Citrus Sinensis ID: 010139

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------
MIQDDDSDLEYELEAFPEVSSEASTEAAACVKVLIASGLPSDSSLPNSSMVEAPLTINIPNGQSLRASTENSQPSSLMQGMNITVPVAVQKVPLPAPTPEVLDANGLIGGSMPPRKKRKPWTAEEDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRKKHGNVILGSNSSGSQLSEAQLAARHAMSLALDMPVKNITASCTNTTAGTTSSATMNNPVPSTANAEASSVANQSKLSPVGSPGSAVKSRVPLKKMPAKSNFGADSSIRAAAVAAGARIVTPSDAASLLKVAQAKKAIHIMPSGVSSIKSPSAGSASAHLEASPTTRYVRPSLPAVPSSSSPAVTSSASHPGLVKAALPKVQHNTSCEQTNAVVSVPATELQLKPEVKAGEEIKVSGCSVSGNEPSKEIQLDLPKLDAEFKNQAAVAENPDSSSNMEIVENGQVQSNGNQPEGNGNQNGNDDKMVDSPVANGENQAAVKQKNSGLPQSSNNEEAELPTLVIDKCSSKNLEV
cccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccHHHcHHHHHHccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccHHHHccccccccc
ccccccccccEEEcccccccHHHHHHHHHHHHHHHHccccccccccccccEcccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHcccccccccHHHHHHHHHHHcHcccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccHHHHHHHHHHccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccccEEEEccccccccccccEEcccccccccccccEEEcccccEEEccccEEEEEccccccccEEEEcccEEEcccccccccccccccccccccccccccccccccccccccccccccHHcccccEEEcccccccccc
MIQDDDSDLEYEleafpevsseaSTEAAACVKVLIAsglpsdsslpnssmveapltinipngqslrastensqpsslmqgmniTVPVavqkvplpaptpevldangliggsmpprkkrkpwtaeEDLELISAVQKcgegnwanilrgdfkwdrtASQLSQRWNILRKKhgnvilgsnssgsqlSEAQLAARHAMSLALdmpvknitasctnttagttssatmnnpvpstanaeassvanqsklspvgspgsavksrvplkkmpaksnfgadsSIRAAAVAAGARIVTPSDAASLLKVAQAKKAihimpsgvssikspsagsasahleaspttryvrpslpavpsssspavtssashpglvkaalpkvqhntsceqtnavvsvpatelqlkpevkageeikvsgcsvsgnepskeiqldlPKLDAEFKNQaavaenpdsssnmeivengqvqsngnqpegngnqngnddkmvdspvangenqaavkqknsglpqssnneeaelptlvidkcssknlev
MIQDDDSDLEYELEAFPEVSSEASTEAAACVKVLIASGLPSDSSLPNSSMVEAPLTINIPNGQSLRASTENSQPSSLMQGMNITVPVAVQKVPLPAPTPEVLdangliggsmpprkkrkpWTAEEDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRKKHGNVILGSNSSGSQLSEAQLAARHAMSLALDMPVKNITASCTNTtagttssatmnnPVPSTANAEASSVANqsklspvgspgsavksrvplkkmpaksnfgadSSIRAAAVAAGARIVTPSDAASLLKVAQAKKAIHIMPSGVSSIKSPSAGSASAHLEASPTTRYVRPSLPAVPSSSSPAVTSSASHPGLVKAALPKVQHNTSCEQTNAVVSVPATELQLKPEVKAGEEIKVsgcsvsgnepskEIQLDLPKLDAEFKNQAAVaenpdsssnMEIVENGQVQSNGNQPEGNGNQNGNDDKMVDSPVANGENQAAVKqknsglpqssnneeaelptlvidkcssknlev
MIQDDDSDLEYELEAFPevsseasteaaaCVKVLIASGLPSDSSLPNSSMVEAPLTINIPNGQSLRASTENSQPSSLMQGMNITVPVAVQKVPLPAPTPEVLDANGLIGGSMPPRKKRKPWTAEEDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRKKHGNVILGSNSSGSQLSEAQLAARHAMSLALDMPVKNItasctnttagttssatmnnPVPSTANAEASSVANQSKLSPVGSPGSAVKSRVPLKKMPAKSNFgadssiraaavaagarivTPSDAASLLKVAQAKKAIHIMpsgvssikspsagsasaHLEASPTTRYvrpslpavpsssspavtssashpGLVKAALPKVQHNTSCEQTNAVVSVPATELQLKPEVKAGEEIKVSGCSVSGNEPSKEIQLDLPKLDAEFKNQAAVAENPDSSSNMEIVENGQVQSngnqpegngnqngnDDKMVDSPVANGENQAAVKQKNSGLPQSSNNEEAELPTLVIDKCSSKNLEV
***************************AACVKVLIA**********************************************ITVPVAVQ**********************************EDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRKKHGNVIL*******************************************************************************************************AVAAGARIVTP**AASLLKVAQA**AI*********************************************************************************************************************************************************************************************************************
***DDDSDLEY******************************************************************************************************************DLELISAVQKCGEGNWANILRGDFKWDR******QRWNILR***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
MIQDDDSDLEYELEAF**********AAACVKVLIASGLPSDSSLPNSSMVEAPLTINIPNGQS***********SLMQGMNITVPVAVQKVPLPAPTPEVLDANGLIGGSM**********AEEDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRKKHGNVILGSNSSGSQLSEAQLAARHAMSLALDMPVKNITASCTNTTAGTTSSATMNNPVP******************************PLKKMPAKSNFGADSSIRAAAVAAGARIVTPSDAASLLKVAQAKKAIHIMPSGV*******************TTRYVRPS******************PGLVKAALPKVQHNTSCEQTNAVVSVPATELQLKPEVKAGEEIKVSGCSVSGNEPSKEIQLDLPKLDAEFKNQAAVAENPDSSSNMEIVENGQVQSNGNQPEGNGNQNGNDDKMVDSPVANGENQ****************EEAELPTLVIDKCSSKNLEV
******SDLEYELEAFPEVSSEASTEAAACVKVLIASG*************EAPLTI*I************************************************************PWTAEEDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRKKH*****************************************************************************************************************************************************************************************************************VVSVPATELQLKPEVK****IKVSG*******PSKEIQLDLPKLDAEFKNQAAVAENPDSSSNMEIVENGQVQSNG**********************************************ELPTLVIDKC*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQDDDSDLEYELEAFPEVSSEASTEAAACVKVLIASGLPSDSSLPNSSMVEAPLTINIPNGQSLRASTENSQPSSLMQGMNITVPVAVQKVPLPAPTPEVLDANGLIGGSMPPRKKRKPWTAEEDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRKKHGNVILGSNSSGSQLSEAQLAARHAMSLALDMPVKNITASCTNTTAGTTSSATMNNPVPSTANAEASSVANQSKLSPVGSPGSAVKSRVPLKKMPAKSNFGADSSIRAAAVAAGARIVTPSDAASLLKVAQAKKAIHIMPSGVSSIKSPSAGSASAHLEASPTTRYVRPSLPAVPSSSSPAVTSSASHPGLVKAALPKVQHNTSCEQTNAVVSVPATELQLKPEVKAGEEIKVSGCSVSGNEPSKEIQLDLPKLDAEFKNQAAVAENPDSSSNMEIVENGQVQSNGNQPEGNGNQNGNDDKMVDSPVANGENQAAVKQKNSGLPQSSNNEEAELPTLVIDKCSSKNLEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query517 2.2.26 [Sep-21-2011]
P70371421 Telomeric repeat-binding yes no 0.100 0.123 0.444 3e-05
O55036438 Telomeric repeat-binding no no 0.098 0.116 0.452 5e-05
P54274439 Telomeric repeat-binding yes no 0.098 0.116 0.452 6e-05
O13493324 Myb-like DNA-binding prot N/A no 0.135 0.216 0.358 0.0005
>sp|P70371|TERF1_MOUSE Telomeric repeat-binding factor 1 OS=Mus musculus GN=Terf1 PE=1 SV=1 Back     alignment and function desciption
 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 115 RKKRKPWTAEEDLELISAVQKCGEGNWANILRGDFKW-DRTASQLSQRWNILRK 167
           R+KR+ W  EED  L   V+K GEGNWA IL   +K+ +RT+  L  RW  +++
Sbjct: 364 RRKRQTWLWEEDRILKCGVKKYGEGNWAKIL-SHYKFNNRTSVMLKDRWRTMKR 416
Binds the telomeric double-stranded TTAGGG repeat and negatively regulates telomere length. Involved in the regulation of the mitotic spindle. Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways.
Mus musculus (taxid: 10090)
>sp|O55036|TERF1_CRIGR Telomeric repeat-binding factor 1 (Fragment) OS=Cricetulus griseus GN=TERF1 PE=2 SV=1 Back     alignment and function description
>sp|P54274|TERF1_HUMAN Telomeric repeat-binding factor 1 OS=Homo sapiens GN=TERF1 PE=1 SV=3 Back     alignment and function description
>sp|O13493|MYB1_NEUCR Myb-like DNA-binding protein myb-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rca-1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query517
147772117598 hypothetical protein VITISV_010188 [Viti 0.965 0.834 0.508 1e-113
302142071 641 unnamed protein product [Vitis vinifera] 0.965 0.778 0.508 1e-113
359492495606 PREDICTED: uncharacterized protein LOC10 0.934 0.797 0.505 1e-110
255545976608 DNA binding protein, putative [Ricinus c 0.849 0.722 0.526 1e-106
224067082 677 predicted protein [Populus trichocarpa] 0.920 0.703 0.463 1e-101
449511444 659 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.758 0.594 0.461 1e-77
449470068 659 PREDICTED: uncharacterized protein LOC10 0.758 0.594 0.461 1e-77
356518433606 PREDICTED: uncharacterized protein LOC10 0.918 0.783 0.366 8e-63
449437282385 PREDICTED: uncharacterized protein LOC10 0.531 0.714 0.496 2e-60
449529210371 PREDICTED: uncharacterized protein LOC10 0.531 0.741 0.496 2e-60
>gi|147772117|emb|CAN60243.1| hypothetical protein VITISV_010188 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  416 bits (1070), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 281/553 (50%), Positives = 348/553 (62%), Gaps = 54/553 (9%)

Query: 4   DDDSDLEYELEAFPEVSSEASTEAAACVKVLIASGLPSDSSLPNSSMVEAPLTINIPNGQ 63
           DDDSDLEY+LEAFP +S+EAS EA ACVKVLIAS LPSDSSLPNSSMVEAPLTINIP GQ
Sbjct: 52  DDDSDLEYDLEAFPSISTEASAEATACVKVLIASSLPSDSSLPNSSMVEAPLTINIPCGQ 111

Query: 64  SLRASTENSQPSSLMQGMNITVPVAVQKVPLPAPTPEVLDANGLIGGSMPPRKKRKPWTA 123
           S RA +E S+ S  MQG NIT+PV+VQK        E  DANG   GS+P RKKRKPW++
Sbjct: 112 SSRAPSEYSRLSGSMQGTNITIPVSVQK-------SEGFDANGSTSGSLPARKKRKPWSS 164

Query: 124 EEDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRKKHGNV-ILGSNSSGSQ 182
           +ED ELI+AVQKCGEGNWANIL+GDFK DR+ASQLSQRW I+RKKH N+ + G+NS+GSQ
Sbjct: 165 DEDKELIAAVQKCGEGNWANILKGDFKGDRSASQLSQRWTIIRKKHKNLNVGGANSNGSQ 224

Query: 183 LSEAQLAARHAMSLALDMPVKNITASCTNTTAGTTSSATMNN---------PVPSTAN-A 232
           LSEAQLAARHAMSLALDMPVKN+T S  ++ AGT  +AT +N          +P++ N +
Sbjct: 225 LSEAQLAARHAMSLALDMPVKNLTTS--SSIAGTNPNATSSNSAFPATPAEALPASTNIS 282

Query: 233 EASSVANQ---SKLSPVGSPGSAVKSRVPLKKMPAKSNFGADSSIRAAAVAAGARIVTPS 289
           +A  ++ Q   S LS +GS GSA KSR   KK  AKS F + S ++A AVAAGARI TPS
Sbjct: 283 QAQQLSQQGPVSTLSQMGSLGSAPKSRATSKKTSAKSTFSSQSMLKATAVAAGARIATPS 342

Query: 290 DAASLLKVAQAKKAIHIMPSGVSSIKSPSAGSA----SAHLEASPTTRYVRPSLPAVPSS 345
            AASLLK AQ++ A+HIMP G + IKS  AG A    + HL A P   Y     P    S
Sbjct: 343 AAASLLKDAQSRNAVHIMPGGSTLIKSSVAGGANPLPANHLGAHPNVHYKCAGPPTTSLS 402

Query: 346 SSPAVTSSASHPGLVKAALPKVQH---------NTSCEQTNAVVSVPATELQLKPEVKAG 396
           +  AV  S S  G  K A P  Q          N S EQTNA  +  A E   K E K  
Sbjct: 403 TYSAVAPSVSRTGSAKPAAPGGQLAPSPSATSVNISSEQTNAATTSLAVEYPAKQETKTS 462

Query: 397 EEIKVSGCSVSGNEPSKEIQLDLPKLDAEFKNQAAVAENPDSSSNMEIV-ENG------- 448
           EE KV    +SGN P  ++  D   + +   ++  V E+  + SN E+V EN        
Sbjct: 463 EETKV---PISGNVPKAKVLEDQACVSSNTASE-QVQEDQATLSNTEVVLENKKAMVSDT 518

Query: 449 ----QVQSNGNQPEGNGNQNGNDDKMVDSPVANGENQAAVKQKNSGLPQSSNNEEAELPT 504
               + ++  N  E   +QN ND+K++D  VA      +V  +NSG  Q++N ++ +LP 
Sbjct: 519 KCLLKTETAENDGEVAESQNVNDNKIMDFRVAGECENQSVANENSG-NQNANEKQTDLPN 577

Query: 505 LVIDKCSSKNLEV 517
              D C  K+ EV
Sbjct: 578 TATD-CGEKSDEV 589

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302142071|emb|CBI19274.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492495|ref|XP_002283801.2| PREDICTED: uncharacterized protein LOC100245507 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255545976|ref|XP_002514048.1| DNA binding protein, putative [Ricinus communis] gi|223547134|gb|EEF48631.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224067082|ref|XP_002302346.1| predicted protein [Populus trichocarpa] gi|222844072|gb|EEE81619.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449511444|ref|XP_004163958.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101223883 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449470068|ref|XP_004152740.1| PREDICTED: uncharacterized protein LOC101206820 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356518433|ref|XP_003527883.1| PREDICTED: uncharacterized protein LOC100799956 [Glycine max] Back     alignment and taxonomy information
>gi|449437282|ref|XP_004136421.1| PREDICTED: uncharacterized protein LOC101205013 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449529210|ref|XP_004171594.1| PREDICTED: uncharacterized protein LOC101223915 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query517
TAIR|locus:2015307 834 AT1G58220 [Arabidopsis thalian 0.566 0.351 0.363 9.8e-37
ZFIN|ZDB-GENE-090612-2386 terf1 "telomeric repeat bindin 0.241 0.323 0.323 1.1e-07
UNIPROTKB|F1NCJ0345 TERF1 "Uncharacterized protein 0.112 0.168 0.466 4.1e-06
UNIPROTKB|F1NEJ5354 TERF1 "Uncharacterized protein 0.112 0.163 0.466 4.3e-06
UNIPROTKB|F1NCI9366 TERF1 "Uncharacterized protein 0.112 0.158 0.466 4.6e-06
UNIPROTKB|F1RWI3439 TERF1 "Uncharacterized protein 0.100 0.118 0.444 0.00049
RGD|1311574421 Terf1 "telomeric repeat bindin 0.100 0.123 0.444 0.00059
TAIR|locus:2015307 AT1G58220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 404 (147.3 bits), Expect = 9.8e-37, P = 9.8e-37
 Identities = 112/308 (36%), Positives = 151/308 (49%)

Query:     2 IQDDDSDLEYELEAFPXXXXXXXXXXXXCVKVLIASGLPSDSSLPNSSMVEAPLTINIPN 61
             + DDDSD+E ELEA P             VKV+ AS +PS+S +P  S VEAPLTINIP 
Sbjct:    87 VLDDDSDMECELEASPGVSVDVVTEAVAHVKVMAASYVPSESDIPEDSTVEAPLTINIP- 145

Query:    62 GQSL-RASTENSQPSSLMQGMNITVPVAVQKVPLPAPTPEVLDANGLIGGSMPPRKKRKP 120
               SL R   E S      +GMNIT PV + K        E  + NGL   S+ PRK+RK 
Sbjct:   146 -YSLHRGPQEPSDSYWSSRGMNITFPVFLPKAA------EGHNGNGL-ASSLAPRKRRKK 197

Query:   121 WTAEEDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRKKHGNVILGSNSSG 180
             W+AEED ELI+AV++ GEG+WA I + +F+ +RTASQLSQRW  +R++  +    S  +G
Sbjct:   198 WSAEEDEELIAAVKRHGEGSWALISKEEFEGERTASQLSQRWGAIRRRT-DTSNTSTQTG 256

Query:   181 SQLSEAQLAARHAMSLALD--MPVKNIXXXXXXXXXXXXXXXXXXXPVPS--TANAEASS 236
              Q +EAQ+AA  A+SLA+   +P K +                      S  T   +   
Sbjct:   257 LQRTEAQMAANRALSLAVGNRLPSKKLAVGMTPMLSSGTIKGAQANGASSGSTLQGQQQP 316

Query:   237 VANQSKLSPVGSPGSAVKSRVPLKKMPAKSNFXXXXXXXXXXXXXXXXXXTPSDAASLLK 296
                   LS   +     KSRVP+KK    S                      + A ++ K
Sbjct:   317 QPQIQALSRATTSVPVAKSRVPVKKTTGNSTSRADLMVTANSVAAAACMSGLATAVTVPK 376

Query:   297 VAQAKKAI 304
             +   K A+
Sbjct:   377 IEPGKNAV 384
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
ZFIN|ZDB-GENE-090612-2 terf1 "telomeric repeat binding factor (NIMA-interacting) 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCJ0 TERF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEJ5 TERF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCI9 TERF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWI3 TERF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1311574 Terf1 "telomeric repeat binding factor (NIMA-interacting) 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 2e-14
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 9e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-10
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-05
pfam09111118 pfam09111, SLIDE, SLIDE 0.003
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information 
 Score = 66.8 bits (164), Expect = 2e-14
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 119 KPWTAEEDLELISAVQKCGEGNWANIL-RGDFKWDRTASQLSQRWNILRK 167
           + WT EED  L+  V+K G GNWA IL    F  +RT+  L  +W  L+K
Sbjct: 1   RKWTDEEDEALVEGVEKYGVGNWAKILKDYFFVNNRTSVDLKDKWRNLKK 50

Human telomere repeat binding factors, TRF1 and TRF2, function as part of the 6 component shelterin complex. TRF2 binds DNA and recruits RAP1 (via binding to the RAP1 protein c-terminal (RCT)) and TIN2 in the protection of telomeres from DNA repair machinery. Metazoan shelterin consists of 3 DNA binding proteins (TRF2, TRF1, and POT1) and 3 recruited proteins that bind to one or more of these DNA-binding proteins (RAP1, TIN2, TPP1). Schizosaccharomyces pombe TAZ1 is an orthlog and binds RAP1. Human TRF1 and TRF2 bind double-stranded DNA. hTRF2 consists of a basic N-terminus, a TRF homology domain, the RAP1 binding motif (RBM), the TIN2 binding motif (TBM) and a myb-like DNA binding domain, SANT, named after 'SWI3, ADA2, N-CoR and TFIIIB', several factors that share this domain. Tandem copies of the domain bind telomeric DNA tandem repeats as part of the capping complex. The single myb-like domain of TRF-type proteins is similar to the tandem myb_like domains found in yeast RAP1. Length = 50
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|220113 pfam09111, SLIDE, SLIDE Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 517
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.97
PLN03212249 Transcription repressor MYB5; Provisional 99.96
PLN03091459 hypothetical protein; Provisional 99.95
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.56
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.55
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.44
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.37
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.29
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.19
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.07
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.03
PLN03091459 hypothetical protein; Provisional 98.9
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.88
PLN03212249 Transcription repressor MYB5; Provisional 98.82
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 98.66
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.54
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.43
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.31
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.3
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.12
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.04
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.32
KOG0051607 consensus RNA polymerase I termination factor, Myb 97.09
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.01
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.54
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.15
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.0
KOG1279506 consensus Chromatin remodeling factor subunit and 95.87
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 95.74
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.7
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 95.38
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 94.63
PRK13923170 putative spore coat protein regulator protein YlbO 91.83
KOG4282345 consensus Transcription factor GT-2 and related pr 91.79
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 90.96
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 90.15
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 90.07
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 87.85
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 87.43
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 83.68
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 83.36
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 82.97
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information 
Probab=99.97  E-value=3.8e-32  Score=266.31  Aligned_cols=105  Identities=18%  Similarity=0.211  Sum_probs=100.9

Q ss_pred             CCCCCCCHHHHHHHHHHHHHcCCCCcceeecccccc-cCCchhhhhHHHhhhhccccccCCCCCCCCCCHHHHHHHHHHH
Q 010139          116 KKRKPWTAEEDLELISAVQKCGEGNWANILRGDFKW-DRTASQLSQRWNILRKKHGNVILGSNSSGSQLSEAQLAARHAM  194 (517)
Q Consensus       116 kKrg~WT~EEDe~Ll~lV~k~G~gnW~~IAk~~f~p-gRT~kQCReRW~nirrr~~~LdP~~IkkgpWT~EED~~Lleav  194 (517)
                      +.||+||+|||++|+++|++||.++|..|++.  .+ +|++|+||.||.|      ||+|+ |+++.||+|||++|++++
T Consensus         7 ~~kGpWt~EED~~L~~~V~~~G~~~W~~i~k~--~gl~R~GKSCRlRW~N------yLrP~-ikrg~fT~eEe~~Ii~lH   77 (238)
T KOG0048|consen    7 LVKGPWTQEEDLTQIRSIKSFGKHNGTALPKL--AGLRRCGKSCRLRWTN------YLRPD-LKRGNFSDEEEDLIIKLH   77 (238)
T ss_pred             ccCCCCChHHHHHHHHHHHHhCCCCcchhhhh--cCCCccchHHHHHhhc------ccCCC-ccCCCCCHHHHHHHHHHH
Confidence            45799999999999999999999999999998  56 9999999999999      99999 999999999999999999


Q ss_pred             HhhcCCCCCCchhHhhccCCCCCCCCCccccCCCCCCCCcc
Q 010139          195 SLALDMPVKNITASCTNTTAGTTSSATMNNPVPSTANAEAS  235 (517)
Q Consensus       195 ~~al~~G~kk~Ws~IA~~LPGRTdn~~IKNrWns~lr~~~s  235 (517)
                      ..   +|++  |+.||++|||||||. |||||+++++++..
T Consensus        78 ~~---~GNr--Ws~IA~~LPGRTDNe-IKN~Wnt~lkkkl~  112 (238)
T KOG0048|consen   78 AL---LGNR--WSLIAGRLPGRTDNE-VKNHWNTHLKKKLL  112 (238)
T ss_pred             HH---HCcH--HHHHHhhCCCcCHHH-HHHHHHHHHHHHHH
Confidence            99   9999  999999999999999 99999999988855

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
1ba5_A53 Dna-Binding Domain Of Human Telomeric Protein, Htrf 7e-06
1w0t_A53 Htrf1 Dna-Binding Domain In Complex With Telomeric 1e-05
1iv6_A70 Solution Structure Of The Dna Complex Of Human Trf1 2e-05
1ity_A69 Solution Structure Of The Dna Binding Domain Of Hum 2e-05
3sjm_A64 Crystal Structure Analysis Of Trf2-Dbd-Dna Complex 2e-04
1w0u_A55 Htrf2 Dna-Binding Domain In Complex With Telomeric 2e-04
1xg1_A67 Solution Structure Of Myb-Domain Of Human Trf2 Leng 3e-04
1vf9_A64 Solution Structure Of Human Trf2 Length = 64 4e-04
1vfc_A63 Solution Structure Of The Dna Complex Of Human Trf2 4e-04
>pdb|1BA5|A Chain A, Dna-Binding Domain Of Human Telomeric Protein, Htrf1, Nmr, 18 Structures Length = 53 Back     alignment and structure 
Iteration: 1

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 2/53 (3%)
Query: 116 KKRKPWTAEEDLELISAVQKCGEGNWANILRGDFKW-DRTASQLSQRWNILRK 167
           +KR+ W  EED  L S V+K GEGNW+ IL   +K+ +RT+  L  RW  ++K
Sbjct: 1   RKRQAWLWEEDKNLRSGVRKYGEGNWSKILL-HYKFNNRTSVMLKDRWRTMKK 52
>pdb|1W0T|A Chain A, Htrf1 Dna-Binding Domain In Complex With Telomeric Dna. Length = 53 Back     alignment and structure
>pdb|1IV6|A Chain A, Solution Structure Of The Dna Complex Of Human Trf1 Length = 70 Back     alignment and structure
>pdb|1ITY|A Chain A, Solution Structure Of The Dna Binding Domain Of Human Trf1 Length = 69 Back     alignment and structure
>pdb|3SJM|A Chain A, Crystal Structure Analysis Of Trf2-Dbd-Dna Complex Length = 64 Back     alignment and structure
>pdb|1W0U|A Chain A, Htrf2 Dna-Binding Domain In Complex With Telomeric Dna. Length = 55 Back     alignment and structure
>pdb|1XG1|A Chain A, Solution Structure Of Myb-Domain Of Human Trf2 Length = 67 Back     alignment and structure
>pdb|1VF9|A Chain A, Solution Structure Of Human Trf2 Length = 64 Back     alignment and structure
>pdb|1VFC|A Chain A, Solution Structure Of The Dna Complex Of Human Trf2 Length = 63 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 2e-20
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 9e-20
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-19
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-19
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 3e-15
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 1e-13
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 3e-13
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-11
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 3e-11
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 7e-11
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-09
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 5e-08
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 1e-10
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 1e-10
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 2e-10
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 6e-08
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 9e-08
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 1e-07
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 3e-06
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 9e-07
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 3e-05
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 3e-06
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 5e-06
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 3e-06
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 4e-04
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 1e-05
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-05
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 7e-05
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 2e-04
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 2e-04
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 3e-04
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
 Score = 84.0 bits (208), Expect = 2e-20
 Identities = 21/57 (36%), Positives = 31/57 (54%)

Query: 111 SMPPRKKRKPWTAEEDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRK 167
           S     K++ WT EE   + + VQK GEGNWA I +     +RTA  +  RW  +++
Sbjct: 4   STTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKR 60
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 62 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Length = 86 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query517
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.96
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.96
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.96
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.95
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.95
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.94
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.92
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.81
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.72
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.69
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.66
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.65
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.64
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.63
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.63
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.61
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.59
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.58
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.57
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.54
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.52
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.5
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.49
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.46
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.43
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.42
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.34
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.33
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.32
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.31
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.3
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.29
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.24
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.24
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.88
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.85
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.2
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.2
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.18
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.16
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.16
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.12
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.12
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.07
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.05
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.05
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.0
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 98.98
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.96
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.89
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.87
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.8
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 98.76
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.67
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.64
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.59
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.59
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.53
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.44
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.37
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.36
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.25
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.25
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.19
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.0
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.9
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 97.81
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.69
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.62
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.59
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.55
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.47
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.45
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 97.28
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.26
2crg_A70 Metastasis associated protein MTA3; transcription 97.07
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.96
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.75
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 96.74
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.6
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.5
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 96.47
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.48
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 96.35
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 95.9
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.17
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.07
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 94.5
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.25
2crg_A70 Metastasis associated protein MTA3; transcription 94.03
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 93.52
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 93.5
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 93.08
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 88.71
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=99.96  E-value=1.6e-30  Score=223.06  Aligned_cols=103  Identities=26%  Similarity=0.317  Sum_probs=97.9

Q ss_pred             CCCCCCCHHHHHHHHHHHHHcCCCCcceeecccccccCCchhhhhHHHhhhhccccccCCCCCCCCCCHHHHHHHHHHHH
Q 010139          116 KKRKPWTAEEDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRKKHGNVILGSNSSGSQLSEAQLAARHAMS  195 (517)
Q Consensus       116 kKrg~WT~EEDe~Ll~lV~k~G~gnW~~IAk~~f~pgRT~kQCReRW~nirrr~~~LdP~~IkkgpWT~EED~~Lleav~  195 (517)
                      .++++||+|||++|+++|++||.++|..||..  +++|+++||++||.+      +|+|. +++++||.|||++|+++|.
T Consensus         2 l~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~--l~~Rt~~qcr~Rw~~------~l~p~-~~~~~Wt~eEd~~L~~~~~   72 (105)
T 1gv2_A            2 LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKH--LKGRIGKQCRERWHN------HLNPE-VKKTSWTEEEDRIIYQAHK   72 (105)
T ss_dssp             CCCSCCCHHHHHHHHHHHHHHCTTCHHHHHTT--STTCCHHHHHHHHHH------TTCCC-CCCCCCCHHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcHHHHhhh--hcCCCHHHHHHHHHh------ccCCc-ccccCCCHHHHHHHHHHHH
Confidence            47899999999999999999998899999987  899999999999999      99999 9999999999999999999


Q ss_pred             hhcCCCCCCchhHhhccCCCCCCCCCccccCCCCCCCC
Q 010139          196 LALDMPVKNITASCTNTTAGTTSSATMNNPVPSTANAE  233 (517)
Q Consensus       196 ~al~~G~kk~Ws~IA~~LPGRTdn~~IKNrWns~lr~~  233 (517)
                      .   ||++  |..|+.+|||||+++ |||||+.+++++
T Consensus        73 ~---~G~~--W~~Ia~~l~gRt~~~-~k~rw~~~~~~~  104 (105)
T 1gv2_A           73 R---LGNR--WAEIAKLLPGRTDNA-IKNHWNSTMRRK  104 (105)
T ss_dssp             H---HSSC--HHHHHTTCTTCCHHH-HHHHHHHHTC--
T ss_pred             H---hCCC--HHHHHHHcCCCCHHH-HHHHHHHHHhcc
Confidence            9   9999  999999999999999 999999988875
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 517
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-16
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-13
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 2e-11
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 6e-11
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 6e-10
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 6e-10
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-09
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 4e-08
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 4e-07
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-06
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 1e-05
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 8e-05
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 5e-04
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 0.003
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of telomeric protein
domain: DNA-binding domain of human telomeric protein, hTRF1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 71.8 bits (176), Expect = 1e-16
 Identities = 23/51 (45%), Positives = 30/51 (58%)

Query: 117 KRKPWTAEEDLELISAVQKCGEGNWANILRGDFKWDRTASQLSQRWNILRK 167
           KR+ W  EED  L S V+K GEGNW+ IL      +RT+  L  RW  ++K
Sbjct: 1   KRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKK 51
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query517
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.68
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.67
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.61
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.61
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.56
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.42
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.42
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.36
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.31
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.29
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.21
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.19
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.1
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.05
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.96
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.95
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.82
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.77
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 98.75
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.68
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.67
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.66
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 98.62
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.52
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.37
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.36
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.28
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.76
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.58
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.57
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.24
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 96.18
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.91
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 95.24
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 92.65
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 85.1
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 84.07
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.68  E-value=4.3e-19  Score=147.78  Aligned_cols=70  Identities=14%  Similarity=0.127  Sum_probs=63.5

Q ss_pred             CCCCCHHHHHHHHHHHHHcCCCC-----cceeecccccccCCchhhhhHHHhhhhccccccCCCCCCCCCCHHHHHHHHH
Q 010139          118 RKPWTAEEDLELISAVQKCGEGN-----WANILRGDFKWDRTASQLSQRWNILRKKHGNVILGSNSSGSQLSEAQLAARH  192 (517)
Q Consensus       118 rg~WT~EEDe~Ll~lV~k~G~gn-----W~~IAk~~f~pgRT~kQCReRW~nirrr~~~LdP~~IkkgpWT~EED~~Lle  192 (517)
                      |+.||+|||++|+++|++||...     |..||+.  ++|||++|||+||.+      +|+|. |++++||.+||++|++
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~--lpgRt~~qcr~Rw~~------~L~p~-l~~~~~t~~ed~ll~d   71 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHY--VPNHTGNSIRHRFRV------YLSKR-LEYVYEVDKFGKLVRD   71 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTT--STTSCHHHHHHHHHH------TTGGG-CCCEECBCTTSCBCBC
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHH--cCCCCHHHHHHHHHH------HcCcc-ccCCCCCCchhHHHHH
Confidence            68999999999999999999654     9999987  899999999999999      99999 9999999999998855


Q ss_pred             HHHh
Q 010139          193 AMSL  196 (517)
Q Consensus       193 av~~  196 (517)
                      .+..
T Consensus        72 ~~~~   75 (86)
T d1igna1          72 DDGN   75 (86)
T ss_dssp             TTSC
T ss_pred             Hhhc
Confidence            4443
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure