Citrus Sinensis ID: 010182


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510------
MDPNPKTFPILSFVMQRLPTFGPRTAAEYDVEQPDPSSSGQAQSQKNPVIVDQMPHLSDPKLVSAMRRAIHDVYQTRSVLQTLGPRPDHETIDKTKARIVEIDSELAKSLEGIVHSIRETDVDQFEWRVQLADKEKALREDSAKEKNACKKILELDDMHEAYEKMLKEAEERLVKIYERAENGEEEVPPVREEVNEEVMGLLQEAAGKSLEQVDLSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPDSIAGLVNLEELNLASNLLETLPDSIGLLDNLKILDVSGNKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHFNELHGLPATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALPNTFGRLDKLIKLNLEENPMVIPPVEVVKEGVGAVKTFMAKRWLDILLEEERRSMLKLEGNNNEGEQMPTGWLTRSTSWLKTVGENVSGILGGGNSPRDPCLDQQL
cccccccccHHHHHHHcccccccccccccccccccccccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccHHHHHHHHHHHHHccccccccccccccccHHHHHHcHHHHcccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHHHcccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEccccccccccHHHHHccHHHHHHHHHHcccccccHHHHccccEEEccccccccccHHHHHHHHccccccccccccccccccccccccccccc
ccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHccccHccccHHHcccccccEEcccccHHHHccHHHHHHHHccccccccHHHHcHHHHHHHEcccccccccccHHHHHHHHHHHHHHccccccccccHHHHcccccccHHHHccccHccEEEcccccccccccHHHcccccEEEccccccccccHHHHcHHcccEEEccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccHccccccEEEccccccccccHHHccccccEEEEccccccccccccHHHHHcccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccHHHHHHHccccccccHHHHHccHHHccccccccccccccccHHHHHHHHHcccccccccccccccccccHHccc
mdpnpktfpILSFVMqrlptfgprtaaeydveqpdpsssgqaqsqknpvivdqmphlsdpkLVSAMRRAIHDVYQTRSvlqtlgprpdhetidkTKARIVEIDSELAKSLEGIVHSIRETDVDQFEWRVQLADKEKALREDSAKEKNACKKILELDDMHEAYEKMLKEAEERLVKIYERaengeeevppvreEVNEEVMGLLQEAAGksleqvdlssrglrflpEAFGRIAGLRLMSLSnnhlevipdsiaGLVNLEELNLASNLLEtlpdsiglldnlkildvsgnklsalpdsisHCRSLVELDASFnrlaylptniGHELVNLQKllvplnkirflptsigemASLRHLDAHFNelhglpatigkltNLEILnvssnftdmkelpetfgeltnlkeldlsnnqihalpntFGRLDKLIKLnleenpmvippveVVKEGVGAVKTFMAKRWLDILLEEERRSMLKlegnnnegeqmptgwltrSTSWLKTVGenvsgilgggnsprdpcldqql
MDPNPKTFPILSFVMQRLPTFGPRTAAEYDVEQPDPSSSGQAQSQKNPVIVDQMPHLSDPKLVSAMRRAIHDVYQtrsvlqtlgprpdhetidkTKARIVEIDSELAKSLEGIVHSiretdvdqfeWRVQLADKEkalredsakeknackkilelDDMHEAYEKMLKEAEERLVKIYEraengeeevppvrEEVNEEVMGLLQEAAGKSLEQVDLSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPDSIAGLVNLEELNLASNLLETLPDSIGLLDNLKILDVSGNKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHFNELHGLPATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALPNTFGRLDKLIKLNLEENPMVIPPVEVVKEGVGAVKTFMAKRWLDILLEEERRSMLKLegnnnegeqmptgWLTRSTSWLKTVGENvsgilgggnsprdpcldqql
MDPNPKTFPILSFVMQRLPTFGPRTAAEYDVEQPDPSSSGQAQSQKNPVIVDQMPHLSDPKLVSAMRRAIHDVYQTRSVLQTLGPRPDHETIDKTKARIVEIDSELAKSLEGIVHSIRETDVDQFEWRVQLADKEKALREDSAKEKNACKKILELDDMHEAYEKMLKEAEERLVKIYERAengeeevppvreevneevMGLLQEAAGKSLEQVDLSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPDSIAGlvnleelnlasnlletlPDSIGLLDNLKILDVSGNKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHFNELHGLPATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALPNTFGRLDKLIKLNLEENPMvippvevvkegvgavkTFMAKRWLDILLEEERRSMLKLEGNNNEGEQMPTGWLTRSTSWLKTVGENVSGILGGGNSPRDPCLDQQL
********PILSFVMQRLPT********************************************AMRRAIHDVYQTRSVLQTL***********TKARIVEIDSELAKSLEGIVHSIRETDVDQFEWRVQLA*******************IL*************************************************************LSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPDSIAGLVNLEELNLASNLLETLPDSIGLLDNLKILDVSGNKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHFNELHGLPATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALPNTFGRLDKLIKLNLEENPMVIPPVEVVKEGVGAVKTFMAKRWLDILLE*********************GWLTRSTSWLKTVGENVSGIL***************
***NPKTFPILSFVMQRLP**********************************MPHLSDPKLVSAMRRAIHDVYQTRSVLQTLGPRPDHETIDKTKARIVEIDSE****L*****SIRETDVDQFEWRVQLADKEKALREDSAKEKNACKKILELDDMHEAYEKMLKEAEERLVKIYERAENGEEEVPPVREEVNEEVMGLLQEAAGKSLEQVDLSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPDSIAGLVNLEELNLASNLLETLPDSIGLLDNLKILDVSGNKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHFNELHGLPATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALPNTFGRLDKLIKLNLEENPMVIPPVEVVKEGVGAVKTFMAKRWLDIL***ERRSMLKLEGNNNEGEQMPTGWLTRSTSWLKTVGEN*********S**DPCLDQQ*
MDPNPKTFPILSFVMQRLPTFGPRTAAE******************NPVIVDQMPHLSDPKLVSAMRRAIHDVYQTRSVLQTLGPRPDHETIDKTKARIVEIDSELAKSLEGIVHSIRETDVDQFEWRVQLADKEKALREDSAKEKNACKKILELDDMHEAYEKMLKEAEERLVKIYERAE*********REEVNEEVMGLLQEAAGKSLEQVDLSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPDSIAGLVNLEELNLASNLLETLPDSIGLLDNLKILDVSGNKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHFNELHGLPATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALPNTFGRLDKLIKLNLEENPMVIPPVEVVKEGVGAVKTFMAKRWLDILLEEERRSMLKLEGNNNEGEQMPTGWLTRSTSWLKTVGENVSGILGGGNSPRDPCLDQQL
****PKTFPILSFVMQRLPT*****************SSGQAQSQKNPVIVDQMPHLSDPKLVSAMRRAIHDVYQTRSVLQTLGPRPDHETIDKTKARIVEIDSELAKSLEGIVHSIRETDVDQFEWRVQLADKEKALREDSAKEKNACKKILELDDMHEAYEKMLKEAEERLVKIYERAENGEEEVPPVREEVNEEVMGLLQEAAGKSLEQVDLSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPDSIAGLVNLEELNLASNLLETLPDSIGLLDNLKILDVSGNKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHFNELHGLPATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALPNTFGRLDKLIKLNLEENPMVIPPVEVVKEGVGAVKTFMAKRWLDILLEEERRSMLKLEGNNNEGEQMPTGWLTRSTSWLKTVGENVSGILGGGNSPRDPC*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPNPKTFPILSFVMQRLPTFGPRTAAEYDVEQPDPSSSGQAQSQKNPVIVDQMPHLSDPKLVSAMRRAIHDVYQTRSVLQTLGPRPDHETIDKTKARIVEIDSELAKSLEGIVHSIRETDVDQFEWRVQLADKEKALREDSAKEKNACKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVPPVREEVNEEVMGLLQEAAGKSLEQVDLSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPDSIAGLVNLEELNLASNLLETLPDSIGLLDNLKILDVSGNKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHFNELHGLPATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALPNTFGRLDKLIKLNLEENPMVIPPVEVVKEGVGAVKTFMAKRWLDILLEEERRSMLKLEGNNNEGEQMPTGWLTRSTSWLKTVGENVSGILGGGNSPRDPCLDQQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query516 2.2.26 [Sep-21-2011]
O61967 699 Protein lap1 OS=Caenorhab yes no 0.441 0.326 0.389 7e-32
Q96NW7 1537 Leucine-rich repeat-conta yes no 0.441 0.148 0.358 2e-29
Q96RT1 1412 Protein LAP2 OS=Homo sapi no no 0.441 0.161 0.346 3e-29
Q80TE7 1490 Leucine-rich repeat-conta yes no 0.420 0.145 0.362 7e-29
F1MCA7 1536 Leucine-rich repeat-conta yes no 0.441 0.148 0.347 8e-29
P70587 1490 Leucine-rich repeat-conta yes no 0.420 0.145 0.362 9e-29
Q80TH2 1402 Protein LAP2 OS=Mus muscu no no 0.441 0.162 0.338 2e-28
Q5F4C4 529 Leucine-rich repeat prote no no 0.567 0.553 0.304 6e-28
Q9BTT6 524 Leucine-rich repeat-conta no no 0.453 0.446 0.347 9e-28
Q9Y4C4 1052 Malignant fibrous histioc no no 0.558 0.273 0.305 1e-27
>sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 Back     alignment and function desciption
 Score =  139 bits (349), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 90/231 (38%), Positives = 130/231 (56%), Gaps = 3/231 (1%)

Query: 209 SLEQVDLSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPDSIAGLVNLEELNLASNLLET 268
           S+  + L+   L  LP   G +  LR++   +N L  IP SI  L  LEEL+L  N LE 
Sbjct: 129 SITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEA 188

Query: 269 LPDSIGLLDNLKILDVSGNKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQK 328
           LP  IG L +L+   V  N L++LPDSIS CR L +LD S N++  LP N+G  + NL  
Sbjct: 189 LPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLG-RMPNLTD 247

Query: 329 LLVPLNKIRFLPTSIGEMASLRHLDAHFNELHGLPATIGKLTNLEILNVSSNFTDMKELP 388
           L + +N+I  LP+S GE+  L+ L A  N LH L + IGK  +L  L +  NF  + +LP
Sbjct: 248 LNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNF--LTDLP 305

Query: 389 ETFGELTNLKELDLSNNQIHALPNTFGRLDKLIKLNLEENPMVIPPVEVVK 439
           +T G+L  L  L++  N +  +P+T G    L  L+L +N +   P+ + K
Sbjct: 306 DTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGK 356




Critical role in assembling adherens junctions; adapter protein involved in polarizing protein trafficking in epithelial cells. Necessary to maintain, not establish, the entire terminal web (organelle-depleted, intermediate filament-rich layer of cytoplasm that underlies the apical microvilli of polarized epithelial cells) or brush border assembly at the apical surface gut cells. Required for correct localization of ifb-2 intermediate filaments in the terminal web.
Caenorhabditis elegans (taxid: 6239)
>sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 Back     alignment and function description
>sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 Back     alignment and function description
>sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 Back     alignment and function description
>sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 Back     alignment and function description
>sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 Back     alignment and function description
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query516
255540519519 leucine-rich repeat-containing protein, 0.988 0.982 0.645 0.0
449440622523 PREDICTED: leucine-rich repeat-containin 0.988 0.975 0.622 0.0
225456898517 PREDICTED: leucine-rich repeat protein S 0.982 0.980 0.655 1e-174
356508718513 PREDICTED: leucine-rich repeat protein S 0.976 0.982 0.603 1e-172
224133674515 predicted protein [Populus trichocarpa] 0.972 0.974 0.616 1e-171
357461813510 Leucine-rich-repeat protein [Medicago tr 0.961 0.972 0.570 1e-163
356513766511 PREDICTED: uncharacterized protein LOC10 0.972 0.982 0.571 1e-162
297810689506 leucine-rich repeat family protein [Arab 0.965 0.984 0.573 1e-151
22330985499 ras group-related LRR 9 protein [Arabido 0.945 0.977 0.569 1e-151
15239256506 plant intracellular ras group-related LR 0.965 0.984 0.567 1e-150
>gi|255540519|ref|XP_002511324.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223550439|gb|EEF51926.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/525 (64%), Positives = 423/525 (80%), Gaps = 15/525 (2%)

Query: 1   MDPNPKTFPILSFVMQRLPTFGPRTAAE---YDVEQPDPSSSGQAQSQKNPVIVDQMPHL 57
           M+PNPK+FPILS+VM RLP+FGP++++    +D+EQP P  +    S     I  Q+PHL
Sbjct: 1   MEPNPKSFPILSYVMARLPSFGPKSSSSETSFDIEQPPPPRAPSDPSASQTPITSQLPHL 60

Query: 58  SDPKLVSAMRRAIHDVYQTRSVLQTLGPRPDHETIDKTKARIVEIDSELAKSLEGIVHSI 117
           +DPKL+++M RAI DV QTRSVLQTLGPRPDHET+D  + ++ EI+S+L+K LE IV S 
Sbjct: 61  TDPKLLASMTRAISDVSQTRSVLQTLGPRPDHETVDNARIKLAEIESDLSKQLEEIVLSP 120

Query: 118 RETDVDQFEWRVQLADKEKALREDSAKEKNACKKILELDDMHEAYEKMLKEAEERLVKIY 177
           R  +V++ EWR  LADKE+  R+ + KEKN CK +L+LD+MH  Y++MLK+AE+RLV+IY
Sbjct: 121 RPAEVERLEWRSHLADKEQECRKSAEKEKNLCKMVLQLDEMHAEYDRMLKDAEKRLVQIY 180

Query: 178 ERAENGEEE-VPPVREEVNEEVMGLLQEAAGKSLEQVDLSSRGLRFLPEAFGRIAGLRLM 236
           ERAE GE+E      EEVNEEV+G+++EA+G+ LE+VDLS+R LRFLPEAF RI+GL+++
Sbjct: 181 ERAERGEDEDNHKDNEEVNEEVVGIMKEASGRVLERVDLSNRRLRFLPEAFCRISGLKVL 240

Query: 237 SLSNNHLEVIPDSIAGLVNLEELNLASNLLETLPDSIGLLDNLKILDVSGNKLSALPDSI 296
            LSNN LEVIPDSIAGL NL+ELNLASNLLE LPD IGLL NLK+L+VS NKL +LPDSI
Sbjct: 241 DLSNNQLEVIPDSIAGLENLDELNLASNLLEALPDFIGLLVNLKVLNVSSNKLESLPDSI 300

Query: 297 SHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHF 356
           SHCRSL+ELD SFNRL YLPTNIG+ELVN+++L + LNKIR LPTSIGEM SL+HLDAHF
Sbjct: 301 SHCRSLLELDVSFNRLTYLPTNIGYELVNVKRLSIQLNKIRSLPTSIGEMRSLQHLDAHF 360

Query: 357 NELHGLPATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALPNTFGR 416
           NEL GLP + G+L NLEIL +SSNF+D+KELP+T G+LTNLKELDLSNNQI  LP++FGR
Sbjct: 361 NELQGLPLSFGRLINLEILKLSSNFSDLKELPDTLGDLTNLKELDLSNNQIETLPDSFGR 420

Query: 417 LDKLIKLNLEENPMVIPPVEVVKEGVGAVKTFMAKRWLDILLEEERRSMLKLEGNNNEGE 476
           LD L KLNL++NP+++PP EVVKEGV AVK FMAKRWLDIL+EEER+SM++++      E
Sbjct: 421 LDNLTKLNLDQNPLILPPPEVVKEGVEAVKIFMAKRWLDILVEEERKSMVEVQ------E 474

Query: 477 QMPTGWLTRSTSWLKT----VGENVSGILG-GGNSPRDPCLDQQL 516
           Q  +GWLTRSTSWLK+    V ENVS  L     SPRD  L+QQL
Sbjct: 475 QAQSGWLTRSTSWLKSYAANVTENVSEYLSPRSRSPRDSYLNQQL 519




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449440622|ref|XP_004138083.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] gi|449526497|ref|XP_004170250.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225456898|ref|XP_002280677.1| PREDICTED: leucine-rich repeat protein SHOC-2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356508718|ref|XP_003523101.1| PREDICTED: leucine-rich repeat protein SHOC-2-like [Glycine max] Back     alignment and taxonomy information
>gi|224133674|ref|XP_002321633.1| predicted protein [Populus trichocarpa] gi|222868629|gb|EEF05760.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357461813|ref|XP_003601188.1| Leucine-rich-repeat protein [Medicago truncatula] gi|355490236|gb|AES71439.1| Leucine-rich-repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356513766|ref|XP_003525581.1| PREDICTED: uncharacterized protein LOC100782818 [Glycine max] Back     alignment and taxonomy information
>gi|297810689|ref|XP_002873228.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297319065|gb|EFH49487.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22330985|ref|NP_187741.2| ras group-related LRR 9 protein [Arabidopsis thaliana] gi|18175638|gb|AAL59901.1| unknown protein [Arabidopsis thaliana] gi|21689861|gb|AAM67491.1| unknown protein [Arabidopsis thaliana] gi|57868160|gb|AAW57418.1| plant intracellular Ras-group-related LRR protein 9 [Arabidopsis thaliana] gi|332641510|gb|AEE75031.1| ras group-related LRR 9 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15239256|ref|NP_196204.1| plant intracellular ras group-related LRR 1 [Arabidopsis thaliana] gi|9759110|dbj|BAB09679.1| unnamed protein product [Arabidopsis thaliana] gi|53850485|gb|AAU95419.1| At5g05850 [Arabidopsis thaliana] gi|55733731|gb|AAV59262.1| At5g05850 [Arabidopsis thaliana] gi|57868144|gb|AAW57410.1| plant intracellular Ras-group-related LRR protein 1 [Arabidopsis thaliana] gi|110737851|dbj|BAF00864.1| hypothetical protein [Arabidopsis thaliana] gi|332003549|gb|AED90932.1| plant intracellular ras group-related LRR 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query516
TAIR|locus:2166429506 PIRL1 "plant intracellular ras 0.963 0.982 0.520 1.6e-127
TAIR|locus:2074728499 PIRL9 "plant intracellular ras 0.949 0.981 0.520 1.4e-126
TAIR|locus:2010326464 PIRL3 "AT1G12970" [Arabidopsis 0.730 0.812 0.431 9.7e-80
TAIR|locus:2088807471 PIRL2 "AT3G26500" [Arabidopsis 0.701 0.768 0.428 4.3e-77
TAIR|locus:2117617549 PIRL4 "plant intracellular ras 0.428 0.402 0.400 1.4e-42
TAIR|locus:2047595380 PIRL6 "AT2G19330" [Arabidopsis 0.428 0.581 0.468 1.1e-41
TAIR|locus:2827587526 PIRL5 "AT2G17440" [Arabidopsis 0.428 0.420 0.400 1.2e-41
TAIR|locus:2123899373 PIRL7 "plant intracellular ras 0.428 0.592 0.468 2.8e-41
TAIR|locus:2120825383 PIRL8 "AT4G26050" [Arabidopsis 0.432 0.582 0.424 3.7e-39
WB|WBGene00002632 699 let-413 [Caenorhabditis elegan 0.420 0.310 0.354 1.3e-25
TAIR|locus:2166429 PIRL1 "plant intracellular ras group-related LRR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1252 (445.8 bits), Expect = 1.6e-127, P = 1.6e-127
 Identities = 269/517 (52%), Positives = 349/517 (67%)

Query:     4 NPKTFPILSFVMQRLPTFGPRTAAEYDVEQPDPSSSGQAQSQKNPV-IVDQMPHLSDPKL 62
             NPK FP+LS+V+ RLP+F  ++++  DVE P PS S  + S  + + IV QMPHL+ P +
Sbjct:     6 NPKNFPVLSYVLDRLPSFTAKSSSSSDVEPP-PSKSDPSSSSNHSIEIVTQMPHLAHPDV 64

Query:    63 VSAMRRAIHDVYQTRSVLQTLGPRPDHETIDKTKARIVEIDSELAKSLEGIVHSIRETDV 122
             +++M  A  DV QTRSVL+TLGPRPDHET+D+ +AR+ EID+ L++S E I  ++   D+
Sbjct:    65 LASMTNATADVSQTRSVLRTLGPRPDHETVDRARARLREIDASLSESFEEI--ALSPNDI 122

Query:   123 DQFEWRVQLADKEKALREDSAKEKNACKKILELDDMHEAYEKMLKEAEERLVKIYERAXX 182
             D       +A+KE+  RE   +EK   K IL+L+++HE+YEK+LKEAEERLV+IYE A  
Sbjct:   123 D-------VAEKEQKRREAVEQEKIWYKSILKLNELHESYEKLLKEAEERLVRIYESAEK 175

Query:   183 XXXXXXXXXXXXXXXX---MGLLQEAAGKSLEQVDLSSRGLRFLPEAFGRIAGLRLMSLS 239
                                + +LQ+AA   L++VDLS R L+ LPEAFG+I GL +++L 
Sbjct:   176 NAAAVAEEEAAEVEVNEEVVSILQQAAENPLDRVDLSGRKLKLLPEAFGKIQGLLVLNLY 235

Query:   240 NNHLEVIPDSIAGXXXXXXXXXXXXXXXXXPDSIGLLDNLKILDVSGNKLSALPDSISHC 299
             NN L+ IPDSIAG                 PDSIGLL  LKIL+VS NKL+ LPDSI HC
Sbjct:   236 NNQLQAIPDSIAGLHNLLELDVSTNFLETLPDSIGLLSKLKILNVSCNKLTTLPDSICHC 295

Query:   300 RSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHFNEL 359
              SLV LDAS+N L YLPTNIG ELV L+KLL+ LNKIR LPTSIGEM SLR+LDAHFNEL
Sbjct:   296 GSLVVLDASYNNLTYLPTNIGFELVKLEKLLIHLNKIRSLPTSIGEMRSLRYLDAHFNEL 355

Query:   360 HGLPATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALPNTFGRLDK 419
             +GLP + G LTNLE LN+SSNF+D+++LP +FG+L +L+ELDLSNNQIH+LP+ FG L  
Sbjct:   356 NGLPNSFGLLTNLEYLNLSSNFSDLQDLPASFGDLISLQELDLSNNQIHSLPDAFGTLVN 415

Query:   420 LIKLNLEENPMXXXXXXXXXXXXXXXXTFMAKRWLDILLEEERRSMLKLEGNNNEGEQMP 479
             L KLNL++NP+                 +M KRW+ +L EEE+ + +K     +E +Q  
Sbjct:   416 LTKLNLDQNPLVVPPDEVVKQGVDAVKMYMGKRWVSMLEEEEKMANMK-----DEMDQTN 470

Query:   480 TGWLTRSTSWLKTVGENVSGILGGGNSPRDPCLDQQL 516
             T WLTR+TS LKT    VS  LG  N PRDP LDQQL
Sbjct:   471 TDWLTRTTSKLKTYVTEVSEYLGS-NPPRDPYLDQQL 506




GO:0005634 "nucleus" evidence=ISM
GO:0009555 "pollen development" evidence=IGI
GO:0055046 "microgametogenesis" evidence=IGI
GO:0009693 "ethylene biosynthetic process" evidence=RCA
TAIR|locus:2074728 PIRL9 "plant intracellular ras group-related LRR 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010326 PIRL3 "AT1G12970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088807 PIRL2 "AT3G26500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117617 PIRL4 "plant intracellular ras group-related LRR 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047595 PIRL6 "AT2G19330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827587 PIRL5 "AT2G17440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123899 PIRL7 "plant intracellular ras group-related LRR 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120825 PIRL8 "AT4G26050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00002632 let-413 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query516
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-19
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-13
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-07
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 5e-06
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 8e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 3e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 4e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.003
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 93.1 bits (231), Expect = 2e-20
 Identities = 71/222 (31%), Positives = 114/222 (51%), Gaps = 4/222 (1%)

Query: 214 DLSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPDSIAGLVNLEELNLASNLLETLPDSI 273
           +LSS  L  LP +  R+  L L+S S        +++  L+ L  L+L  N L +    +
Sbjct: 53  NLSSNTLLLLPSSLSRLLSLDLLSPSGISSLDGSENLLNLLPLPSLDLNLNRLRSNISEL 112

Query: 274 GLLDNLKILDVSGNKLSALPDSISH-CRSLVELDASFNRLAYLPTNIGHELVNLQKLLVP 332
             L NL  LD+  N ++ +P  I     +L ELD S N++  LP+ + + L NL+ L + 
Sbjct: 113 LELTNLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPLRN-LPNLKNLDLS 171

Query: 333 LNKIRFLPTSIGEMASLRHLDAHFNELHGLPATIGKLTNLEILNVSSNFTDMKELPETFG 392
            N +  LP  +  +++L +LD   N++  LP  I  L+ LE L++S+N   + EL  +  
Sbjct: 172 FNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLSNN--SIIELLSSLS 229

Query: 393 ELTNLKELDLSNNQIHALPNTFGRLDKLIKLNLEENPMVIPP 434
            L NL  L+LSNN++  LP + G L  L  L+L  N +    
Sbjct: 230 NLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSIS 271


Length = 394

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 516
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.87
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
KOG0617264 consensus Ras suppressor protein (contains leucine 99.78
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.77
KOG4237498 consensus Extracellular matrix protein slit, conta 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.69
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.55
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.5
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.47
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.43
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.43
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.42
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.41
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.4
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.34
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.3
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.28
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.27
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.27
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.14
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.07
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.93
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.88
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.73
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.69
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.58
PLN03150623 hypothetical protein; Provisional 98.55
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.52
PLN03150623 hypothetical protein; Provisional 98.51
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.5
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.48
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.47
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.42
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.37
PRK15386426 type III secretion protein GogB; Provisional 98.33
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.33
PRK15386 426 type III secretion protein GogB; Provisional 98.18
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.14
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.06
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.05
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.85
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.85
KOG4341483 consensus F-box protein containing LRR [General fu 97.79
KOG4308478 consensus LRR-containing protein [Function unknown 97.58
KOG4308478 consensus LRR-containing protein [Function unknown 97.49
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.3
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.26
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.24
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.09
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.05
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.88
KOG4341483 consensus F-box protein containing LRR [General fu 96.65
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.34
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.94
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.0
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.57
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.29
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.14
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.48
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.68
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.24
smart0037026 LRR Leucine-rich repeats, outliers. 89.04
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.04
smart0037026 LRR Leucine-rich repeats, outliers. 88.21
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.21
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 87.02
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.59
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.36
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.94  E-value=1.2e-26  Score=267.24  Aligned_cols=228  Identities=33%  Similarity=0.446  Sum_probs=168.6

Q ss_pred             CCCccEEEeecCCCC-cchHhhcCCCCCcEEEeecCCCC-CcchhhcCCCCccEEEeeCCCCC-CcchhhcCCCCCcEEE
Q 010182          207 GKSLEQVDLSSRGLR-FLPEAFGRIAGLRLMSLSNNHLE-VIPDSIAGLVNLEELNLASNLLE-TLPDSIGLLDNLKILD  283 (516)
Q Consensus       207 ~~~L~~L~L~~~~l~-~l~~~~~~l~~L~~L~Ls~n~l~-~l~~~l~~l~~L~~L~Ls~n~l~-~l~~~l~~l~~L~~L~  283 (516)
                      .++|++|++++|.+. .+|..++.+++|++|++++|.+. .+|..+.++++|++|++++|.+. .+|..++.+++|++|+
T Consensus       139 l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  218 (968)
T PLN00113        139 IPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIY  218 (968)
T ss_pred             cCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEE
Confidence            356777777777776 56677777888888888888765 56777778888888888888776 5667777788888888


Q ss_pred             eeCCCCC-CCCcccccCCCCcEEeCCCCCCCcCChhhhhcCCCCcEEecCCCCCc-cccchhcCCCCCcEEEccCCCCCC
Q 010182          284 VSGNKLS-ALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIR-FLPTSIGEMASLRHLDAHFNELHG  361 (516)
Q Consensus       284 Ls~n~l~-~l~~~l~~l~~L~~L~L~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~-~l~~~l~~l~~L~~L~Ls~n~l~~  361 (516)
                      +++|.+. .+|..++.+++|++|++++|.++......+..+++|+.|++++|.+. .+|..+..+++|++|++++|.+++
T Consensus       219 L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~  298 (968)
T PLN00113        219 LGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSG  298 (968)
T ss_pred             CcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeecc
Confidence            8888776 56777777888888888888776443344456778888888888775 566677777788888888887765


Q ss_pred             -cchhhCCCCCCcEEEcccCCCCCCCcchhhcCCCCccEEeccCCCCC-CchhhhcCCCcccEEecccCCCCCCCH
Q 010182          362 -LPATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIH-ALPNTFGRLDKLIKLNLEENPMVIPPV  435 (516)
Q Consensus       362 -l~~~l~~l~~L~~L~L~~n~~~~~~l~~~l~~l~~L~~L~L~~n~i~-~lp~~l~~l~~L~~L~L~~N~l~~~~~  435 (516)
                       +|..+..+++|+.|++++|.+. ..+|..+..+++|+.|++++|.++ .+|..+..+++|+.|++++|.+....+
T Consensus       299 ~~p~~~~~l~~L~~L~l~~n~~~-~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p  373 (968)
T PLN00113        299 EIPELVIQLQNLEILHLFSNNFT-GKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIP  373 (968)
T ss_pred             CCChhHcCCCCCcEEECCCCccC-CcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCC
Confidence             6777777788888888877654 455667777788888888888776 466777777888888888887764433



>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query516
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-14
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-12
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 2e-12
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 4e-10
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-08
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-08
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-07
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-06
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-06
2z64_A 599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 1e-06
3vq1_A 606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 1e-06
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 3e-06
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 1e-05
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 4e-05
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 5e-05
2z7x_A 549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 6e-05
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 7e-05
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 7e-05
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 8e-05
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 9e-05
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 1e-04
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 1e-04
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 1e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-04
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 2e-04
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-04
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-04
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 2e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 3e-04
2z81_A 549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 3e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 3e-04
3fxi_A 605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 4e-04
3a79_A 580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 3e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 3e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 4e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 5e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 5e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 5e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 5e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 6e-04
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 6e-04
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 6e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 7e-04
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Iteration: 1

Score = 77.8 bits (190), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 72/224 (32%), Positives = 107/224 (47%), Gaps = 52/224 (23%) Query: 211 EQVDLSSRGLRFLP-EAFGRIAGLRLMSLSNNHLEVIPDSIAGXXXXXXXXXXXXXXXXX 269 +++DL S L LP +AF R+ LRL+ L++N L+ +P I Sbjct: 40 KKLDLQSNKLSSLPSKAFHRLTKLRLLYLNDNKLQTLPAGIFKE---------------- 83 Query: 270 PDSIGLLDNLKILDVSGNKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKL 329 L NL+ L V+ NKL A LP + +LVNL +L Sbjct: 84 ------LKNLETLWVTDNKLQA-----------------------LPIGVFDQLVNLAEL 114 Query: 330 LVPLNKIRFLPTSIGE-MASLRHLDAHFNELHGLP-ATIGKLTNLEILNVSSNFTDMKEL 387 + N+++ LP + + + L +L +NEL LP KLT+L+ L + +N +K + Sbjct: 115 RLDRNQLKSLPPRVFDSLTKLTYLSLGYNELQSLPKGVFDKLTSLKELRLYNN--QLKRV 172 Query: 388 PE-TFGELTNLKELDLSNNQIHALP-NTFGRLDKLIKLNLEENP 429 PE F +LT LK L L NNQ+ +P F L+KL L L+ENP Sbjct: 173 PEGAFDKLTELKTLKLDNNQLKRVPEGAFDSLEKLKMLQLQENP 216
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query516
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-66
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-63
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-55
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-50
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-55
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-49
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-48
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-44
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-35
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-33
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-45
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-41
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-43
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-43
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-36
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-44
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-40
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-44
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-43
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-42
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-39
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-38
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-38
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-34
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-41
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-38
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-30
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-28
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-41
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-31
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-40
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-38
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-35
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-34
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-32
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-25
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-39
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-39
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-37
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-32
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-26
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-39
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-37
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-30
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-35
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-39
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-29
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-39
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-38
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-30
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-38
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-38
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-36
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-31
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-38
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-37
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-27
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-37
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-36
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-37
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-33
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-37
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-34
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-35
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-35
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-33
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-36
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-33
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-32
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-30
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-33
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-32
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-30
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-28
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-34
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-30
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-28
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-33
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-30
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-28
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-33
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-28
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-32
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-29
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-31
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-26
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-31
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-23
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-30
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-29
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-29
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-28
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-27
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-29
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-23
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-23
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-28
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-28
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-20
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-18
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-28
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-25
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-27
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-27
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-26
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-26
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-26
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-24
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-23
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-25
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-25
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-22
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-23
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-22
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-15
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-21
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-20
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-19
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-16
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-15
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-13
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-11
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-10
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-10
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-09
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 3e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 8e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  216 bits (553), Expect = 2e-66
 Identities = 65/234 (27%), Positives = 98/234 (41%), Gaps = 13/234 (5%)

Query: 209 SLEQVDLSSRGLRFLPEAFGRIA--GLRLMSLSNNHLEVIPDSIAGLVNLEELNLASNLL 266
           + +    + R L+   +        G   + L +  L   PD    L +L+ + + +  L
Sbjct: 57  NPQIETRTGRALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGL 116

Query: 267 ETLPDSIGLLDNLKILDVSGNKLSALPDSISHCRSLVELDAS-FNRLAYLPTNIG----- 320
             LPD++     L+ L ++ N L ALP SI+    L EL       L  LP  +      
Sbjct: 117 MELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDAS 176

Query: 321 ---HELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHFNELHGLPATIGKLTNLEILNV 377
                LVNLQ L +    IR LP SI  + +L+ L    + L  L   I  L  LE L++
Sbjct: 177 GEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDL 236

Query: 378 SSNFTDMKELPETFGELTNLKELDLSN-NQIHALPNTFGRLDKLIKLNLEENPM 430
               T ++  P  FG    LK L L + + +  LP    RL +L KL+L     
Sbjct: 237 RGC-TALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVN 289


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query516
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.93
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.76
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.76
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.75
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.63
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.54
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.29
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.91
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.88
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.86
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.72
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.71
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.7
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.58
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.17
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.04
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.04
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.98
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.95
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.93
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.47
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.69
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.41
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.96  E-value=5.8e-28  Score=244.32  Aligned_cols=264  Identities=20%  Similarity=0.255  Sum_probs=174.4

Q ss_pred             CCCccEEEeecCCCCcchHhhcCCCCCcEEEeecCCCCCcchhhcCCCCccEEEeeCCCCCCcchhhcCCCCCcEEEeeC
Q 010182          207 GKSLEQVDLSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPDSIAGLVNLEELNLASNLLETLPDSIGLLDNLKILDVSG  286 (516)
Q Consensus       207 ~~~L~~L~L~~~~l~~l~~~~~~l~~L~~L~Ls~n~l~~l~~~l~~l~~L~~L~Ls~n~l~~l~~~l~~l~~L~~L~Ls~  286 (516)
                      .++|++|++++|.++.++. +..+++|++|++++|.++.++ .+..+++|++|++++|.++.++. +..+++|++|++++
T Consensus        65 ~~~L~~L~l~~n~i~~~~~-~~~l~~L~~L~L~~n~i~~~~-~~~~l~~L~~L~l~~n~i~~~~~-~~~l~~L~~L~l~~  141 (347)
T 4fmz_A           65 LTNLEYLNLNGNQITDISP-LSNLVKLTNLYIGTNKITDIS-ALQNLTNLRELYLNEDNISDISP-LANLTKMYSLNLGA  141 (347)
T ss_dssp             CTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCCCCG-GGTTCTTCSEEECTTSCCCCCGG-GTTCTTCCEEECTT
T ss_pred             cCCccEEEccCCccccchh-hhcCCcCCEEEccCCcccCch-HHcCCCcCCEEECcCCcccCchh-hccCCceeEEECCC
Confidence            3567777777777776655 667777777777777776663 46677777777777777776655 66677777777777


Q ss_pred             CCCCCCCcccccCCCCcEEeCCCCCCCcCChhhhhcCCCCcEEecCCCCCccccchhcCCCCCcEEEccCCCCCCcchhh
Q 010182          287 NKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDAHFNELHGLPATI  366 (516)
Q Consensus       287 n~l~~l~~~l~~l~~L~~L~L~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~Ls~n~l~~l~~~l  366 (516)
                      |........+..+++|++|++++|.+..++.  +..+++|+.|++++|.+..++. +..+++|+.|++++|.+++++. +
T Consensus       142 n~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~--~~~l~~L~~L~l~~n~l~~~~~-~~~l~~L~~L~l~~n~l~~~~~-~  217 (347)
T 4fmz_A          142 NHNLSDLSPLSNMTGLNYLTVTESKVKDVTP--IANLTDLYSLSLNYNQIEDISP-LASLTSLHYFTAYVNQITDITP-V  217 (347)
T ss_dssp             CTTCCCCGGGTTCTTCCEEECCSSCCCCCGG--GGGCTTCSEEECTTSCCCCCGG-GGGCTTCCEEECCSSCCCCCGG-G
T ss_pred             CCCcccccchhhCCCCcEEEecCCCcCCchh--hccCCCCCEEEccCCccccccc-ccCCCccceeecccCCCCCCch-h
Confidence            7433333446666777777777777666554  3357777777777777776654 6666667777777776666544 6


Q ss_pred             CCCCCCcEEEcccCCCCCCCcchhhcCCCCccEEeccCCCCCCchhhhcCCCcccEEecccCCCCCCCHHHHhchhHHHH
Q 010182          367 GKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALPNTFGRLDKLIKLNLEENPMVIPPVEVVKEGVGAVK  446 (516)
Q Consensus       367 ~~l~~L~~L~L~~n~~~~~~l~~~l~~l~~L~~L~L~~n~i~~lp~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~~~~~~  446 (516)
                      ..+++|++|++++|.+  ..++. +..+++|++|++++|.++.++ .+..+++|+.|++++|.++..+            
T Consensus       218 ~~~~~L~~L~l~~n~l--~~~~~-~~~l~~L~~L~l~~n~l~~~~-~~~~l~~L~~L~l~~n~l~~~~------------  281 (347)
T 4fmz_A          218 ANMTRLNSLKIGNNKI--TDLSP-LANLSQLTWLEIGTNQISDIN-AVKDLTKLKMLNVGSNQISDIS------------  281 (347)
T ss_dssp             GGCTTCCEEECCSSCC--CCCGG-GTTCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCSSCCCCCG------------
T ss_pred             hcCCcCCEEEccCCcc--CCCcc-hhcCCCCCEEECCCCccCCCh-hHhcCCCcCEEEccCCccCCCh------------
Confidence            6667777777777743  34443 666777777777777777663 5667777777777777776542            


Q ss_pred             HHHhhhhhhHhHHHhhhcccccccccCCCCCCCCccccccccEEEccCCccccccC
Q 010182          447 TFMAKRWLDILLEEERRSMLKLEGNNNEGEQMPTGWLTRSTSWLKTVGENVSGILG  502 (516)
Q Consensus       447 ~~~~~~~l~~~~~~~~l~~l~L~~N~i~~~~~~~~~~~~~l~~l~l~~N~ls~~~~  502 (516)
                               .+...++++.+++++|++++..+..+...+++..|++++|++++..+
T Consensus       282 ---------~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~  328 (347)
T 4fmz_A          282 ---------VLNNLSQLNSLFLNNNQLGNEDMEVIGGLTNLTTLFLSQNHITDIRP  328 (347)
T ss_dssp             ---------GGGGCTTCSEEECCSSCCCGGGHHHHHTCTTCSEEECCSSSCCCCGG
T ss_pred             ---------hhcCCCCCCEEECcCCcCCCcChhHhhccccCCEEEccCCccccccC
Confidence                     11234566777777777776655555566677777777777776655



>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 516
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-23
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-18
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-17
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-16
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-12
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-10
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-10
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-10
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-09
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-09
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-08
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-08
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-08
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-06
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-06
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 4e-05
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 99.3 bits (246), Expect = 3e-23
 Identities = 47/195 (24%), Positives = 88/195 (45%), Gaps = 14/195 (7%)

Query: 235 LMSLSNNHLEVIPDSIAGLVNLEELNLASNLLETLPDSIGLLDNLKILDVSGNKLSALPD 294
           L++ +N   ++ P  I    NL+EL+L  N L+ +  ++  L NL  LD++ N++S L  
Sbjct: 202 LIATNNQISDITPLGIL--TNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLA- 257

Query: 295 SISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRFLPTSIGEMASLRHLDA 354
            +S    L EL    N+++ +    G   +   +            + I  + +L +L  
Sbjct: 258 PLSGLTKLTELKLGANQISNISPLAGLTALTNLE---LNENQLEDISPISNLKNLTYLTL 314

Query: 355 HFNELHGLPATIGKLTNLEILNVSSN-FTDMKELPETFGELTNLKELDLSNNQIHALPNT 413
           +FN +  +   +  LT L+ L  ++N  +D      +   LTN+  L   +NQI  L   
Sbjct: 315 YFNNISDISP-VSSLTKLQRLFFANNKVSD----VSSLANLTNINWLSAGHNQISDLTP- 368

Query: 414 FGRLDKLIKLNLEEN 428
              L ++ +L L + 
Sbjct: 369 LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query516
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.61
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.61
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.41
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.33
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.25
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.21
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.21
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.87
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.91  E-value=2.2e-23  Score=204.56  Aligned_cols=264  Identities=23%  Similarity=0.266  Sum_probs=213.1

Q ss_pred             CccEEEeecCCCCcchHhhcCCCCCcEEEeecCCCCCcch-hhcCCCCccEEEeeCCCCCCcc-hhhcCCCCCcEEEeeC
Q 010182          209 SLEQVDLSSRGLRFLPEAFGRIAGLRLMSLSNNHLEVIPD-SIAGLVNLEELNLASNLLETLP-DSIGLLDNLKILDVSG  286 (516)
Q Consensus       209 ~L~~L~L~~~~l~~l~~~~~~l~~L~~L~Ls~n~l~~l~~-~l~~l~~L~~L~Ls~n~l~~l~-~~l~~l~~L~~L~Ls~  286 (516)
                      ..+.+|+++.+++.+|..+.  +++++|+|++|+|+.+++ +|.++++|++|++++|.+..++ ..|..+++|++|++++
T Consensus        11 ~~~~~~C~~~~L~~lP~~l~--~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~l~~n~~~~i~~~~f~~l~~L~~L~l~~   88 (305)
T d1xkua_          11 HLRVVQCSDLGLEKVPKDLP--PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSK   88 (305)
T ss_dssp             ETTEEECTTSCCCSCCCSCC--TTCCEEECCSSCCCCBCTTTTTTCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECCS
T ss_pred             cCCEEEecCCCCCccCCCCC--CCCCEEECcCCcCCCcChhHhhccccccccccccccccccchhhhhCCCccCEecccC
Confidence            46778999999999988664  689999999999999975 6899999999999999999884 5788999999999999


Q ss_pred             CCCCCCCcccccCCCCcEEeCCCCCCCcCChhhhhcCCCCcEEecCCCCCcc---ccchhcCCCCCcEEEccCCCCCCcc
Q 010182          287 NKLSALPDSISHCRSLVELDASFNRLAYLPTNIGHELVNLQKLLVPLNKIRF---LPTSIGEMASLRHLDAHFNELHGLP  363 (516)
Q Consensus       287 n~l~~l~~~l~~l~~L~~L~L~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~~---l~~~l~~l~~L~~L~Ls~n~l~~l~  363 (516)
                      |+++.+|..+  ...+..|++..|.+..++...+.....+..++...|....   .+..+..+++|+.+++++|.++.++
T Consensus        89 n~l~~l~~~~--~~~l~~L~~~~n~l~~l~~~~~~~~~~~~~l~~~~n~~~~~~~~~~~~~~l~~L~~l~l~~n~l~~l~  166 (305)
T d1xkua_          89 NQLKELPEKM--PKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIP  166 (305)
T ss_dssp             SCCSBCCSSC--CTTCCEEECCSSCCCBBCHHHHTTCTTCCEEECCSSCCCGGGBCTTGGGGCTTCCEEECCSSCCCSCC
T ss_pred             CccCcCccch--hhhhhhhhccccchhhhhhhhhhccccccccccccccccccCCCccccccccccCccccccCCccccC
Confidence            9999887654  4678999999999998888888778888888888876552   2446777888999999999988886


Q ss_pred             hhhCCCCCCcEEEcccCCCCCCCcchhhcCCCCccEEeccCCCCCCch-hhhcCCCcccEEecccCCCCCCCHHHHhchh
Q 010182          364 ATIGKLTNLEILNVSSNFTDMKELPETFGELTNLKELDLSNNQIHALP-NTFGRLDKLIKLNLEENPMVIPPVEVVKEGV  442 (516)
Q Consensus       364 ~~l~~l~~L~~L~L~~n~~~~~~l~~~l~~l~~L~~L~L~~n~i~~lp-~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~~  442 (516)
                      ..+  +++|+.|++++|... ...+..+..++.++.|++++|.++.++ .++..+++|++|+|++|+|+.++..      
T Consensus       167 ~~~--~~~L~~L~l~~n~~~-~~~~~~~~~~~~l~~L~~s~n~l~~~~~~~~~~l~~L~~L~L~~N~L~~lp~~------  237 (305)
T d1xkua_         167 QGL--PPSLTELHLDGNKIT-KVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGG------  237 (305)
T ss_dssp             SSC--CTTCSEEECTTSCCC-EECTGGGTTCTTCCEEECCSSCCCEECTTTGGGSTTCCEEECCSSCCSSCCTT------
T ss_pred             ccc--CCccCEEECCCCcCC-CCChhHhhccccccccccccccccccccccccccccceeeecccccccccccc------
Confidence            543  578999999998654 344567888899999999999999875 7788899999999999998876532      


Q ss_pred             HHHHHHHhhhhhhHhHHHhhhcccccccccCCCCCCCC------ccccccccEEEccCCcccc
Q 010182          443 GAVKTFMAKRWLDILLEEERRSMLKLEGNNNEGEQMPT------GWLTRSTSWLKTVGENVSG  499 (516)
Q Consensus       443 ~~~~~~~~~~~l~~~~~~~~l~~l~L~~N~i~~~~~~~------~~~~~~l~~l~l~~N~ls~  499 (516)
                                    +...++++.++|++|+|+......      .....+++.+++++|.+..
T Consensus       238 --------------l~~l~~L~~L~Ls~N~i~~i~~~~f~~~~~~~~~~~L~~L~L~~N~~~~  286 (305)
T d1xkua_         238 --------------LADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQY  286 (305)
T ss_dssp             --------------TTTCSSCCEEECCSSCCCCCCTTSSSCSSCCTTSCCCSEEECCSSSSCG
T ss_pred             --------------cccccCCCEEECCCCccCccChhhccCcchhcccCCCCEEECCCCcCcc
Confidence                          124567888999999988653322      2345678899999998863



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure