Citrus Sinensis ID: 010089

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MASQCHGLPLALETVGQAMAGKEFPEEWRRAIEIISTSASKFEDMEKKVLSRLKFSYDSLPNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLLDSIGGWDVLGALVRACLLEEGGDHVKMHDMIRDMALWIANEIEEEEKFLVRAGVGLTDAPKIEEWEGTLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLVSLHHLDLSSTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHCGSNHWPIAEEGNVLSDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQALHIKDCNSLPLNLLHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVNCSNVKDLTWLVFVPNLKWLQIFNCDDMEEIISVEKFEKLGEVSEMMGEPILFSELELLVISNASNLKRIYRDPLPFPHLERIGISECPKLKKLPLNSSSAKGRKIVIYGEKEWWEELQWEDQATQNAFSPCFLPYEL
ccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccHHHHHHHcccccccccHHHHHHccccccccccccHHHHHHHHHHccccccccccHHHHHHHHcccccccccEEEEcccHHHHHHHHHHccccccEEEEEcccccccccccccccEEEEEEccccccccccHHcccccccEEEcccccccccccccccccccccEEcccccccccccHHHHHcccccEEcccccccHHHccccHHHHHcccccccEEcccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEEEccccccccccccccccccEEEEEccccccEEccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEEcccccccccccccccccccEEEEEccHHHHcccccccHHcccccccccEEEcc
ccHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHcccccccccHHHHEEcHcccccHHHHHHHHEHEcccccccEcHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHcccccEEEEEEEccccccccccccccEEEEEccccccccccHHHHHHcccEEEEEcccccccccccccHccccccEEEEccccccccccHHHccccccEEEEEcccccHHcccccHHHcHcHcHcccEEEEEEccccccccHHHcccccccccccHHHHcccccccccEccccccccHHHcccHHHHHHHHHHccHcccHHHHHcccccccHHHcEEEEccccccccHcccccccccccEEEEEcccccccccccccccccccEEEEcccccHcccccHHHccccccccccccccccccccEEEEEcccHcHHHccccccccccccEEEEccccHHHccccccccccccEEEEcccHHHHHHcccccHHHHHHHcccccEccc
masqchglplALETVGqamagkefpEEWRRAIEIISTSASKFEDMEKKVLSRLKFSydslpndelrscllycclfpedseirktDLIVYWESeglldsigGWDVLGALVRACLLeeggdhvkMHDMIRDMALWIANEIEEEEKFLVRAgvgltdapkieEWEGTLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLVSlhhldlsstkvrgLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHcgsnhwpiaeegnvlsddAESLMKEIHCLEQLNLIALSLrgsrgvenflkfpklqnITQAlhikdcnslplNLLHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVncsnvkdltwlvfvpnlkwlqifncddmeeIISVEKFEKLGEvsemmgepilfSELELLVISNAsnlkriyrdplpfphlerigisecpklkklplnsssakgrKIVIYGEKEWWEELQWEDQatqnafspcflpyel
masqchglplaLETVGQAMAGKEFPEEWRRAIEIIstsaskfedmEKKVLSRLKFSYDSLPNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLLDSIGGWDVLGALVRACLLEEGGDHVKMHDMIRDMALWIANEIEEEEKFLVRAGVGLTDAPKIEEWEGTLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLVSLHHLDLSSTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHCGSNHWPIAEEGNVLSDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQALHIKDCNSLPLNLLHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVNCSNVKDLTWLVFVPNLKWLQIFNCDDMEEIISVEKFEKLGEVSEMMGEPILFSELELLVISNASNLKRIYRDPLPFPHLErigisecpklkklplnsssakgrkIVIYGEKEWWEELQWEDQATqnafspcflpyel
MASQCHGLPLALETVGQAMAGKEFPEEWRRAIEIISTSASKFEDMEKKVLSRLKFSYDSLPNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLLDSIGGWDVLGALVRACLLEEGGDHVKMHDMIRDMALWIANEIEEEEKFLVRAGVGLTDAPKIEEWEGTLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGIsslvslhhldlssTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHCGSNHWPIAEEGNVLSDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQALHIKDCNSLPLNLLHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVNCSNVKDLTWLVFVPNLKWLQIFNCDDMEEIISVEKFEKLGEVSEMMGEPILFSELELLVISNASNLKRIYRDPLPFPHLERIGISECPKLKKLPLNSSSAKGRKIVIYGEKEWWEELQWEDQATQNAFSPCFLPYEL
*********LALETVGQAMAGKEFPEEWRRAIEIISTSA**F****KKVLSRLKFSYDSLPNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLLDSIGGWDVLGALVRACLLEEGGDHVKMHDMIRDMALWIANEIEEEEKFLVRAGVGLTDAPKIEEWEGTLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLVSLHHLDLSSTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHCGSNHWPIAEEGNVLSDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQALHIKDCNSLPLNLLHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVNCSNVKDLTWLVFVPNLKWLQIFNCDDMEEIISVEKFEKLGEVSEMMGEPILFSELELLVISNASNLKRIYRDPLPFPHLERIGISECPKLKKLPL*****KGRKIVIYGEKEWWEELQWEDQATQNAFSPCFLP***
MASQCHGLPLALETVGQAMAGKEFPEEWRRAIEIISTS*SK**DMEKKVLSRLKFSYDSLPNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLLDSIGGWDVLGALVRACLLEEGGDHVKMHDMIRDMALWIANEIEEEEKFLVRA*V**TDAPKIEEWEGTLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLVSLHHLDLSSTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHCGSNHWPIAE**********SLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQALHIKDCN***LNLLHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVNCSNVKDLTWLVFVPNLKWLQIFNCDDMEEIISVEKFEK************LFSELELLVISNASNLKRIYRDPLPFPHLERIGISECPKLKKLPLNS***K***IVIYGEKEWWEELQWEDQATQNAFSPCFLPYEL
MASQCHGLPLALETVGQAMAGKEFPEEWRRAIEIISTSASKFEDMEKKVLSRLKFSYDSLPNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLLDSIGGWDVLGALVRACLLEEGGDHVKMHDMIRDMALWIANEIEEEEKFLVRAGVGLTDAPKIEEWEGTLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLVSLHHLDLSSTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHCGSNHWPIAEEGNVLSDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQALHIKDCNSLPLNLLHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVNCSNVKDLTWLVFVPNLKWLQIFNCDDMEEIISVEKFEKLGEVSEMMGEPILFSELELLVISNASNLKRIYRDPLPFPHLERIGISECPKLKKLPLNSSSAKGRKIVIYGEKEWWEELQWEDQATQNAFSPCFLPYEL
MASQCHGLPLALETVGQAMAGKEFPEEWRRAIEIISTSASKFEDMEKKVLSRLKFSYDSLPNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLLDSIGGWDVLGALVRACLLEEGGDHVKMHDMIRDMALWIANEIEEEEKFLVRAGVGLTDAPKIEEWEGTLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLVSLHHLDLSSTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHCGSNHWPIAEEGNVLSDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQALHIKDCNSLPLNLLHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVNCSNVKDLTWLVFVPNLKWLQIFNCDDMEEIISVEKFEKLGEVSEMMGEPILFSELELLVISNASNLKRIYRDPLPFPHLERIGISECPKLKKLPLNSSSAKGRKIVIYGEKEWWEELQWEDQATQNAFSPCFLPYEL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASQCHGLPLALETVGQAMAGKEFPEEWRRAIEIISTSASKFEDMEKKVLSRLKFSYDSLPNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLLDSIGGWDVLGALVRACLLEEGGDHVKMHDMIRDMALWIANEIEEEEKFLVRAGVGLTDAPKIEEWEGTLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLVSLHHLDLSSTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHCGSNHWPIAEEGNVLSDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQALHIKDCNSLPLNLLHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVNCSNVKDLTWLVFVPNLKWLQIFNCDDMEEIISVEKFEKLGEVSEMMGEPILFSELELLVISNASNLKRIYRDPLPFPHLERIGISECPKLKKLPLNSSSAKGRKIVIYGEKEWWEELQWEDQATQNAFSPCFLPYEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query518 2.2.26 [Sep-21-2011]
Q8RXS5888 Probable disease resistan yes no 0.940 0.548 0.364 2e-87
Q9C8T9898 Putative disease resistan no no 0.938 0.541 0.370 5e-85
Q9FLB4874 Putative disease resistan no no 0.934 0.553 0.360 2e-81
O64973889 Disease resistance protei no no 0.940 0.547 0.360 3e-80
Q8L3R3885 Disease resistance protei no no 0.938 0.549 0.382 2e-78
Q9SI85893 Probable disease resistan no no 0.938 0.544 0.349 1e-76
O82484892 Putative disease resistan no no 0.944 0.548 0.357 2e-76
Q9LVT3948 Probable disease resistan no no 0.928 0.507 0.352 1e-75
P60838894 Probable disease resistan no no 0.940 0.544 0.359 1e-75
Q940K0889 Probable disease resistan no no 0.938 0.546 0.342 3e-75
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function desciption
 Score =  323 bits (828), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 205/563 (36%), Positives = 312/563 (55%), Gaps = 76/563 (13%)

Query: 1   MASQCHGLPLALETVGQAMAGKEFPEEWRRAIEIISTSASKFEDMEKKVLSRLKFSYDSL 60
           +A +C GLPLAL  +G+ MA K   +EWR AI+++++SA++F  ME ++L  LK+SYD+L
Sbjct: 342 VAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNL 401

Query: 61  PNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLLDSIG------GWDVLGALVRACLL 114
            +++L+ C  YC LFPED  I K DL+ YW  EG +D         G++++G LVR+CLL
Sbjct: 402 KSEQLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFIDRNKGKAENQGYEIIGILVRSCLL 461

Query: 115 -EEGGDHVKMHDMIRDMALWIANEI-EEEEKFLVRAGVGLTDAPKIEEWEG--------- 163
            EE  + VKMHD++R+MALWIA++  +++E F+V+AG+   + P+IE+W+          
Sbjct: 462 MEENQETVKMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFN 521

Query: 164 ---------------TLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLV 208
                          TLLL  N +  I+ SFF+ +P L VL+LS+N  L  LP  IS  V
Sbjct: 522 NIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECV 581

Query: 209 SLHHLDLSSTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLH 268
           SL +L LS T++R  P  L  L  L YLNL+YT  +  +C      IS  + L+VLR+  
Sbjct: 582 SLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICG-----ISGLTSLKVLRLFV 636

Query: 269 CGSNHWPIAEEGNVLSDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQA 328
            G    P       L ++ ++L              ++L  +  +E FL   +L + T+A
Sbjct: 637 SGFPEDPCVLNELQLLENLQTL-------------TITLGLASILEQFLSNQRLASCTRA 683

Query: 329 LHIKDCNSLPLNLLHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLH-------FVN 381
           L I++ N     +  +A M+ LQ     DS++  W +      + +L LH       F N
Sbjct: 684 LRIENLNPQSSVISFVATMDSLQELHFADSDI--WEIKVKRN-ETVLPLHIPTTTTFFPN 740

Query: 382 --------CSNVKDLTWLVFVPNLKWLQIFNCDDMEEIISVEKFEKLGEVSEMMGEPILF 433
                   C+ ++DLTWL+F PNL  L++ +  D++E+I+ EK E+           I F
Sbjct: 741 LSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQ--------QNLIPF 792

Query: 434 SELELLVISNASNLKRIYRDPLPFPHLERIGISECPKLKKLPLNSSSAKGRKIVIYGEKE 493
            EL+ L + N   LK I+R PLPFP L++I ++ C +L+KLPLN +S     +VI   K+
Sbjct: 793 QELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKK 852

Query: 494 WWEELQWEDQATQNAFSPCFLPY 516
           W E L+WED+AT+  F P    +
Sbjct: 853 WIEILEWEDEATKARFLPTLKAF 875
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVT3|DRL38_ARATH Probable disease resistance protein At5g47260 OS=Arabidopsis thaliana GN=At5g47260 PE=3 SV=2 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
24461866 890 NBS-LRR type disease resistance protein 0.974 0.567 0.467 1e-120
24461865 892 NBS-LRR type disease resistance protein 0.971 0.563 0.483 1e-119
225443158 903 PREDICTED: probable disease resistance p 0.969 0.555 0.440 1e-113
24461861 890 NBS-LRR type disease resistance protein 0.961 0.559 0.461 1e-111
24461864 899 NBS-LRR type disease resistance protein 0.974 0.561 0.448 1e-111
359482672 905 PREDICTED: probable disease resistance p 0.976 0.559 0.421 1e-108
225442867 893 PREDICTED: probable disease resistance p 0.959 0.556 0.417 1e-106
147852651 882 hypothetical protein VITISV_017542 [Viti 0.940 0.552 0.416 1e-105
24461863 889 NBS-LRR type disease resistance protein 0.972 0.566 0.442 1e-104
359482674 991 PREDICTED: probable disease resistance p 0.949 0.496 0.407 1e-102
>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 258/552 (46%), Positives = 351/552 (63%), Gaps = 47/552 (8%)

Query: 2   ASQCHGLPLALETVGQAMAGKEFPEEWRRAIEIISTSASKFEDMEKKVLSRLKFSYDSLP 61
           A +C GLPLAL T+G+AMA K+ PEEW  AIE++ TS+S+F  +  +V   LKFSYDSLP
Sbjct: 344 AKECGGLPLALITIGRAMACKKTPEEWTYAIEVLRTSSSQFPGLGNEVYPLLKFSYDSLP 403

Query: 62  NDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLL---DSIG----GWDVLGALVRACLL 114
           +D +RSCLLYCCL+PED  I K  LI  W  EG L   D  G    G+ +LG L+ ACLL
Sbjct: 404 SDTIRSCLLYCCLYPEDYCISKEILIDCWIGEGFLTERDRFGEQNQGYHILGILLHACLL 463

Query: 115 EEGGD-HVKMHDMIRDMALWIANEIE-EEEKFLVRAGVGLTDAPKIEEWEG--------- 163
           EEGGD  VKMHD++RDMALWIA  IE E++ FLV AGVGL +AP +  WE          
Sbjct: 464 EEGGDGEVKMHDVVRDMALWIACAIEKEKDNFLVYAGVGLIEAPDVSGWEKARRLSLMHN 523

Query: 164 ---------------TLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLV 208
                          TL L  N ++ I   FF+ +PSL+VLNL+ +  LT LP GIS LV
Sbjct: 524 QITNLSEVATCPHLLTLFLNENELQMIHNDFFRFMPSLKVLNLA-DSSLTNLPEGISKLV 582

Query: 209 SLHHLDLSSTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLH 268
           SL HLDLS + +  LP ELKALVNL+ LNL+YT     +  IP QLIS+ S+L VLRM  
Sbjct: 583 SLQHLDLSKSSIEELPLELKALVNLKCLNLEYT---WSLTTIPRQLISNLSRLHVLRMFA 639

Query: 269 CGSNHWPIAEEGNVLSDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQA 328
              + +  A E ++L    E +++E+  L+ L +I+ +LR S G+++FL   KL++ T+A
Sbjct: 640 ASHSAFDRASEDSILFGGGELIVEELLGLKYLEVISFTLRSSHGLQSFLSSHKLRSCTRA 699

Query: 329 LHIKDCN-SLPLNLLHLANMEHLQLFSIWD-SNLEDWNVDCAGEVQKML-----KLHFVN 381
           L ++  N S  L +  LA+++ L    I +   LE+  +D   EVQ+ +     K+  + 
Sbjct: 700 LLLQCFNDSTSLEVSALADLKQLNRLWITECKKLEELKMDYTREVQQFVFHSLKKVEILA 759

Query: 382 CSNVKDLTWLVFVPNLKWLQIFNCDDMEEIISVEKFEKLGEVSEMMGEPILFSELELLVI 441
           CS +KDLT+LVF PNL+ +++  C  MEE++S+ KF    EV E++     F++L+ L +
Sbjct: 760 CSKLKDLTFLVFAPNLESIELMGCPAMEEMVSMGKF---AEVPEVVANLNPFAKLQNLKL 816

Query: 442 SNASNLKRIYRDPLPFPHLERIGISECPKLKKLPLNSSSAKGRKIVIYGEKEWWEELQWE 501
             A+NLK IY  PLPFPHL+ +  S C KLKKLPL+S+SA+ R IVI G + WWE+L+W 
Sbjct: 817 FGATNLKSIYWKPLPFPHLKSMSFSHCYKLKKLPLDSNSARERNIVISGTRRWWEQLEWV 876

Query: 502 DQATQNAFSPCF 513
           D+AT+NAF PCF
Sbjct: 877 DEATRNAFLPCF 888

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147852651|emb|CAN80649.1| hypothetical protein VITISV_017542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|359482674|ref|XP_002281708.2| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
TAIR|locus:2203881893 AT1G62630 [Arabidopsis thalian 0.345 0.200 0.441 7e-67
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.737 0.430 0.345 4.5e-52
TAIR|locus:2171589948 AT5G47260 [Arabidopsis thalian 0.955 0.522 0.294 8.2e-52
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.749 0.434 0.328 2.4e-48
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.770 0.451 0.325 9.5e-46
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.805 0.494 0.282 2.4e-45
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.847 0.576 0.310 5.6e-44
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.463 0.269 0.403 1.9e-43
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.866 0.464 0.310 1.9e-43
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.741 0.427 0.331 1.8e-42
TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 405 (147.6 bits), Expect = 7.0e-67, Sum P(2) = 7.0e-67
 Identities = 86/195 (44%), Positives = 129/195 (66%)

Query:     1 MASQCHGLPLALETVGQAMAGKEFPEEWRRAIEIISTSASKFEDMEKKVLSRLKFSYDSL 60
             +A +C GLPLAL  +G+ M+ K   +EWR AI ++++ A++F  ME K+L  LK+SYD+L
Sbjct:   340 VAKKCCGLPLALNVIGETMSCKRTIQEWRNAIHVLNSYAAEFIGMEDKILPLLKYSYDNL 399

Query:    61 PNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLLD-SIG-------GWDVLGALVRAC 112
               + ++S LLYC L+PED++IRK DLI +W  E ++D S G       G+D++G+LVRA 
Sbjct:   400 KGEHVKSSLLYCALYPEDAKIRKEDLIEHWICEEIIDGSEGIEKAEDKGYDIIGSLVRAS 459

Query:   113 LLEE-----GGDHVKMHDMIRDMALWIANEIE-EEEKFLVRAGVGLTDAPKIEEWEGT-- 164
             LL E     G   V MHD++R+MALWIA+E+  ++E F+VRAGVG+ + PK++ W     
Sbjct:   460 LLMECVDLKGKSSVIMHDVVREMALWIASELGIQKEAFIVRAGVGVREIPKVKNWNVVRR 519

Query:   165 LLLEYNHIEEITESF 179
             + L  N I  +  S+
Sbjct:   520 MSLMGNKIHHLVGSY 534
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034581001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (878 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 7e-22
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
PLN03210 1153 PLN03210, PLN03210, Resistant to P 6e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score = 95.1 bits (237), Expect = 7e-22
 Identities = 40/96 (41%), Positives = 55/96 (57%), Gaps = 2/96 (2%)

Query: 1   MASQCHGLPLALETVGQAMAGKEFPEEWRRAIEIISTSASKFEDMEKKVLSRLKFSYDSL 60
           +  +C GLPLAL+ +G  +A K   +EW   +E ++   +   D   +VLS L  SYD+L
Sbjct: 187 IVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGR-DGLNEVLSILSLSYDNL 245

Query: 61  PNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLL 96
           P   L+ C LY  LFPED  IRK  LI  W +EG +
Sbjct: 246 P-MHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFV 280

Length = 285
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 518
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.85
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.81
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.74
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.68
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.67
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.67
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.64
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.6
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.46
KOG4237498 consensus Extracellular matrix protein slit, conta 99.44
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.43
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.41
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.4
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.39
KOG0617264 consensus Ras suppressor protein (contains leucine 99.39
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.36
KOG0617264 consensus Ras suppressor protein (contains leucine 99.32
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.27
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.2
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.03
KOG4237498 consensus Extracellular matrix protein slit, conta 98.89
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.85
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.64
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.63
KOG4341483 consensus F-box protein containing LRR [General fu 98.57
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.57
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.56
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.5
PLN03150623 hypothetical protein; Provisional 98.49
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.47
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.46
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.46
KOG4341483 consensus F-box protein containing LRR [General fu 98.46
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.38
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.11
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.09
PLN03150623 hypothetical protein; Provisional 98.08
PRK15386426 type III secretion protein GogB; Provisional 97.96
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.91
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.8
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.75
PRK15386 426 type III secretion protein GogB; Provisional 97.67
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.67
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.6
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.53
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.47
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.42
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.32
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.19
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.86
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.79
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.66
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.52
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.48
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.39
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.18
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.99
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.65
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.58
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.42
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.19
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.13
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.86
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.27
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 92.28
smart0037026 LRR Leucine-rich repeats, outliers. 91.63
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.63
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.48
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.0
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 87.92
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 87.74
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 86.75
PRK04841 903 transcriptional regulator MalT; Provisional 83.06
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=8.2e-61  Score=503.83  Aligned_cols=485  Identities=40%  Similarity=0.707  Sum_probs=390.5

Q ss_pred             CcccCCCCchHHHHHHHHhcCCCChhHHHHHHHHHhcc-CCcccchHHHHHHHHhhhcCCCCchhhhhHhhhhcccCCCC
Q 010089            1 MASQCHGLPLALETVGQAMAGKEFPEEWRRAIEIISTS-ASKFEDMEKKVLSRLKFSYDSLPNDELRSCLLYCCLFPEDS   79 (518)
Q Consensus         1 I~~~c~GlPLai~~ig~~L~~~~~~~~W~~~l~~l~~~-~~~~~~~~~~i~~~L~~sY~~L~~~~lk~cfl~~a~fp~~~   79 (518)
                      ||++|+|+|||++|||+.|+.|++.++|+++.+.+.+. ..+.+++++.|+++|++|||+||. ++|.||+|||+||+||
T Consensus       348 v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~-~lK~CFLycalFPED~  426 (889)
T KOG4658|consen  348 VAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPE-ELKSCFLYCALFPEDY  426 (889)
T ss_pred             HHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhH-HHHHHHHhhccCCccc
Confidence            58999999999999999999999999999999999887 555667788999999999999997 9999999999999999


Q ss_pred             ccChHHHHHHHHHhCCCccc--------chhHHHHHHHHhcccccCCC----c-eecchHHHHHHHHHHhhccccc-eeE
Q 010089           80 EIRKTDLIVYWESEGLLDSI--------GGWDVLGALVRACLLEEGGD----H-VKMHDMIRDMALWIANEIEEEE-KFL  145 (518)
Q Consensus        80 ~i~~~~Li~~Wia~g~i~~~--------~~~~~~~~L~~~sli~~~~~----~-~~mHdl~~dl~~~i~~~~~~~~-~~~  145 (518)
                      +|++++||.+||||||+.+.        +|++|+.+|+++++++.++.    . |+|||+|||||.++|.+.+..+ ..+
T Consensus       427 ~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~i  506 (889)
T KOG4658|consen  427 EIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQI  506 (889)
T ss_pred             ccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceE
Confidence            99999999999999999773        89999999999999998651    3 9999999999999999766543 466


Q ss_pred             EecCcCCCCCCchhhhhhe--eeccccc------------------------ccccChhhhCCCCCCcEEEeecCCCcCc
Q 010089          146 VRAGVGLTDAPKIEEWEGT--LLLEYNH------------------------IEEITESFFQSLPSLRVLNLSVNHYLTE  199 (518)
Q Consensus       146 ~~~~~~~~~~~~~~~~~~~--l~l~~~~------------------------i~~~~~~~~~~l~~Lr~L~L~~~~~~~~  199 (518)
                      +.++......|....|..+  +++.+|.                        +..++..+|..|+.||+||+++|....+
T Consensus       507 v~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~  586 (889)
T KOG4658|consen  507 VSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSK  586 (889)
T ss_pred             EECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCc
Confidence            6666555556666555443  3333332                        3456667799999999999999989999


Q ss_pred             cCccccCccccCEEecCCCcCCccchhhhcCCCCcEeeccCCcccccccCCchhhhcCCCCCcEEeccccCCCCcccccc
Q 010089          200 LPVGISSLVSLHHLDLSSTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHCGSNHWPIAEE  279 (518)
Q Consensus       200 lp~~i~~L~~L~~L~l~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~~~~lp~~~~~~l~~L~~L~l~~~~~~~~~~~~~  279 (518)
                      +|++|++|.|||||+++++.+..+|.++++|..|.+|++..+..+   ..+|. +...|++|++|.+.....        
T Consensus       587 LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l---~~~~~-i~~~L~~Lr~L~l~~s~~--------  654 (889)
T KOG4658|consen  587 LPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRL---ESIPG-ILLELQSLRVLRLPRSAL--------  654 (889)
T ss_pred             CChHHhhhhhhhcccccCCCccccchHHHHHHhhheecccccccc---ccccc-hhhhcccccEEEeecccc--------
Confidence            999999999999999999999999999999999999999999876   55544 467799999999987652        


Q ss_pred             CCCCcchhhhhHHHhhcccccceEEEEEecCccccccccCcchhhccceeecccCCCCCccccccccccccceEEeccCc
Q 010089          280 GNVLSDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQALHIKDCNSLPLNLLHLANMEHLQLFSIWDSN  359 (518)
Q Consensus       280 ~~~~~~~~~~~~~~l~~L~~L~~l~~~~~~~~~~~~l~~~~~l~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~  359 (518)
                           ......+.++.+|++|+.+.+..........+.....+....+.+.+.++. ......++..+.+|+.|.+..|.
T Consensus       655 -----~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~~-~~~~~~~~~~l~~L~~L~i~~~~  728 (889)
T KOG4658|consen  655 -----SNDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSIEGCS-KRTLISSLGSLGNLEELSILDCG  728 (889)
T ss_pred             -----ccchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhhhhcccc-cceeecccccccCcceEEEEcCC
Confidence                 135567788889999998888665543345566666777777777775543 34555788899999999999996


Q ss_pred             CccccccCc-----cc-cccccEEEEecCCCCCCCcccccCCCccEEEEecCcchhhhhcccchhccccccccCCCCccC
Q 010089          360 LEDWNVDCA-----GE-VQKMLKLHFVNCSNVKDLTWLVFVPNLKWLQIFNCDDMEEIISVEKFEKLGEVSEMMGEPILF  433 (518)
Q Consensus       360 l~~~~~~~~-----~~-l~~L~~L~l~~c~~l~~l~~l~~l~~L~~L~L~~c~~l~~~~~~~~~~~~~~l~~~~~~~~~~  433 (518)
                      ..+....+.     .. ++++.++.+.+|...+.+.|....|+|+.|.+..|..++++++......     .+......|
T Consensus       729 ~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~-----~l~~~i~~f  803 (889)
T KOG4658|consen  729 ISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALL-----ELKELILPF  803 (889)
T ss_pred             CchhhcccccccchhhhHHHHHHHHhhccccccccchhhccCcccEEEEecccccccCCCHHHHhh-----hcccEEecc
Confidence            654333331     22 6688888899999999999998999999999999999999877544332     121124567


Q ss_pred             CCccee-eccCCccccccCCCCCCCCCcceEeccCCCCCcCCCCCCCCCC-C--cceEEEchhhhhccCccCchhhhhhh
Q 010089          434 SELELL-VISNASNLKRIYRDPLPFPHLERIGISECPKLKKLPLNSSSAK-G--RKIVIYGEKEWWEELQWEDQATQNAF  509 (518)
Q Consensus       434 ~~L~~L-~l~~~~~l~~l~~~~~~~~~L~~L~i~~C~~L~~lp~~~~~~~-~--~l~~~~~~~~~~~~~~~~~~~~~~~~  509 (518)
                      .++..+ .+.+...+..+......++.|+.+.+..||++.++|....... .  ......-+.+|.+..+|+++++...+
T Consensus       804 ~~~~~l~~~~~l~~l~~i~~~~l~~~~l~~~~ve~~p~l~~~P~~~~~~i~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~  883 (889)
T KOG4658|consen  804 NKLEGLRMLCSLGGLPQLYWLPLSFLKLEELIVEECPKLGKLPLLSTLTIVGCEEKLKEYPDGEWLEGVYWEDELTKLRF  883 (889)
T ss_pred             cccccceeeecCCCCceeEecccCccchhheehhcCcccccCccccccceeccccceeecCCccceeeEEehhhhhhhhc
Confidence            777777 5777777777777667788899999999999999998866543 2  22333334678999999999998887

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-22
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 6e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score = 99.7 bits (248), Expect = 2e-22
 Identities = 24/151 (15%), Positives = 44/151 (29%), Gaps = 14/151 (9%)

Query: 5   CHGLPLALETVGQAMAGKEFPEEWRRAIEIISTSASKFEDM----EKKVLSRLKFSYDSL 60
             G P  L    ++   K F +  +   ++ S      E +     K +   L+   + L
Sbjct: 326 SSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVL 385

Query: 61  PNDELRSCLLYCCLFPEDSEIRKTDLIVYWESEGLLDSIG-----GWDVLGALVRACLLE 115
             DE RS L +  + P   +I           +   +          D L  L +   L 
Sbjct: 386 S-DEDRSALAFAVVMPPGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALL 444

Query: 116 EGGD----HVKMHDMIRDMALWIANEIEEEE 142
            G        K+  +I      + +      
Sbjct: 445 SGKRMPVLTFKIDHIIHMFLKHVVDAQTIAN 475
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.88
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.86
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.86
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.86
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.86
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.86
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.85
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.85
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.85
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.84
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.83
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.83
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.82
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.79
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.73
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.73
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.71
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.71
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.7
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.69
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.68
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.65
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.63
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.63
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.63
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.61
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.61
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.6
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.6
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.59
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.58
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.57
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.57
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.53
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.48
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.48
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.47
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.47
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.47
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.46
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.46
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.45
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.45
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.45
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.44
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.43
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.43
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.42
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.41
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.4
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.39
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.37
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.36
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.35
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.34
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.33
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.31
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.27
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.27
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.23
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.19
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.17
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.16
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.05
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.03
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.0
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.0
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.98
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.9
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.89
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.86
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.79
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.74
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.57
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.41
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.37
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.27
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.27
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.86
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.5
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.41
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.38
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.2
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.14
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.01
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.66
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.35
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.75
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.3
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 90.27
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 87.64
2fna_A357 Conserved hypothetical protein; structural genomic 85.61
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.91  E-value=2.2e-23  Score=201.50  Aligned_cols=241  Identities=18%  Similarity=0.247  Sum_probs=185.7

Q ss_pred             CCCCCcEEEeecCCCcCccCccccCccccCEEecCCCcCCccchhhhcCCCCcEeeccCCcccccccCCchhhhcCCCCC
Q 010089          182 SLPSLRVLNLSVNHYLTELPVGISSLVSLHHLDLSSTKVRGLPQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKL  261 (518)
Q Consensus       182 ~l~~Lr~L~L~~~~~~~~lp~~i~~L~~L~~L~l~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~~~~lp~~~~~~l~~L  261 (518)
                      ...++++|+++++ .+..+|..++++++|++|++++|.++.+|..++++++|++|++++|..    ..+|.. ++++++|
T Consensus        79 ~~~~l~~L~L~~n-~l~~lp~~l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~l----~~lp~~-l~~l~~L  152 (328)
T 4fcg_A           79 TQPGRVALELRSV-PLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPL----RALPAS-IASLNRL  152 (328)
T ss_dssp             TSTTCCEEEEESS-CCSSCCSCGGGGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESCCC----CCCCGG-GGGCTTC
T ss_pred             cccceeEEEccCC-CchhcChhhhhCCCCCEEECCCCCccchhHHHhccCCCCEEECCCCcc----ccCcHH-HhcCcCC
Confidence            3578899999999 778999999999999999999999999999999999999999999876    678876 8899999


Q ss_pred             cEEeccccCCCCccccccCCCCcchhhhhHHHhhcccccceEEEEEecCccccccccCcchhhccceeecccCCCCCccc
Q 010089          262 QVLRMLHCGSNHWPIAEEGNVLSDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQALHIKDCNSLPLNL  341 (518)
Q Consensus       262 ~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~~l~~~~~~~~~~~~l~~~~~l~~~L~~L~l~~~~~~~~~~  341 (518)
                      ++|++.+|....            ..+..   +                                ....         ..
T Consensus       153 ~~L~L~~n~~~~------------~~p~~---~--------------------------------~~~~---------~~  176 (328)
T 4fcg_A          153 RELSIRACPELT------------ELPEP---L--------------------------------ASTD---------AS  176 (328)
T ss_dssp             CEEEEEEETTCC------------CCCSC---S--------------------------------EEEC----------C
T ss_pred             CEEECCCCCCcc------------ccChh---H--------------------------------hhcc---------ch
Confidence            999998875421            00000   0                                0000         01


Q ss_pred             cccccccccceEEeccCcCccccccCccccccccEEEEecCCCCCCCc-ccccCCCccEEEEecCcchhhhhcccchhcc
Q 010089          342 LHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVNCSNVKDLT-WLVFVPNLKWLQIFNCDDMEEIISVEKFEKL  420 (518)
Q Consensus       342 ~~l~~l~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~c~~l~~l~-~l~~l~~L~~L~L~~c~~l~~~~~~~~~~~~  420 (518)
                      ..+..+++|+.|++++|.++. .|.++..+++|++|++++|. +..+| .+..+++|++|++++|.....++.       
T Consensus       177 ~~~~~l~~L~~L~L~~n~l~~-lp~~l~~l~~L~~L~L~~N~-l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~-------  247 (328)
T 4fcg_A          177 GEHQGLVNLQSLRLEWTGIRS-LPASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYPP-------  247 (328)
T ss_dssp             CCEEESTTCCEEEEEEECCCC-CCGGGGGCTTCCEEEEESSC-CCCCCGGGGGCTTCCEEECTTCTTCCBCCC-------
T ss_pred             hhhccCCCCCEEECcCCCcCc-chHhhcCCCCCCEEEccCCC-CCcCchhhccCCCCCEEECcCCcchhhhHH-------
Confidence            234567788888888887774 56668888888999998884 44444 677888999999988876655443       


Q ss_pred             ccccccCCCCccCCCcceeeccCCccccccCCCCCCCCCcceEeccCCCCCcCCCCCCCCCCCcceEEEchhhhhccCcc
Q 010089          421 GEVSEMMGEPILFSELELLVISNASNLKRIYRDPLPFPHLERIGISECPKLKKLPLNSSSAKGRKIVIYGEKEWWEELQW  500 (518)
Q Consensus       421 ~~l~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~i~~C~~L~~lp~~~~~~~~~l~~~~~~~~~~~~~~~  500 (518)
                              .++.+++|++|++++|.....+|..+..+++|+.|++++|+.+..+|..+..+ .+++++..+..+...+.+
T Consensus       248 --------~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~~l~~L-~~L~~l~l~~~~~~~l~~  318 (328)
T 4fcg_A          248 --------IFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQL-PANCIILVPPHLQAQLDQ  318 (328)
T ss_dssp             --------CTTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTCCCCCGGGGGS-CTTCEEECCGGGSCC---
T ss_pred             --------HhcCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCchhhccHHHhhc-cCceEEeCCHHHHHHHhh
Confidence                    66788999999999988888888888889999999999999999999888887 578888888877777665


Q ss_pred             Cc
Q 010089          501 ED  502 (518)
Q Consensus       501 ~~  502 (518)
                      ..
T Consensus       319 ~~  320 (328)
T 4fcg_A          319 HR  320 (328)
T ss_dssp             --
T ss_pred             hh
Confidence            43
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 518
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 52.3 bits (124), Expect = 5e-08
 Identities = 43/244 (17%), Positives = 83/244 (34%), Gaps = 27/244 (11%)

Query: 164 TLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLVSLHHLDLSSTKVRGL 223
            L L+ N I EI +  F++L +L  L L  N      P   + LV L  L LS  +++ L
Sbjct: 35  LLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKEL 94

Query: 224 PQELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHCGSNHWPIAEEGNVL 283
           P++         +            +I +   S F+ L  + ++  G+N    +   N  
Sbjct: 95  PEK---------MPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGA 145

Query: 284 SDDAESLMKEIHCLEQLNLIALSLRGSRGVENFLKFPKLQNITQALHIKDCNSLPLNLLH 343
               + L         +  I   L            P L      LH+       ++   
Sbjct: 146 FQGMKKLSYIRIADTNITTIPQGL-----------PPSLTE----LHLDGNKITKVDAAS 190

Query: 344 LANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVNCSNVKDLTWLVFVPNLKWLQIF 403
           L  + +L        +    +    G +     L  ++ +N K +     + + K++Q+ 
Sbjct: 191 LKGLNNLA---KLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVV 247

Query: 404 NCDD 407
              +
Sbjct: 248 YLHN 251
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.67
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.56
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.56
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.47
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.25
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.2
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.15
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.14
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.06
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.01
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.91
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.82
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.79
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.53
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.48
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.34
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.72
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.47
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.45
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.81  E-value=7.8e-19  Score=165.84  Aligned_cols=281  Identities=16%  Similarity=0.187  Sum_probs=159.1

Q ss_pred             EecCcCCCCCCch-hhhhheeecccccccccChhhhCCCCCCcEEEeecCCCcCccCccccCccccCEEecCCCcCCccc
Q 010089          146 VRAGVGLTDAPKI-EEWEGTLLLEYNHIEEITESFFQSLPSLRVLNLSVNHYLTELPVGISSLVSLHHLDLSSTKVRGLP  224 (518)
Q Consensus       146 ~~~~~~~~~~~~~-~~~~~~l~l~~~~i~~~~~~~~~~l~~Lr~L~L~~~~~~~~lp~~i~~L~~L~~L~l~~~~l~~lp  224 (518)
                      ...+..++.+|.. ....+.+++++|+++++++..|.++++|++|++++|......|..+.++++|++|++++|+++.+|
T Consensus        16 ~C~~~~L~~lP~~l~~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~l~~n~~~~i~~~~f~~l~~L~~L~l~~n~l~~l~   95 (305)
T d1xkua_          16 QCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELP   95 (305)
T ss_dssp             ECTTSCCCSCCCSCCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECCSSCCSBCC
T ss_pred             EecCCCCCccCCCCCCCCCEEECcCCcCCCcChhHhhccccccccccccccccccchhhhhCCCccCEecccCCccCcCc
Confidence            3344445555442 122233777777777777666777777777777777333333556777777777777777777776


Q ss_pred             hhhhcCCCCcEeeccCCcccccccCCchhhhcCCCCCcEEeccccCCCCccccccCCCCcchhhhhHHHhhcccccceEE
Q 010089          225 QELKALVNLRYLNLDYTNEMCKMCKIPEQLISSFSKLQVLRMLHCGSNHWPIAEEGNVLSDDAESLMKEIHCLEQLNLIA  304 (518)
Q Consensus       225 ~~i~~L~~L~~L~l~~~~~l~~~~~lp~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~~l~  304 (518)
                      ..+  ...|+.|++..+..    ..++.........++.+....+...             ........+..+++|+.+.
T Consensus        96 ~~~--~~~l~~L~~~~n~l----~~l~~~~~~~~~~~~~l~~~~n~~~-------------~~~~~~~~~~~l~~L~~l~  156 (305)
T d1xkua_          96 EKM--PKTLQELRVHENEI----TKVRKSVFNGLNQMIVVELGTNPLK-------------SSGIENGAFQGMKKLSYIR  156 (305)
T ss_dssp             SSC--CTTCCEEECCSSCC----CBBCHHHHTTCTTCCEEECCSSCCC-------------GGGBCTTGGGGCTTCCEEE
T ss_pred             cch--hhhhhhhhccccch----hhhhhhhhhcccccccccccccccc-------------ccCCCccccccccccCccc
Confidence            543  34677777776654    4555554556666666666554431             1222223344555565555


Q ss_pred             EEEecCccccccccCcchhhccceeecccCCCCCccccccccccccceEEeccCcCccccccCccccccccEEEEecCCC
Q 010089          305 LSLRGSRGVENFLKFPKLQNITQALHIKDCNSLPLNLLHLANMEHLQLFSIWDSNLEDWNVDCAGEVQKMLKLHFVNCSN  384 (518)
Q Consensus       305 ~~~~~~~~~~~l~~~~~l~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~c~~  384 (518)
                      +..+....+   ..  .....++.|+++++......+..+..++.++.|++++|.+....+.++..+++|++|++++| .
T Consensus       157 l~~n~l~~l---~~--~~~~~L~~L~l~~n~~~~~~~~~~~~~~~l~~L~~s~n~l~~~~~~~~~~l~~L~~L~L~~N-~  230 (305)
T d1xkua_         157 IADTNITTI---PQ--GLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNN-K  230 (305)
T ss_dssp             CCSSCCCSC---CS--SCCTTCSEEECTTSCCCEECTGGGTTCTTCCEEECCSSCCCEECTTTGGGSTTCCEEECCSS-C
T ss_pred             cccCCcccc---Cc--ccCCccCEEECCCCcCCCCChhHhhccccccccccccccccccccccccccccceeeecccc-c
Confidence            543322111   11  12345677777766544444455666677777777777666666666777777777777776 5


Q ss_pred             CCCCc-ccccCCCccEEEEecCcchhhhhcccchhccccccccCCCCccCCCcceeeccCCccccccCCCCCCCCCcc
Q 010089          385 VKDLT-WLVFVPNLKWLQIFNCDDMEEIISVEKFEKLGEVSEMMGEPILFSELELLVISNASNLKRIYRDPLPFPHLE  461 (518)
Q Consensus       385 l~~l~-~l~~l~~L~~L~L~~c~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~  461 (518)
                      ++.+| .+..+++|+.|+|+++ .++.+....+...        ......++|+.|.|.+++ ++.++...++|+.++
T Consensus       231 L~~lp~~l~~l~~L~~L~Ls~N-~i~~i~~~~f~~~--------~~~~~~~~L~~L~L~~N~-~~~~~~~~~~f~~~~  298 (305)
T d1xkua_         231 LVKVPGGLADHKYIQVVYLHNN-NISAIGSNDFCPP--------GYNTKKASYSGVSLFSNP-VQYWEIQPSTFRCVY  298 (305)
T ss_dssp             CSSCCTTTTTCSSCCEEECCSS-CCCCCCTTSSSCS--------SCCTTSCCCSEEECCSSS-SCGGGSCGGGGTTCC
T ss_pred             ccccccccccccCCCEEECCCC-ccCccChhhccCc--------chhcccCCCCEEECCCCc-CccCcCCHhHhcccc
Confidence            55554 4666777777777764 3555433111110        123345666777776643 444444444555443
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure