPALRLLLS-SPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNAS  400 (503)
T ss_dssp             HHHHHH-TTHHHHHHHHTT-CSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHHHHSCHHHHHHHHHHHHHHH
T ss_pred             HHhhhc-cchHHHHHHHhc-CCCHHHHHHHHHHHHHHhhccHHHHHHHHHccccchhHHhcccCChhHHHHHHHHHHHHH
Confidence            556666 799999999998 678999999999999999998888999999999999999999999999999999999998


Q ss_pred             hc
Q 010064          417 VD  418 (519)
Q Consensus       417 ~~  418 (519)
                      ..
T Consensus       401 ~~  402 (503)
T d1wa5b_         401 SG  402 (503)
T ss_dssp             HH
T ss_pred             hc
Confidence            54



>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure